Query         gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 468
No_of_seqs    261 out of 7845
Neff          8.3 
Searched_HMMs 39220
Date          Mon May 30 05:06:11 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781099.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK01390 murD UDP-N-acetylmura 100.0       0       0  867.6  34.4  449    2-452     3-457 (457)
  2 PRK02472 murD UDP-N-acetylmura 100.0       0       0  833.8  33.6  436    1-453     1-449 (450)
  3 PRK02006 murD UDP-N-acetylmura 100.0       0       0  831.9  31.7  447    4-453     3-495 (501)
  4 PRK01438 murD UDP-N-acetylmura 100.0       0       0  820.6  32.6  447    3-454     9-479 (481)
  5 PRK02705 murD UDP-N-acetylmura 100.0       0       0  809.8  33.2  430   11-452     3-456 (459)
  6 PRK04308 murD UDP-N-acetylmura 100.0       0       0  812.3  31.1  431    5-451     2-445 (445)
  7 PRK03806 murD UDP-N-acetylmura 100.0       0       0  811.4  29.4  428    3-452     1-438 (438)
  8 PRK03803 murD UDP-N-acetylmura 100.0       0       0  803.4  31.8  433    1-451     1-447 (448)
  9 PRK01368 murD UDP-N-acetylmura 100.0       0       0  797.9  33.2  436    3-451     1-446 (450)
 10 PRK03369 murD UDP-N-acetylmura 100.0       0       0  799.5  30.0  435    7-451    11-485 (487)
 11 PRK04690 murD UDP-N-acetylmura 100.0       0       0  797.6  29.2  441    1-456     1-467 (468)
 12 COG0771 MurD UDP-N-acetylmuram 100.0       0       0  796.3  30.1  437    3-453     2-448 (448)
 13 PRK00141 murD UDP-N-acetylmura 100.0       0       0  793.9  31.5  438    4-451    14-468 (476)
 14 TIGR01087 murD UDP-N-acetylmur 100.0       0       0  803.6  23.1  433   10-450     1-476 (476)
 15 PRK01710 murD UDP-N-acetylmura 100.0       0       0  788.0  32.5  429    5-451    11-458 (458)
 16 PRK04663 murD UDP-N-acetylmura 100.0       0       0  788.4  29.0  427    3-452     1-438 (438)
 17 PRK00683 murD UDP-N-acetylmura 100.0       0       0  759.6  25.5  408    9-455     4-418 (418)
 18 PRK03815 murD UDP-N-acetylmura 100.0       0       0  702.7  22.3  394   10-451     2-401 (401)
 19 PRK00421 murC UDP-N-acetylmura 100.0       0       0  542.0  28.5  404    7-429     7-446 (459)
 20 TIGR01082 murC UDP-N-acetylmur 100.0       0       0  478.2  22.5  400   10-425     1-478 (491)
 21 COG0773 MurC UDP-N-acetylmuram 100.0       0       0  450.9  25.2  392   10-426     9-442 (459)
 22 PRK00139 murE UDP-N-acetylmura 100.0       0       0  416.8  18.9  320  109-432    96-457 (481)
 23 TIGR01085 murE UDP-N-acetylmur 100.0       0       0  404.6  13.3  314  110-425    85-466 (494)
 24 PRK10773 murF UDP-N-acetylmura 100.0       0       0  391.7  20.2  323  110-452    97-447 (452)
 25 PRK11929 putative bifunctional 100.0       0       0  395.7  15.1  361   78-454   537-946 (953)
 26 PRK11929 putative bifunctional 100.0       0       0  387.3  19.8  340  109-452   107-501 (953)
 27 TIGR01143 murF UDP-N-acetylmur 100.0       0       0  387.5  16.2  331  109-451    78-462 (462)
 28 PRK11930 putative bifunctional 100.0       0       0  370.6  15.2  329  109-453   106-458 (824)
 29 COG0770 MurF UDP-N-acetylmuram 100.0       0       0  363.6  16.2  325  110-453   100-450 (451)
 30 TIGR01081 mpl UDP-N-acetylmura 100.0       0       0  348.8  20.9  404   10-427     1-445 (459)
 31 COG0769 MurE UDP-N-acetylmuram 100.0   1E-41       0  307.1  12.9  321  111-433    89-454 (475)
 32 TIGR02068 cya_phycin_syn cyano 100.0 2.9E-35 7.4E-40  262.5  16.5  345   71-426   454-860 (876)
 33 pfam08245 Mur_ligase_M Mur lig 100.0 3.1E-33   8E-38  248.5   5.7  175  118-292     1-188 (188)
 34 PRK10846 bifunctional folylpol  99.9 2.7E-26 6.9E-31  200.6  16.4  327   80-425    12-401 (416)
 35 COG0285 FolC Folylpolyglutamat  99.9 1.7E-25 4.4E-30  195.0  17.2  304  111-431    42-411 (427)
 36 TIGR01499 folC FolC bifunction  99.9 2.9E-24 7.4E-29  186.6   9.3  258  113-373    21-357 (460)
 37 KOG2525 consensus               99.5 5.5E-14 1.4E-18  115.6   8.8  211  112-343    71-353 (496)
 38 pfam02875 Mur_ligase_C Mur lig  98.5 8.5E-08 2.2E-12   72.9   3.6   70  312-382     1-76  (87)
 39 PRK13984 putative oxidoreducta  98.1 2.8E-05 7.2E-10   55.5   9.4   68    7-74    282-378 (604)
 40 PRK12814 putative NADPH-depend  98.1 3.1E-05 7.8E-10   55.3   8.8   69    7-75    192-289 (652)
 41 cd01075 NAD_bind_Leu_Phe_Val_D  98.0 0.00026 6.7E-09   48.9  11.7  110    3-140    23-133 (200)
 42 PRK12771 putative glutamate sy  97.9 8.9E-05 2.3E-09   52.1   9.0   68    7-74    136-232 (560)
 43 PRK08306 dipicolinate synthase  97.9   6E-05 1.5E-09   53.3   7.4   61    7-70      1-61  (296)
 44 PRK12809 putative oxidoreducta  97.9 0.00012   3E-09   51.2   8.4   68    7-74    309-405 (639)
 45 PRK12831 putative oxidoreducta  97.8 0.00018 4.7E-09   49.9   8.8   35    7-41    139-173 (464)
 46 PRK12769 putative oxidoreducta  97.8 0.00017 4.3E-09   50.1   8.6   68    7-74    326-422 (654)
 47 PRK07417 arogenate dehydrogena  97.8 0.00011 2.8E-09   51.4   7.6   63    9-71      2-65  (280)
 48 pfam03446 NAD_binding_2 NAD bi  97.8 0.00019 4.9E-09   49.8   8.8  113    9-141     2-115 (163)
 49 PRK12778 putative bifunctional  97.8 0.00011 2.9E-09   51.4   7.6   15   82-96    114-128 (760)
 50 PRK12810 gltD glutamate syntha  97.8 0.00022 5.7E-09   49.3   8.9   35    7-41    142-176 (472)
 51 PRK09853 putative selenate red  97.8 0.00013 3.2E-09   51.1   7.6   70    7-76    549-646 (1032)
 52 PRK11749 putative oxidoreducta  97.7 0.00027 6.8E-09   48.8   8.5   36    6-41    138-173 (460)
 53 TIGR03315 Se_ygfK putative sel  97.7 0.00017 4.3E-09   50.2   7.4   68    7-74    536-631 (1012)
 54 TIGR02853 spore_dpaA dipicolin  97.7 6.3E-05 1.6E-09   53.1   5.0   45  174-223    86-133 (288)
 55 pfam03721 UDPG_MGDP_dh_N UDP-g  97.7 0.00099 2.5E-08   44.9  11.0  119   10-140     2-139 (185)
 56 PRK07502 cyclohexadienyl dehyd  97.7  0.0002   5E-09   49.7   7.1   63    9-71      7-73  (307)
 57 PRK11064 wecC UDP-N-acetyl-D-m  97.6  0.0015 3.8E-08   43.6  11.1  117    9-137     4-136 (415)
 58 PRK09310 aroDE bifunctional 3-  97.6  0.0013 3.3E-08   44.0  10.8   50  332-385   312-367 (477)
 59 PRK12775 putative trifunctiona  97.6 0.00069 1.8E-08   45.9   8.6   69    7-75    431-530 (993)
 60 PRK11559 garR tartronate semia  97.5 0.00025 6.4E-09   49.0   6.2  113    9-140     2-114 (295)
 61 PRK08507 prephenate dehydrogen  97.5  0.0004   1E-08   47.6   7.1   62   10-71      2-65  (275)
 62 TIGR03026 NDP-sugDHase nucleot  97.5  0.0012 2.9E-08   44.4   9.4  117   10-138     2-138 (411)
 63 PRK09599 6-phosphogluconate de  97.5  0.0019 4.9E-08   42.9  10.4  110   10-141     2-114 (301)
