HHsearch alignment for GI: 254781099 and conserved domain: cd05292

>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=95.12  E-value=0.25  Score=28.27  Aligned_cols=69  Identities=16%  Similarity=0.192  Sum_probs=45.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHH----HHHHHH----CC-CEEECCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             79998368548999999998598--69998189647----889997----89-899645315722588899888868567
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCA----VKQAKD----MG-IEVIDFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~----~~~l~~----~g-~~~~~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
T Consensus         2 KI~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~~~~~~l~daDvVVitaG~~rk~   81 (308)
T cd05292           2 KVAIVGAGFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYAGDYADCKGADVVVITAGANQKP   81 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHHHCCCCEEEECCCCCCCC
T ss_conf             79999948889999999986799887999918898451256876624103688168409999977999999899999998