HHsearch alignment for GI: 254781099 and conserved domain: cd02040

>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=91.72  E-value=0.14  Score=29.92  Aligned_cols=31  Identities=35%  Similarity=0.394  Sum_probs=0.0

Q ss_pred             CEEEEE--CCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             689960--3457521578999999873100000
Q gi|254781099|r  114 PFIAVT--GTNGKSSTVALISHVLRKNGYDVQL  144 (468)
Q Consensus       114 ~vI~VT--GT~GKTTt~~ll~~iL~~~g~~~~~  144 (468)
T Consensus         2 r~Iai~GKGGVGKTTtavNLA~aLa~~GkkVll   34 (270)
T cd02040           2 RQIAIYGKGGIGKSTTTQNLSAALAEMGKKVMI   34 (270)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             589997998577899999999999987994999