 64 PRK03659 glutathione-regulated  97.5  0.0012 3.1E-08   44.2   8.9  140  316-460   436-592 (602)
 65 PRK12490 6-phosphogluconate de  97.5  0.0014 3.5E-08   43.9   9.1  110   10-141     2-114 (298)
 66 TIGR01318 gltD_gamma_fam gluta  97.5 0.00068 1.7E-08   46.0   7.5   69    7-77    142-239 (480)
 67 COG1648 CysG Siroheme synthase  97.4  0.0013 3.2E-08   44.2   8.7  119    4-127     8-134 (210)
 68 COG1052 LdhA Lactate dehydroge  97.4 0.00045 1.1E-08   47.2   6.3   12   85-96     82-93  (324)
 69 PRK07574 formate dehydrogenase  97.4   0.001 2.6E-08   44.8   7.4   92   21-136    58-161 (385)
 70 PRK03562 glutathione-regulated  97.3  0.0017 4.5E-08   43.2   8.5   96  315-415   434-532 (615)
 71 PRK06718 precorrin-2 dehydroge  97.3  0.0025 6.4E-08   42.1   8.8  129    4-137     6-142 (202)
 72 TIGR01316 gltA glutamate synth  97.3   0.001 2.6E-08   44.7   6.8   92    8-144   142-235 (462)
 73 PRK13243 glyoxylate reductase;  97.3  0.0015 3.9E-08   43.5   7.5   82    9-97      3-95  (333)
 74 KOG0029 consensus               97.3  0.0015 3.9E-08   43.6   7.4   78    6-96     13-92  (501)
 75 KOG0068 consensus               97.3  0.0019 4.8E-08   43.0   7.8   81   10-97      8-98  (406)
 76 TIGR00507 aroE shikimate 5-deh  97.3   0.003 7.7E-08   41.5   8.8   77    3-79    115-207 (286)
 77 KOG0409 consensus               97.3 0.00059 1.5E-08   46.4   5.2   63    8-70     35-97  (327)
 78 cd01065 NAD_bind_Shikimate_DH   97.2  0.0065 1.7E-07   39.2  10.4   43    5-47     16-59  (155)
 79 PRK12826 3-ketoacyl-(acyl-carr  97.2  0.0035 8.8E-08   41.1   9.0   52    3-54      1-57  (253)
 80 PRK12779 putative bifunctional  97.2  0.0014 3.5E-08   43.9   6.8   69    7-75    305-403 (944)
 81 PRK06500 short chain dehydroge  97.2  0.0036 9.2E-08   41.0   8.9   47    3-49      1-48  (249)
 82 PRK07060 short chain dehydroge  97.2  0.0037 9.5E-08   40.9   8.8   50    1-50      1-52  (245)
 83 PRK07097 gluconate 5-dehydroge  97.2  0.0052 1.3E-07   39.9   9.6  137    1-138     3-164 (265)
 84 pfam01488 Shikimate_DH Shikima  97.2  0.0021 5.3E-08   42.7   7.4   74    2-75      6-86  (134)
 85 PRK12825 fabG 3-ketoacyl-(acyl  97.2  0.0035 8.9E-08   41.1   8.6   77    3-79      2-100 (250)
 86 TIGR01317 GOGAT_sm_gam glutama  97.2 0.00065 1.7E-08   46.1   4.7   72    7-80    150-264 (517)
 87 COG0677 WecC UDP-N-acetyl-D-ma  97.2   0.016 4.1E-07   36.5  11.8   41    9-49     10-50  (436)
 88 COG0569 TrkA K+ transport syst  97.2  0.0042 1.1E-07   40.5   8.8   83    9-95      1-95  (225)
 89 PRK00258 aroE shikimate 5-dehy  97.2  0.0068 1.7E-07   39.1   9.8   10    9-18      6-15  (275)
 90 pfam02826 2-Hacid_dh_C D-isome  97.1  0.0034 8.8E-08   41.1   8.1  110    4-137    32-141 (176)
 91 COG1748 LYS9 Saccharopine dehy  97.1  0.0056 1.4E-07   39.7   8.8  108    9-120     2-122 (389)
 92 cd05313 NAD_bind_2_Glu_DH NAD(  97.1   0.026 6.8E-07   35.0  12.3  112    4-141    34-172 (254)
 93 PRK13581 D-3-phosphoglycerate   97.1  0.0055 1.4E-07   39.7   8.8   66    4-71    134-199 (524)
 94 COG1064 AdhP Zn-dependent alco  97.1   0.005 1.3E-07   40.0   8.5   13  196-208   118-130 (339)
 95 PRK06545 prephenate dehydrogen  97.1  0.0031 7.8E-08   41.5   7.3   63    9-71      1-67  (357)
 96 cd05211 NAD_bind_Glu_Leu_Phe_V  97.1   0.018 4.5E-07   36.2  11.1  108    4-140    19-144 (217)
 97 PRK12742 oxidoreductase; Provi  97.0   0.015 3.8E-07   36.7  10.6   40    3-42      1-41  (237)
 98 PRK06125 short chain dehydroge  97.0   0.013 3.4E-07   37.1  10.3   45    1-46      1-46  (259)
 99 pfam02254 TrkA_N TrkA-N domain  97.0  0.0055 1.4E-07   39.7   8.1   60   11-71      1-68  (115)
100 COG0111 SerA Phosphoglycerate   97.0  0.0017 4.4E-08   43.2   5.5   66    5-71    139-204 (324)
101 PRK13394 3-hydroxybutyrate deh  97.0  0.0065 1.6E-07   39.2   8.4   77    3-79      2-99  (262)
102 COG2084 MmsB 3-hydroxyisobutyr  97.0  0.0029 7.3E-08   41.7   6.6  114    9-141     1-115 (286)
103 cd01076 NAD_bind_1_Glu_DH NAD(  97.0   0.031   8E-07   34.5  11.8  108    4-140    27-153 (227)
104 COG0287 TyrA Prephenate dehydr  97.0  0.0019 4.8E-08   42.9   5.6   68    8-77      3-75  (279)
105 PRK05868 hypothetical protein;  97.0  0.0028 7.1E-08   41.8   6.4   34    9-42      2-35  (372)
106 pfam00208 ELFV_dehydrog Glutam  96.9   0.014 3.7E-07   36.8   9.8  109    3-140    27-157 (237)
107 COG0169 AroE Shikimate 5-dehyd  96.9   0.023 5.8E-07   35.5  10.8   41    7-47    125-166 (283)
108 pfam01210 NAD_Gly3P_dh_N NAD-d  96.9  0.0047 1.2E-07   40.2   7.2   43    9-51      1-43  (159)
109 PRK09424 pntA NAD(P) transhydr  96.9  0.0043 1.1E-07   40.5   7.0   50    8-57    165-214 (510)
110 PRK07814 short chain dehydroge  96.9  0.0082 2.1E-07   38.5   8.4   78    1-78      3-101 (263)
111 PRK07208 hypothetical protein;  96.9  0.0019 4.8E-08   42.9   5.1   35    7-41      2-36  (474)
112 PRK07062 short chain dehydroge  96.9   0.012 3.2E-07   37.3   9.2   78    1-78      1-101 (265)
113 PRK07236 hypothetical protein;  96.9  0.0016   4E-08   43.5   4.6   40    3-42      1-40  (386)
114 PRK12481 2-deoxy-D-gluconate 3  96.9   0.009 2.3E-07   38.3   8.4   54    1-54      1-57  (251)
115 PRK05653 fabG 3-ketoacyl-(acyl  96.9  0.0098 2.5E-07   38.0   8.5   50    5-54      2-56  (246)
116 PRK12480 D-lactate dehydrogena  96.8  0.0044 1.1E-07   40.4   6.5   32    9-40      2-34  (330)
117 CHL00194 ycf39 Ycf39; Provisio  96.8   0.018 4.6E-07   36.2   9.5   62   10-71      2-71  (319)
118 PRK12939 short chain dehydroge  96.8   0.012 3.1E-07   37.4   8.5   78    1-79      1-99  (250)
119 pfam00670 AdoHcyase_NAD S-aden  96.8  0.0036 9.1E-08   41.0   5.7   68    7-75     22-89  (162)
120 PRK06847 hypothetical protein;  96.8  0.0023 5.8E-08   42.4   4.7   36    7-42      3-38  (375)
121 PRK09072 short chain dehydroge  96.8  0.0087 2.2E-07   38.3   7.6   45    5-49      2-47  (262)
122 PRK07576 short chain dehydroge  96.8   0.021 5.3E-07   35.8   9.4   52    2-53      2-58  (260)
123 PRK08220 2,3-dihydroxybenzoate  96.7  0.0057 1.5E-07   39.6   6.5   44    1-44      1-45  (253)
124 PRK04965 nitric oxide reductas  96.7   0.021 5.3E-07   35.7   9.4   31    9-39      3-35  (378)
125 pfam00743 FMO-like Flavin-bind  96.7  0.0027 6.9E-08   41.8   4.8   34    8-41      1-34  (532)
126 PRK05867 short chain dehydroge  96.7   0.006 1.5E-07   39.5   6.5   54    1-54      2-60  (253)
127 PRK08993 2-deoxy-D-gluconate 3  96.7   0.014 3.5E-07   37.0   8.3   54    1-54      3-59  (253)
128 TIGR01505 tartro_sem_red 2-hyd  96.7  0.0018 4.6E-08   43.0   3.7   68   10-80      1-68  (291)
129 PRK08936 glucose-1-dehydrogena  96.7   0.024   6E-07   35.4   9.4   76    4-79      3-100 (261)
130 PRK07523 gluconate 5-dehydroge  96.7  0.0066 1.7E-07   39.2   6.5   47    1-47      2-49  (251)
131 PRK06182 short chain dehydroge  96.7   0.013 3.4E-07   37.1   8.0   50    6-55      1-51  (273)
132 PRK05993 short chain dehydroge  96.7   0.015 3.9E-07   36.7   8.3   51    1-55      1-52  (277)
133 PRK12746 short chain dehydroge  96.7   0.025 6.3E-07   35.2   9.3   52    3-54      1-58  (254)
134 PRK08655 prephenate dehydrogen  96.7  0.0058 1.5E-07   39.5   6.1   67   10-78      2-70  (441)
135 PRK06719 precorrin-2 dehydroge  96.7   0.011 2.7E-07   37.7   7.4  117    4-127     9-131 (157)
136 PRK08628 short chain dehydroge  96.6   0.024 6.1E-07   35.3   9.1   52    1-53      1-56  (258)
137 cd01080 NAD_bind_m-THF_DH_Cycl  96.6   0.021 5.4E-07   35.7   8.8  120    5-138    41-167 (168)
138 PRK06436 glycerate dehydrogena  96.6  0.0072 1.8E-07   38.9   6.4   34    6-39    120-153 (303)
139 PRK00045 hemA glutamyl-tRNA re  96.6  0.0092 2.3E-07   38.2   6.9   19  443-461   406-424 (429)
140 PRK12859 3-ketoacyl-(acyl-carr  96.6   0.026 6.7E-07   35.0   9.2   36    3-38      1-39  (257)
141 PRK06124 gluconate 5-dehydroge  96.6   0.016   4E-07   36.6   8.0   54    1-54      7-65  (259)
142 PRK08410 2-hydroxyacid dehydro  96.6   0.013 3.2E-07   37.2   7.5   67   26-97     18-91  (311)
143 PRK12550 shikimate 5-dehydroge  96.6   0.042 1.1E-06   33.6  10.1   28  112-140     8-36  (272)
144 PRK05557 fabG 3-ketoacyl-(acyl  96.6   0.023 5.9E-07   35.4   8.7   75    5-79      2-98  (248)
145 PRK11790 D-3-phosphoglycerate   96.6  0.0093 2.4E-07   38.1   6.7   82   10-97     12-103 (409)
146 cd05212 NAD_bind_m-THF_DH_Cycl  96.6   0.038 9.6E-07   34.0   9.7  108    5-138    25-139 (140)
147 PRK09754 phenylpropionate diox  96.6   0.035   9E-07   34.1   9.6   32    7-38      2-35  (400)
148 PRK05565 fabG 3-ketoacyl-(acyl  96.6    0.03 7.7E-07   34.6   9.2   75    5-79      2-98  (247)
149 PRK06113 7-alpha-hydroxysteroi  96.5   0.034 8.6E-07   34.3   9.2   52    4-55      7-63  (255)
150 KOG0685 consensus               96.5    0.05 1.3E-06   33.1  10.1  106    7-136    20-129 (498)
151 cd05213 NAD_bind_Glutamyl_tRNA  96.5   0.011 2.8E-07   37.6   6.7   75  344-431   174-251 (311)
152 PRK07825 short chain dehydroge  96.5   0.015 3.7E-07   36.8   7.3   46    4-49      1-47  (273)
153 PRK05872 short chain dehydroge  96.5  0.0098 2.5E-07   38.0   6.4   49    1-49      2-51  (296)
154 PRK06398 aldose dehydrogenase;  96.5  0.0064 1.6E-07   39.3   5.4   40    3-42      1-41  (256)
155 PRK12829 short chain dehydroge  96.5  0.0095 2.4E-07   38.1   6.1   46    3-48      6-52  (264)
156 PRK11883 protoporphyrinogen ox  96.4  0.0057 1.5E-07   39.6   4.9   33    9-41      1-35  (452)
157 PRK08213 gluconate 5-dehydroge  96.4   0.009 2.3E-07   38.3   5.9   54    1-54      5-63  (259)
158 PRK00257 erythronate-4-phospha  96.4   0.012 3.1E-07   37.4   6.5   26   68-97     61-86  (379)
159 PRK07530 3-hydroxybutyryl-CoA   96.4  0.0088 2.3E-07   38.3   5.8   41    3-45      1-41  (292)
160 PRK06198 short chain dehydroge  96.4   0.029 7.5E-07   34.7   8.4  135    3-139     1-163 (268)
161 pfam02882 THF_DHG_CYH_C Tetrah  96.4   0.046 1.2E-06   33.3   9.4  118    5-139    33-157 (159)
162 PRK10637 cysG siroheme synthas  96.4   0.052 1.3E-06   33.0   9.6  119    4-127     8-134 (457)
163 PRK00066 ldh L-lactate dehydro  96.4   0.052 1.3E-06   33.0   9.6   73    6-78      4-87  (315)
164 pfam01262 AlaDh_PNT_C Alanine   96.4   0.012 2.9E-07   37.5   6.2   65    7-71     19-91  (150)
165 PRK12744 short chain dehydroge  96.4   0.061 1.6E-06   32.5   9.9   77    1-77      1-102 (257)
166 PRK08163 salicylate hydroxylas  96.4  0.0073 1.8E-07   38.9   5.2   35    7-41      3-37  (396)
167 PRK13940 glutamyl-tRNA reducta  96.4    0.02 5.1E-07   35.8   7.2   16  440-456   397-412 (414)
168 PRK07233 hypothetical protein;  96.3  0.0056 1.4E-07   39.7   4.4   32   10-41      1-32  (430)
169 PRK09496 trkA potassium transp  96.3   0.021 5.2E-07   35.8   7.2   81   10-94      2-93  (455)
170 PRK01747 mnmC 5-methylaminomet  96.3  0.0073 1.8E-07   38.9   4.8   31    9-39    257-287 (660)
171 PRK07066 3-hydroxybutyryl-CoA   96.3   0.013 3.2E-07   37.2   6.0   40    3-44      4-43  (321)
172 PRK06194 hypothetical protein;  96.3   0.014 3.7E-07   36.8   6.2   52    3-54      1-57  (301)
173 PRK07424 bifunctional sterol d  96.3   0.018 4.5E-07   36.2   6.7   27  218-244   185-211 (410)
174 PRK12936 3-ketoacyl-(acyl-carr  96.3   0.031 7.9E-07   34.5   7.9   47    3-49      1-48  (245)
175 PRK12429 3-hydroxybutyrate deh  96.3   0.045 1.1E-06   33.4   8.6   48    6-53      2-54  (258)
176 PRK05876 short chain dehydroge  96.3   0.015 3.9E-07   36.7   6.2   52    3-54      1-57  (275)
177 PRK07041 short chain dehydroge  96.3   0.018 4.6E-07   36.2   6.6   46    1-47      1-47  (240)
178 PRK12409 D-amino acid dehydrog  96.3  0.0075 1.9E-07   38.8   4.6   33    9-41      2-34  (410)
179 PRK06841 short chain dehydroge  96.3   0.042 1.1E-06   33.6   8.4   45    4-48     11-56  (255)
180 PRK06753 hypothetical protein;  96.3  0.0073 1.9E-07   38.9   4.5   32   10-41      2-33  (373)
181 COG0373 HemA Glutamyl-tRNA red  96.2   0.074 1.9E-06   31.9   9.7   16  440-455   397-412 (414)
182 PRK13512 coenzyme A disulfide   96.2   0.062 1.6E-06   32.4   9.2   33    9-41      2-36  (438)
183 TIGR03385 CoA_CoA_reduc CoA-di  96.2   0.038 9.6E-07   33.9   8.1   24  147-170   147-170 (427)
184 PRK09880 L-idonate 5-dehydroge  96.2   0.035   9E-07   34.1   7.9   84  323-413   234-330 (343)
185 TIGR03451 mycoS_dep_FDH mycoth  96.2   0.041   1E-06   33.7   8.2   92  324-421   245-351 (358)
186 PRK05808 3-hydroxybutyryl-CoA   96.2   0.014 3.7E-07   36.8   5.9   37    9-45      4-40  (282)
187 PRK07588 hypothetical protein;  96.2  0.0082 2.1E-07   38.5   4.5   33   10-42      2-34  (391)
188 PRK12770 putative glutamate sy  96.2  0.0095 2.4E-07   38.1   4.8   35    7-41     16-50  (350)
189 PTZ00117 malate dehydrogenase;  96.2   0.036 9.2E-07   34.1   7.7   70    9-78      2-83  (313)
190 PRK12367 short chain dehydroge  96.1   0.027 6.9E-07   34.9   7.0   89    2-90     11-108 (250)
191 PRK06129 3-hydroxyacyl-CoA deh  96.1   0.017 4.4E-07   36.3   5.8   37    9-45      3-39  (308)
192 PRK08703 short chain dehydroge  96.1   0.021 5.3E-07   35.8   6.2   44    3-46      1-45  (239)
193 PRK06200 2,3-dihydroxy-2,3-dih  96.1    0.02 5.2E-07   35.8   6.2   47    3-49      1-48  (263)
194 PRK08265 short chain dehydroge  96.1   0.022 5.5E-07   35.6   6.3   47    3-49      1-48  (261)
195 TIGR00872 gnd_rel 6-phosphoglu  96.1   0.012 3.1E-07   37.4   5.0   51    9-59      2-54  (341)
196 PRK08277 D-mannonate oxidoredu  96.1   0.022 5.6E-07   35.6   6.3   52    2-53      4-60  (278)
197 PTZ00142 6-phosphogluconate de  96.1   0.015 3.8E-07   36.7   5.4  112    8-141     5-125 (474)
198 PRK06932 glycerate dehydrogena  96.1   0.018 4.6E-07   36.2   5.8   67   27-97     20-93  (314)
199 PRK06935 2-deoxy-D-gluconate 3  96.1    0.07 1.8E-06   32.1   8.8   54    1-54      8-65  (258)
200 PRK08339 short chain dehydroge  96.1   0.023 5.8E-07   35.5   6.3   45    1-46      2-47  (263)
201 PRK06172 short chain dehydroge  96.1   0.025 6.5E-07   35.1   6.5   53    1-54      1-58  (253)
202 PRK07677 short chain dehydroge  96.1   0.094 2.4E-06   31.2   9.4   72    6-77      1-93  (254)
203 PRK08605 D-lactate dehydrogena  96.1   0.013 3.4E-07   37.1   5.1   71    9-98      2-75  (332)
204 PRK07531 bifunctional 3-hydrox  96.1    0.02 5.1E-07   35.9   6.0   35    9-43      3-37  (489)
205 cd05293 LDH_1 A subgroup of L-  96.1   0.023 5.9E-07   35.4   6.3   73    7-79      2-86  (312)
206 PRK06487 glycerate dehydrogena  96.1   0.013 3.4E-07   37.1   5.0   67   27-97     21-94  (317)
207 PRK05875 short chain dehydroge  96.0   0.025 6.4E-07   35.1   6.5   44    1-45      1-45  (277)
208 PRK05396 tdh L-threonine 3-deh  96.0   0.064 1.6E-06   32.4   8.5   99  321-423   229-338 (341)
209 PRK08017 short chain dehydroge  96.0   0.066 1.7E-06   32.3   8.5   45    9-53      3-48  (256)
210 PRK08862 short chain dehydroge  96.0   0.024 6.1E-07   35.3   6.3   42    5-46      2-44  (227)
211 PRK08293 3-hydroxybutyryl-CoA   96.0    0.02 5.2E-07   35.8   5.9   36    9-44      4-39  (288)
212 pfam02737 3HCDH_N 3-hydroxyacy  96.0   0.018 4.7E-07   36.1   5.6   35   10-44      1-35  (180)
213 TIGR03467 HpnE squalene-associ  96.0    0.01 2.6E-07   37.8   4.3   31   11-41      1-31  (430)
214 PRK06035 3-hydroxyacyl-CoA deh  96.0    0.02 5.1E-07   35.9   5.8   36    9-44      4-39  (291)
215 PRK07819 3-hydroxybutyryl-CoA   96.0   0.022 5.6E-07   35.6   5.9   36    9-44      3-38  (284)
216 PRK11880 pyrroline-5-carboxyla  96.0    0.06 1.5E-06   32.6   8.2   67    9-77      3-73  (267)
217 PRK08085 gluconate 5-dehydroge  96.0   0.029 7.5E-07   34.7   6.5   53    2-54      3-60  (254)
218 KOG0399 consensus               96.0   0.036 9.3E-07   34.1   6.9   11  116-126  1373-1383(2142)
219 cd05291 HicDH_like L-2-hydroxy  96.0   0.068 1.7E-06   32.2   8.3   70    9-78      1-82  (306)
220 PRK07660 consensus              95.9   0.023   6E-07   35.4   5.9   36    9-44      4-39  (283)
221 KOG0069 consensus               95.9   0.028 7.3E-07   34.8   6.3   27   67-97     86-112 (336)
222 PRK06567 putative bifunctional  95.9  0.0083 2.1E-07   38.5   3.5   33    6-38    399-431 (1048)
223 pfam00389 2-Hacid_dh D-isomer   95.9   0.029 7.4E-07   34.8   6.3   72   22-97     10-89  (313)
224 PRK07538 hypothetical protein;  95.9   0.013 3.3E-07   37.1   4.5   32   10-41      2-33  (413)
225 PRK09134 short chain dehydroge  95.9    0.11 2.7E-06   30.8   9.2   75    3-77      4-100 (256)
226 pfam03435 Saccharop_dh Sacchar  95.9    0.12 3.1E-06   30.5   9.4   83   11-97      1-96  (384)
227 PRK06475 salicylate hydroxylas  95.9   0.013 3.3E-07   37.2   4.4   33    9-41      3-35  (400)
228 PRK09496 trkA potassium transp  95.9    0.07 1.8E-06   32.1   8.2   16  282-298   309-324 (455)
229 PRK05786 fabG 3-ketoacyl-(acyl  95.9    0.03 7.7E-07   34.6   6.3   43    6-48      3-46  (238)
230 PRK09260 3-hydroxybutyryl-CoA   95.9   0.024 6.1E-07   35.3   5.7   36    9-44      3-38  (289)
231 PRK05562 precorrin-2 dehydroge  95.9    0.16   4E-06   29.7  11.2  125    7-136    23-156 (222)
232 PRK08594 enoyl-(acyl carrier p  95.9   0.027 6.9E-07   34.9   6.0   40    3-42      1-43  (256)
233 PRK06114 short chain dehydroge  95.8    0.11 2.7E-06   30.8   8.9   77    2-78     10-108 (262)
234 PRK07045 putative monooxygenas  95.8   0.016 4.2E-07   36.5   4.7   34    8-41      5-38  (388)
235 PRK07774 short chain dehydroge  95.8   0.035 8.9E-07   34.2   6.4   52    3-54      1-57  (250)
236 TIGR03201 dearomat_had 6-hydro  95.8   0.041 1.1E-06   33.7   6.7   14  196-209   112-125 (349)
237 PRK09117 consensus              95.8   0.029 7.5E-07   34.7   5.8   36    9-44      3-38  (282)
238 PRK07831 short chain dehydroge  95.8   0.081 2.1E-06   31.7   8.1   39    6-44     14-54  (261)
239 TIGR02374 nitri_red_nirB nitri  95.8   0.051 1.3E-06   33.0   7.1   78   12-96    151-263 (813)
240 pfam05368 NmrA NmrA-like famil  95.8   0.098 2.5E-06   31.1   8.5   61   11-71      1-71  (232)
241 PRK07856 short chain dehydroge  95.8   0.016 4.1E-07   36.5   4.5   41    1-42      2-43  (254)
242 COG0190 FolD 5,10-methylene-te  95.8    0.17 4.4E-06   29.4  10.3   15  149-163   169-183 (283)
243 PRK13403 ketol-acid reductoiso  95.8   0.032   8E-07   34.5   5.9   67    3-70     11-77  (335)
244 PRK06130 3-hydroxybutyryl-CoA   95.8   0.028 7.3E-07   34.8   5.7   39    7-45      4-42  (310)
245 PRK08217 fabG 3-ketoacyl-(acyl  95.7   0.037 9.4E-07   34.0   6.2   50    5-54      2-56  (253)
246 PTZ00082 L-lactate dehydrogena  95.7   0.033 8.5E-07   34.3   6.0   72    6-77      5-88  (322)
247 pfam01408 GFO_IDH_MocA Oxidore  95.7   0.093 2.4E-06   31.2   8.2   86   10-99      2-93  (120)
248 PRK07063 short chain dehydroge  95.7   0.041 1.1E-06   33.7   6.4   43    3-45      2-45  (259)
249 PRK06101 short chain dehydroge  95.7   0.057 1.5E-06   32.7   7.1   44    9-52      2-46  (241)
250 PRK07035 short chain dehydroge  95.7   0.043 1.1E-06   33.6   6.4   44    2-45      2-46  (252)
251 pfam00056 Ldh_1_N lactate/mala  95.7   0.059 1.5E-06   32.6   7.1   71   10-80      2-85  (142)
252 PRK00711 D-amino acid dehydrog  95.7    0.02   5E-07   35.9   4.7   32   10-41      2-33  (416)
253 PRK07067 sorbitol dehydrogenas  95.7    0.15 3.7E-06   29.9   9.1   46    6-51      3-50  (256)
254 PRK05479 ketol-acid reductoiso  95.7    0.04   1E-06   33.8   6.2   68    2-70     11-79  (336)
255 PRK12747 short chain dehydroge  95.7    0.13 3.4E-06   30.2   8.9   49    6-54      2-56  (252)
256 COG3349 Uncharacterized conser  95.7   0.019 4.9E-07   36.0   4.5   33    9-41      1-33  (485)
257 PRK05693 short chain dehydroge  95.7   0.093 2.4E-06   31.3   8.0   46    9-54      2-48  (274)
258 PRK09242 tropinone reductase;   95.6   0.047 1.2E-06   33.3   6.5   46    1-46      1-49  (258)
259 PRK07832 short chain dehydroge  95.6   0.093 2.4E-06   31.3   7.9   45    9-53      1-50  (272)
260 PRK06522 2-dehydropantoate 2-r  95.6   0.074 1.9E-06   31.9   7.4   47   10-56      2-48  (307)
261 PRK07231 fabG 3-ketoacyl-(acyl  95.6   0.045 1.1E-06   33.4   6.3   44    5-48      3-47  (250)
262 TIGR03206 benzo_BadH 2-hydroxy  95.6    0.11 2.7E-06   30.8   8.1   49    6-54      1-54  (250)
263 COG1023 Gnd Predicted 6-phosph  95.6   0.028 7.1E-07   34.9   5.1   46   10-55      2-47  (300)
264 PRK07109 short chain dehydroge  95.6   0.052 1.3E-06   33.0   6.5   54    1-54      1-59  (338)
265 pfam01494 FAD_binding_3 FAD bi  95.6   0.021 5.2E-07   35.8   4.4   33   10-42      3-35  (349)
266 PRK07478 short chain dehydroge  95.5   0.052 1.3E-06   33.0   6.3   52    3-54      1-57  (254)
267 PRK08268 3-hydroxybutyryl-CoA   95.5   0.045 1.1E-06   33.4   5.9   36    9-44      4-39  (503)
268 PRK07806 short chain dehydroge  95.5   0.084 2.1E-06   31.6   7.3   53    3-55      1-59  (248)
269 TIGR03219 salicylate_mono sali  95.5   0.024 6.1E-07   35.3   4.5   32   10-41      2-34  (414)
270 PRK07776 consensus              95.5   0.059 1.5E-06   32.6   6.5   48    1-49      2-50  (252)
271 PRK06720 hypothetical protein;  95.5   0.058 1.5E-06   32.7   6.4   75    1-76     10-105 (169)
272 PRK08278 short chain dehydroge  95.5   0.043 1.1E-06   33.6   5.8   40    3-42      1-41  (273)
273 PTZ00075 S-adenosyl-L-homocyst  95.5   0.042 1.1E-06   33.6   5.7   52    5-57     42-101 (476)
274 pfam07991 IlvN Acetohydroxy ac  95.5   0.046 1.2E-06   33.4   5.8   64    6-70      2-66  (165)
275 PRK05476 S-adenosyl-L-homocyst  95.4    0.04   1E-06   33.8   5.5   54    5-59     42-102 (427)
276 KOG1399 consensus               95.4    0.02 5.2E-07   35.8   4.0   34    7-40      5-38  (448)
277 COG0499 SAM1 S-adenosylhomocys  95.4   0.079   2E-06   31.7   7.0  146   23-169    61-241 (420)
278 PRK06914 short chain dehydroge  95.4    0.17 4.4E-06   29.4   8.7   44    6-49      1-45  (280)
279 PRK12491 pyrroline-5-carboxyla  95.4   0.069 1.7E-06   32.2   6.6   68    8-77      2-74  (272)
280 COG1179 Dinucleotide-utilizing  95.4   0.078   2E-06   31.8   6.9   37    3-39     25-62  (263)
281 PRK08773 2-octaprenyl-3-methyl  95.4   0.029 7.3E-07   34.8   4.6   39    3-41      1-39  (392)
282 PRK08159 enoyl-(acyl carrier p  95.4   0.089 2.3E-06   31.4   7.1   37    6-42      8-47  (272)
283 PRK07666 fabG 3-ketoacyl-(acyl  95.3    0.06 1.5E-06   32.6   6.1   51    4-54      2-57  (238)
284 cd05290 LDH_3 A subgroup of L-  95.3   0.077   2E-06   31.8   6.7   68   10-77      1-81  (307)
285 PRK08328 hypothetical protein;  95.3   0.055 1.4E-06   32.8   5.9   36    4-39     23-59  (230)
286 PRK09291 short chain dehydroge  95.3    0.12 3.1E-06   30.4   7.6   41    8-48      2-43  (257)
287 PRK04148 hypothetical protein;  95.3   0.083 2.1E-06   31.6   6.8   87    7-97     16-107 (135)
288 PRK06483 short chain dehydroge  95.3    0.18 4.6E-06   29.3   8.4   48    8-55      2-51  (236)
289 PRK12937 short chain dehydroge  95.3    0.16 4.2E-06   29.6   8.2   73    6-78      3-97  (245)
290 PRK07533 enoyl-(acyl carrier p  95.3   0.055 1.4E-06   32.8   5.8   42    3-44      1-45  (254)
291 TIGR03325 BphB_TodD cis-2,3-di  95.3   0.065 1.7E-06   32.3   6.1   45    6-50      3-48  (262)
292 PRK07680 late competence prote  95.3    0.15 3.7E-06   29.9   7.9   66   10-77      2-73  (273)
293 cd00757 ThiF_MoeB_HesA_family   95.3    0.13 3.4E-06   30.2   7.7   36    4-39     17-53  (228)
294 PRK06126 hypothetical protein;  95.3   0.033 8.5E-07   34.3   4.6   39    3-41      2-40  (545)
295 PRK05866 short chain dehydroge  95.2   0.061 1.6E-06   32.5   5.9   50    4-53     36-90  (290)
296 PRK08229 2-dehydropantoate 2-r  95.2    0.13 3.3E-06   30.3   7.6   46   10-56      4-49  (341)
297 PRK13566 anthranilate synthase  95.2    0.24 6.1E-06   28.4   9.0   28  418-445   566-593 (724)
298 COG0240 GpsA Glycerol-3-phosph  95.2    0.26 6.6E-06   28.2  10.5   42    9-50      2-43  (329)
299 pfam05221 AdoHcyase S-adenosyl  95.2   0.057 1.5E-06   32.7   5.8   52    5-57     40-98  (430)
300 PTZ00325 malate dehydrogenase;  95.2    0.23   6E-06   28.5   8.9  123    9-139     2-135 (313)
301 PRK07370 enoyl-(acyl carrier p  95.2   0.089 2.3E-06   31.4   6.6   38    1-39      1-41  (259)
302 cd00401 AdoHcyase S-adenosyl-L  95.2   0.066 1.7E-06   32.3   5.9   52    5-57     33-91  (413)
303 PRK12823 benD 1,6-dihydroxycyc  95.2   0.075 1.9E-06   31.9   6.2   41    1-41      1-42  (260)
304 PRK07985 oxidoreductase; Provi  95.2    0.22 5.7E-06   28.6   8.6   35    5-39     46-81  (294)
305 PRK06057 short chain dehydroge  95.2   0.086 2.2E-06   31.5   6.5   47    1-48      1-48  (255)
306 TIGR00292 TIGR00292 thiazole b  95.1    0.06 1.5E-06   32.5   5.7   36    5-40     18-55  (283)
307 PRK12935 acetoacetyl-CoA reduc  95.1    0.21 5.3E-06   28.8   8.4   76    3-78      1-98  (247)
308 PRK07494 2-octaprenyl-6-methox  95.1   0.043 1.1E-06   33.6   4.9   32   10-41      7-38  (386)
309 COG0059 IlvC Ketol-acid reduct  95.1     0.1 2.6E-06   31.0   6.8   67    3-70     13-80  (338)
310 PRK10309 galactitol-1-phosphat  95.1   0.083 2.1E-06   31.6   6.3   28  396-423   317-344 (347)
311 cd05292 LDH_2 A subgroup of L-  95.1    0.25 6.4E-06   28.3   8.8   69   10-78      2-81  (308)
312 COG2085 Predicted dinucleotide  95.1    0.19 4.8E-06   29.1   8.1   67    9-77      2-71  (211)
313 PRK12827 short chain dehydroge  95.1   0.069 1.7E-06   32.2   5.9   38    3-40      1-39  (251)
314 PRK08020 ubiF 2-octaprenyl-3-m  95.1   0.042 1.1E-06   33.6   4.8   34    8-41      5-38  (391)
315 PRK07479 consensus              95.1   0.084 2.1E-06   31.5   6.2   41    6-46      3-44  (252)
316 PRK13771 putative alcohol dehy  95.1    0.24 6.2E-06   28.4   8.5  101  320-426   221-332 (332)
317 PRK12428 3-alpha-hydroxysteroi  95.1   0.058 1.5E-06   32.7   5.3   39    5-43      2-41  (261)
318 PRK07792 fabG 3-ketoacyl-(acyl  95.0    0.29 7.4E-06   27.8   8.9   53    2-54      3-61  (303)
319 PRK08324 short chain dehydroge  95.0    0.29 7.4E-06   27.8   9.1   41  346-388   419-460 (676)
320 TIGR01692 HIBADH 3-hydroxyisob  95.0   0.027 6.8E-07   35.0   3.6   58   13-70      1-58  (290)
321 COG2403 Predicted GTPase [Gene  95.0    0.12 3.1E-06   30.5   6.9  131    7-144     5-160 (449)
322 PRK08945 short chain dehydroge  95.0   0.089 2.3E-06   31.4   6.2   43    4-46      9-52  (245)
323 PRK07454 short chain dehydroge  95.0   0.096 2.4E-06   31.2   6.3   52    1-54      1-57  (241)
324 PTZ00079 NADP-specific glutama  95.0     0.3 7.7E-06   27.7  13.1   15  296-310   247-261 (469)
325 PRK12828 short chain dehydroge  95.0     0.1 2.6E-06   30.9   6.4   45    1-46      1-46  (239)
326 PRK07890 short chain dehydroge  95.0   0.095 2.4E-06   31.2   6.2   48    6-53      3-55  (258)
327 pfam01266 DAO FAD dependent ox  95.0   0.044 1.1E-06   33.5   4.5   32   10-41      1-32  (309)
328 TIGR03649 ergot_EASG ergot alk  94.9   0.061 1.6E-06   32.5   5.2   87   10-96      1-100 (285)
329 PRK08226 short chain dehydroge  94.9   0.084 2.1E-06   31.5   5.9   51    3-53      1-55  (263)
330 PRK08589 short chain dehydroge  94.9    0.08   2E-06   31.7   5.8   52    3-54      1-56  (272)
331 PRK07608 hypothetical protein;  94.9   0.042 1.1E-06   33.6   4.4   33    9-41      6-38  (389)
332 PRK06184 hypothetical protein;  94.9   0.048 1.2E-06   33.2   4.7   39    3-41      1-39  (503)
333 COG0654 UbiH 2-polyprenyl-6-me  94.9   0.043 1.1E-06   33.5   4.4   33    8-40      2-34  (387)
334 PRK07326 short chain dehydroge  94.9    0.11 2.7E-06   30.9   6.3   43    6-48      3-46  (235)
335 cd01337 MDH_glyoxysomal_mitoch  94.9    0.32 8.3E-06   27.5  10.5   69   10-78      2-82  (310)
336 pfam03807 F420_oxidored NADP o  94.8    0.05 1.3E-06   33.1   4.5   66   10-77      1-69  (93)
337 PRK06701 short chain dehydroge  94.8    0.33 8.4E-06   27.5   9.9   51    5-55     42-98  (289)
338 PRK09186 flagellin modificatio  94.8    0.11 2.9E-06   30.7   6.3   41    6-46      2-43  (255)
339 PRK06346 consensus              94.8    0.11 2.8E-06   30.7   6.2   49    5-53      2-55  (251)
340 PRK12384 sorbitol-6-phosphate   94.8    0.18 4.6E-06   29.2   7.3   39    8-46      2-41  (259)
341 PRK08251 short chain dehydroge  94.8    0.34 8.7E-06   27.4   9.2   40    8-47      2-42  (248)
342 PRK09126 hypothetical protein;  94.8   0.052 1.3E-06   33.0   4.5   32   10-41      5-36  (392)
343 TIGR03127 RuMP_HxlB 6-phospho   94.7    0.21 5.5E-06   28.7   7.6   33    7-39     29-64  (179)
344 COG1233 Phytoene dehydrogenase  94.7   0.076 1.9E-06   31.9   5.3   34    8-41      3-36  (487)
345 PRK08243 4-hydroxybenzoate 3-m  94.7   0.056 1.4E-06   32.8   4.6   33    9-41      3-35  (392)
346 PRK06077 fabG 3-ketoacyl-(acyl  94.7    0.35 8.9E-06   27.3   9.2   49    6-54      1-55  (249)
347 pfam01946 Thi4 Thi4 family. Th  94.7   0.097 2.5E-06   31.1   5.8   38    3-40     12-49  (229)
348 PRK00094 gpsA NAD(P)H-dependen  94.7    0.18 4.5E-06   29.3   7.1   44    9-52      2-45  (325)
349 pfam10727 Rossmann-like Rossma  94.7   0.047 1.2E-06   33.3   4.2   59   12-71      1-61  (111)
350 PRK07364 2-octaprenyl-6-methox  94.7   0.055 1.4E-06   32.8   4.5   32   10-41     19-50  (413)
351 PRK06179 short chain dehydroge  94.7    0.14 3.5E-06   30.1   6.5   39    7-45      3-42  (270)
352 KOG2380 consensus               94.7   0.091 2.3E-06   31.3   5.6   66    8-74     52-118 (480)
353 PRK09564 coenzyme A disulfide   94.7    0.12   3E-06   30.5   6.1   31   10-40      2-34  (443)
354 PRK06138 short chain dehydroge  94.7    0.13 3.3E-06   30.2   6.3   42    5-46      2-44  (252)
355 PRK06728 aspartate-semialdehyd  94.6   0.099 2.5E-06   31.1   5.7   87    7-97      4-97  (347)
356 PRK06550 fabG 3-ketoacyl-(acyl  94.6   0.089 2.3E-06   31.4   5.3   37    5-41      2-39  (237)
357 PRK06139 short chain dehydroge  94.6    0.12 3.1E-06   30.5   6.0   45    3-47      1-46  (324)
358 PRK06617 2-octaprenyl-6-methox  94.6   0.073 1.9E-06   32.0   4.8   32   10-41      3-34  (374)
359 PRK05855 short chain dehydroge  94.6    0.38 9.8E-06   27.0   8.9   28   11-39     29-59  (582)
360 PRK06185 hypothetical protein;  94.5    0.06 1.5E-06   32.6   4.4   34    8-41      6-39  (409)
361 KOG2614 consensus               94.5   0.072 1.8E-06   32.0   4.7   35    8-42      2-36  (420)
362 PRK06079 enoyl-(acyl carrier p  94.5    0.15 3.8E-06   29.8   6.3   47    4-50      3-52  (252)
363 PRK05717 oxidoreductase; Valid  94.5    0.15 3.8E-06   29.8   6.3   45    3-47      5-50  (255)
364 PRK05714 2-octaprenyl-3-methyl  94.5   0.061 1.5E-06   32.5   4.3   33    9-41      3-35  (405)
365 PRK05671 aspartate-semialdehyd  94.5    0.19 4.9E-06   29.1   6.8   87    7-97      3-95  (336)
366 PRK06227 consensus              94.5    0.15 3.9E-06   29.8   6.3   50    5-54      2-56  (256)
367 PRK06949 short chain dehydroge  94.5    0.17 4.3E-06   29.4   6.6   75    4-78      5-100 (258)
368 PRK06834 hypothetical protein;  94.4    0.07 1.8E-06   32.1   4.5   32    9-40      4-35  (488)
369 PRK07984 enoyl-(acyl carrier p  94.4    0.16 4.1E-06   29.6   6.3   40    3-42      1-43  (262)
370 PRK08415 enoyl-(acyl carrier p  94.4    0.14 3.6E-06   30.0   6.0   37    6-42      3-42  (274)
371 pfam00743 FMO-like Flavin-bind  94.4   0.052 1.3E-06   33.0   3.8   32    6-37    181-212 (532)
372 PRK06183 mhpA 3-(3-hydroxyphen  94.4    0.09 2.3E-06   31.4   5.0   35    7-41     11-45  (554)
373 TIGR03364 HpnW_proposed FAD de  94.4    0.07 1.8E-06   32.1   4.4   31   11-41      3-33  (365)
374 pfam02558 ApbA Ketopantoate re  94.4    0.22 5.6E-06   28.7   6.9   45   11-56      1-45  (150)
375 KOG0024 consensus               94.4     0.2 5.1E-06   28.9   6.7   38  285-329   182-219 (354)
376 TIGR01372 soxA sarcosine oxida  94.4   0.077   2E-06   31.8   4.6   31   11-41    179-209 (1026)
377 COG0673 MviM Predicted dehydro  94.3    0.35 8.9E-06   27.3   7.9   89    7-99      2-98  (342)
378 TIGR03453 partition_RepA plasm  94.3   0.033 8.5E-07   34.3   2.7   36  110-145   101-139 (387)
379 PRK05249 soluble pyridine nucl  94.3   0.098 2.5E-06   31.1   5.0   38    1-41      2-39  (465)
380 PRK08416 7-alpha-hydroxysteroi  94.3    0.17 4.3E-06   29.5   6.2   41    1-42      2-44  (260)
381 cd00650 LDH_MDH_like NAD-depen  94.3     0.1 2.5E-06   31.0   5.0   68   11-78      1-84  (263)
382 COG0039 Mdh Malate/lactate deh  94.2    0.28 7.1E-06   27.9   7.2   69    9-77      1-82  (313)
383 COG2072 TrkA Predicted flavopr  94.2   0.088 2.2E-06   31.4   4.6   35    7-41      7-42  (443)
384 COG0345 ProC Pyrroline-5-carbo  94.2     0.4   1E-05   26.9   8.0   66    9-76      2-72  (266)
385 PRK08244 hypothetical protein;  94.2   0.082 2.1E-06   31.6   4.5   31   10-40      4-34  (494)
386 COG1232 HemY Protoporphyrinoge  94.2   0.087 2.2E-06   31.4   4.6   32    9-40      1-34  (444)
387 cd05191 NAD_bind_amino_acid_DH  94.2    0.23   6E-06   28.5   6.8   36    4-39     19-55  (86)
388 cd05294 LDH-like_MDH_nadp A la  94.2    0.23 5.9E-06   28.5   6.7   70   10-79      2-87  (309)
389 PRK08643 acetoin reductase; Va  94.1    0.47 1.2E-05   26.4   9.5   72    8-79      2-94  (256)
390 pfam00899 ThiF ThiF family. Th  94.1     0.3 7.6E-06   27.7   7.2   31    9-39      2-33  (134)
391 PRK06180 short chain dehydroge  94.1    0.35 8.9E-06   27.3   7.5   43    7-49      3-46  (277)
392 PRK12416 protoporphyrinogen ox  94.1     0.1 2.7E-06   30.9   4.8   32    9-40      2-39  (466)
393 COG2072 TrkA Predicted flavopr  94.1    0.09 2.3E-06   31.4   4.5   11  117-127   120-130 (443)
394 PRK08642 fabG 3-ketoacyl-(acyl  94.1    0.16 4.2E-06   29.5   5.8   40    3-42      1-41  (254)
395 PRK05225 ketol-acid reductoiso  94.1    0.23 5.9E-06   28.5   6.5   78    5-88     34-117 (489)
396 KOG0022 consensus               94.0    0.17 4.5E-06   29.4   5.9   99  322-422   260-369 (375)
397 COG1148 HdrA Heterodisulfide r  94.0    0.12   3E-06   30.5   5.0   91    8-128   124-214 (622)
398 PRK12921 2-dehydropantoate 2-r  94.0    0.29 7.5E-06   27.8   7.0   46   10-56      2-47  (306)
399 PRK08849 2-octaprenyl-3-methyl  94.0     0.1 2.6E-06   30.9   4.6   32    9-40      4-35  (384)
400 PRK07634 pyrroline-5-carboxyla  94.0    0.49 1.2E-05   26.3   8.0   69    7-77      3-77  (245)
401 PRK08132 hypothetical protein;  93.9     0.1 2.7E-06   30.9   4.5   32   10-41     25-56  (549)
402 PRK13869 plasmid-partitioning   93.9   0.045 1.2E-06   33.4   2.7   34  112-145   120-156 (405)
403 PRK09422 alcohol dehydrogenase  93.9    0.27   7E-06   28.0   6.7   12  197-208   115-126 (338)
404 cd01483 E1_enzyme_family Super  93.9    0.25 6.5E-06   28.2   6.5   31   10-40      1-32  (143)
405 PRK07102 short chain dehydroge  93.9    0.19   5E-06   29.0   5.8   39    9-47      2-41  (243)
406 PRK06171 sorbitol-6-phosphate   93.9    0.17 4.3E-06   29.5   5.5   40    3-42      4-44  (266)
407 PRK11259 solA N-methyltryptoph  93.9     0.1 2.7E-06   30.9   4.4   32   10-41      5-36  (377)
408 PRK06505 enoyl-(acyl carrier p  93.8    0.23 5.8E-06   28.6   6.2   38    5-42      4-44  (271)
409 PRK08774 consensus              93.8    0.12   3E-06   30.6   4.6   32   10-41      6-37  (402)
410 PRK07791 short chain dehydroge  93.8    0.53 1.4E-05   26.0   8.1   37    3-39      1-38  (285)
411 TIGR01968 minD_bact septum sit  93.8   0.057 1.4E-06   32.7   3.0   36  114-149     2-41  (272)
412 PRK10206 putative dehydrogenas  93.8    0.32 8.2E-06   27.5   6.8   87    9-99      3-96  (345)
413 cd05005 SIS_PHI Hexulose-6-pho  93.8    0.31   8E-06   27.6   6.8   72    7-96     32-106 (179)
414 TIGR00936 ahcY adenosylhomocys  93.7    0.23 5.8E-06   28.5   6.0   53    6-58     39-98  (422)
415 COG1893 ApbA Ketopantoate redu  93.7    0.38 9.7E-06   27.0   7.1   50    9-59      1-50  (307)
416 PRK06997 enoyl-(acyl carrier p  93.7    0.22 5.5E-06   28.7   5.8   39    3-41      1-42  (260)
417 PRK06463 fabG 3-ketoacyl-(acyl  93.7    0.56 1.4E-05   25.9   9.3   51    4-54      3-55  (254)
418 PRK06947 glucose-1-dehydrogena  93.7    0.28 7.2E-06   27.9   6.4   52    3-54      1-58  (252)
419 PRK06476 pyrroline-5-carboxyla  93.7    0.28   7E-06   28.0   6.3   66   10-77      2-72  (255)
420 PRK11579 putative oxidoreducta  93.7    0.42 1.1E-05   26.7   7.2   88    7-99      3-95  (346)
421 pfam00070 Pyr_redox Pyridine n  93.6    0.26 6.7E-06   28.1   6.2   32   10-41      1-32  (82)
422 PRK00048 dihydrodipicolinate r  93.6    0.38 9.7E-06   27.0   7.0   83    9-96      3-97  (265)
423 TIGR01035 hemA glutamyl-tRNA r  93.6    0.29 7.5E-06   27.8   6.4   67    6-72    183-259 (436)
424 PRK08063 enoyl-(acyl carrier p  93.6    0.59 1.5E-05   25.7   8.6   49    6-54      2-56  (250)
425 COG0665 DadA Glycine/D-amino a  93.5    0.18 4.6E-06   29.3   5.2   35    7-41      3-37  (387)
426 PRK11557 putative DNA-binding   93.5     0.6 1.5E-05   25.7   7.9   13  439-451   269-281 (282)
427 PRK07190 hypothetical protein;  93.4    0.14 3.6E-06   30.0   4.5   32   10-41      7-38  (480)
428 PRK08850 2-octaprenyl-6-methox  93.4    0.18 4.5E-06   29.3   4.9   33    8-40      4-36  (405)
429 PRK08013 hypothetical protein;  93.4    0.15 3.9E-06   29.8   4.6   34    8-41      3-36  (400)
430 PRK10262 thioredoxin reductase  93.3    0.15 3.9E-06   29.8   4.5   38    3-40      1-38  (321)
431 PRK08264 short chain dehydroge  93.2    0.29 7.4E-06   27.9   5.8   37    5-41      2-40  (235)
432 PRK08040 putative semialdehyde  93.2    0.25 6.3E-06   28.3   5.4   87    7-97      3-95  (337)
433 PRK06482 short chain dehydroge  93.2    0.67 1.7E-05   25.3   8.2   42    9-50      3-45  (276)
434 COG2910 Putative NADH-flavin r  93.1    0.45 1.2E-05   26.5   6.7   67    9-75      1-73  (211)
435 COG0644 FixC Dehydrogenases (f  93.1    0.18 4.6E-06   29.2   4.7   31   10-40      5-35  (396)
436 TIGR02352 thiamin_ThiO glycine  93.1    0.12 3.2E-06   30.4   3.8   50   11-60      1-51  (357)
437 PRK06128 oxidoreductase; Provi  93.1    0.69 1.8E-05   25.2   9.9   50    5-54     52-108 (300)
438 PRK05439 pantothenate kinase;   93.1    0.07 1.8E-06   32.1   2.5   27  112-138    84-113 (312)
439 PRK06181 short chain dehydroge  93.1    0.35   9E-06   27.3   6.1   40    8-47      1-41  (263)
440 PRK07889 enoyl-(acyl carrier p  93.0    0.35   9E-06   27.2   6.1   41    4-44      3-46  (256)
441 COG1004 Ugd Predicted UDP-gluc  93.0    0.71 1.8E-05   25.2  10.8   43   10-52      2-44  (414)
442 PRK08219 short chain dehydroge  93.0    0.69 1.7E-05   25.3   7.5   71    8-79      3-85  (226)
443 PRK10537 voltage-gated potassi  93.0    0.43 1.1E-05   26.7   6.5   50  372-427   266-321 (356)
444 PRK06223 malate dehydrogenase;  93.0    0.71 1.8E-05   25.1   9.1   70   10-79      2-84  (312)
445 cd01078 NAD_bind_H4MPT_DH NADP  93.0    0.39 9.9E-06   27.0   6.2   42    4-45     24-66  (194)
446 TIGR01292 TRX_reduct thioredox  93.0    0.44 1.1E-05   26.6   6.4   75   10-97      2-79  (321)
447 pfam07755 DUF1611 Protein of u  93.0    0.35   9E-06   27.2   6.0   84   85-168    81-194 (302)
448 PRK08267 short chain dehydroge  92.9    0.36 9.1E-06   27.2   5.9   41    9-49      2-43  (258)
449 TIGR02734 crtI_fam phytoene de  92.8    0.15 3.8E-06   29.8   3.9   31   11-41      1-31  (526)
450 PRK04176 ribulose-1,5-biphosph  92.8    0.16 4.1E-06   29.6   4.0   38    3-40     20-57  (257)
451 COG0493 GltD NADPH-dependent g  92.8    0.16   4E-06   29.7   4.0   36    5-40    120-155 (457)
452 PRK06598 aspartate-semialdehyd  92.8    0.55 1.4E-05   25.9   6.7   85    9-97      3-93  (348)
453 PRK06928 pyrroline-5-carboxyla  92.7    0.73 1.9E-05   25.1   7.3   67    9-77      2-74  (275)
454 PRK08690 enoyl-(acyl carrier p  92.7    0.37 9.5E-06   27.1   5.8   38    3-40      1-41  (261)
455 TIGR03466 HpnA hopanoid-associ  92.7    0.75 1.9E-05   25.0   7.3   62   10-71      2-71  (328)
456 PRK06953 short chain dehydroge  92.6    0.47 1.2E-05   26.4   6.2   46    9-54      2-48  (222)
457 PRK05134 3-demethylubiquinone-  92.6     0.8   2E-05   24.8   8.9  113    3-137    44-167 (233)
458 PRK10083 putative dehydrogenas  92.6    0.43 1.1E-05   26.7   6.0   19  396-415   307-325 (339)
459 cd00300 LDH_like L-lactate deh  92.6    0.56 1.4E-05   25.9   6.6   68   11-78      1-80  (300)
460 PRK08177 short chain dehydroge  92.6    0.41   1E-05   26.8   5.8   43    8-50      1-44  (225)
461 PRK06249 2-dehydropantoate 2-r  92.6    0.77   2E-05   24.9   7.2   48    7-56      4-51  (313)
462 COG1703 ArgK Putative periplas  92.5    0.29 7.5E-06   27.8   5.1  113  109-228    47-205 (323)
463 PRK08263 short chain dehydroge  92.5    0.48 1.2E-05   26.3   6.1   43    7-49      2-45  (275)
464 PRK06484 short chain dehydroge  92.5    0.52 1.3E-05   26.1   6.3   70    7-76      4-91  (530)
465 pfam07992 Pyr_redox_2 Pyridine  92.4    0.24 6.2E-06   28.4   4.5   30   11-40      2-31  (277)
466 PRK07707 consensus              92.4    0.58 1.5E-05   25.8   6.4   42    8-49      2-45  (239)
467 PRK12938 acetyacetyl-CoA reduc  92.4    0.72 1.8E-05   25.1   6.9   73    6-78      1-95  (246)
468 PRK12748 3-ketoacyl-(acyl-carr  92.4    0.86 2.2E-05   24.6   8.6   36    5-40      2-40  (257)
469 COG1250 FadB 3-hydroxyacyl-CoA  92.4    0.35 8.8E-06   27.3   5.3   36    8-43      3-38  (307)
470 PRK07679 pyrroline-5-carboxyla  92.4    0.81 2.1E-05   24.7   7.1   67    9-77      4-76  (279)
471 PRK03839 putative kinase; Prov  92.3    0.18 4.5E-06   29.3   3.8   26  115-143     2-29  (180)
472 PRK07024 short chain dehydroge  92.3    0.49 1.2E-05   26.3   6.0   41    9-49      3-44  (256)
473 PRK07775 short chain dehydroge  92.3    0.49 1.2E-05   26.3   6.0   50    5-54      7-61  (275)
474 PRK12824 acetoacetyl-CoA reduc  92.3    0.87 2.2E-05   24.5   7.9   72    8-79      2-95  (245)
475 PRK06731 flhF flagellar biosyn  92.3   0.072 1.8E-06   32.0   1.7   29  115-144    80-108 (270)
476 PRK08303 short chain dehydroge  92.3    0.77   2E-05   24.9   6.9   38    3-40      3-41  (305)
477 cd01424 MGS_CPS_II Methylglyox  92.3     0.8   2E-05   24.8   7.0   81   21-104    16-107 (110)
478 PRK11730 fadB multifunctional   92.2    0.43 1.1E-05   26.7   5.6   37    8-44    313-349 (715)
479 PRK07577 short chain dehydroge  92.2    0.35 8.9E-06   27.3   5.1   36    6-41      1-37  (234)
480 PRK12835 3-ketosteroid-delta-1  92.2    0.28 7.3E-06   27.9   4.6   32   10-41     13-44  (584)
481 pfam01113 DapB_N Dihydrodipico  92.2    0.68 1.7E-05   25.3   6.6   82   10-96      2-93  (122)
482 cd06318 PBP1_ABC_sugar_binding  92.1    0.91 2.3E-05   24.4   8.6   66   22-97     20-85  (282)
483 cd01339 LDH-like_MDH L-lactate  92.1    0.92 2.3E-05   24.4   7.5   68   11-78      1-80  (300)
484 PRK07074 short chain dehydroge  92.1     0.6 1.5E-05   25.6   6.2   42    8-49      2-44  (256)
485 PRK05708 2-dehydropantoate 2-r  92.1    0.65 1.7E-05   25.4   6.4   44    9-52      3-46  (305)
486 COG1231 Monoamine oxidase [Ami  92.1    0.31 7.8E-06   27.7   4.7   35    7-41      6-40  (450)
487 PRK08674 bifunctional phosphog  92.1     0.9 2.3E-05   24.4   7.1   80    9-124    35-116 (328)
488 PRK08294 phenol 2-monooxygenas  92.0   0.096 2.4E-06   31.2   2.0   43   11-53     35-78  (634)
489 KOG0023 consensus               92.0    0.62 1.6E-05   25.6   6.1   48    8-55    182-230 (360)
490 COG3380 Predicted NAD/FAD-depe  92.0    0.28 7.2E-06   27.9   4.4   29   11-39      4-32  (331)
491 KOG1201 consensus               91.9    0.96 2.5E-05   24.2   8.7  136    2-139    32-192 (300)
492 KOG1209 consensus               91.9    0.97 2.5E-05   24.2  10.3  120    1-121     1-139 (289)
493 cd05014 SIS_Kpsf KpsF-like pro  91.9    0.77   2E-05   24.9   6.6   74   10-97      2-79  (128)
494 COG1086 Predicted nucleoside-d  91.9    0.98 2.5E-05   24.2  10.6  349    9-424   117-476 (588)
495 TIGR03026 NDP-sugDHase nucleot  91.8    0.29 7.3E-06   27.9   4.3   77  343-437   308-392 (411)
496 PRK07843 3-ketosteroid-delta-1  91.8    0.32 8.2E-06   27.5   4.6   31   11-41      8-38  (560)
497 PRK10416 cell division protein  91.8   0.099 2.5E-06   31.0   2.0   30  115-145   300-329 (499)
498 PRK07333 2-octaprenyl-6-methox  91.8    0.33 8.5E-06   27.4   4.6   31   11-41      4-36  (403)
499 PRK12726 flagellar biosynthesi  91.8    0.27 6.9E-06   28.0   4.2   54   83-145   185-240 (407)
500 cd02040 NifH NifH gene encodes  91.7    0.14 3.7E-06   29.9   2.7   31  114-144     2-34  (270)

No 1  
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=867.63  Aligned_cols=449  Identities=46%  Similarity=0.772  Sum_probs=399.8

Q ss_pred             CCHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             81321898799983685489999999985986999818964788999789899645315722588899888868567557
Q gi|254781099|r    2 KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENA   81 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~   81 (468)
                      .+++|+||+|+|+|+|+||+|+|++|+++|++|+++|++++....+...|+.+.+....++..+|+||+|||||+++|+.
T Consensus         3 ~~~~~~gk~v~v~GlG~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~g~~~~~~~~~~~~~~~~iV~SPGIp~~~p~~   82 (457)
T PRK01390          3 PVTSFKGKTVALFGLGGSGLATARALKAGGAEVIAWDDNPDSVAKAAAAGIATADLRTADWSQFAALVLSPGVPLTHPKP   82 (457)
T ss_pred             CCCCCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCC
T ss_conf             73202899899994369999999999978997999939920668998759831455412320387899999888656673


Q ss_pred             CHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
Q ss_conf             88899999769809983034223343015688689960345752157899999987310000000124432211016888
Q gi|254781099|r   82 HWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN  161 (468)
Q Consensus        82 ~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~~~~  161 (468)
                      |+.+.+|++.|+||+||+|||++.......+.|+|||||||||||||+|++|||+++|+++.++||||+|++.+....+.
T Consensus        83 ~~~v~~a~~~gi~v~seielf~~~~~~~~~~~~iIaVTGTnGKTTTtsli~~iL~~~g~~~~~gGNIG~p~l~l~~~~~~  162 (457)
T PRK01390         83 HWTVDLARAAGVEVIGDIELFCRERRAHAPDAPFIAITGTNGKSTTTALIAHLLRQAGRDVQMGGNIGTAILSLEPPKAG  162 (457)
T ss_pred             HHHHHHHHHCCCEEEEHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCHHHCCCCCCCCC
T ss_conf             19999999859918600899999987325789889992899649899999999997399869966624011123468899


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEE
Q ss_conf             37999217754321223332210111002101222111000011221000101344322478678999874012343011
Q gi|254781099|r  162 RFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS  241 (468)
Q Consensus       162 ~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~~~~~  241 (468)
                      +++|+|+|||||+++..++|+++|||||+|||||||+|||+|+++|.+||.+++..++|.||+..+.+..........+.
T Consensus       163 ~~~VlElSSfQl~~~~~~~p~iavitNI~~DHLD~h~s~e~Y~~aK~~i~~~~~~~Vin~DD~~~~~l~~~~~~~~~~~~  242 (457)
T PRK01390        163 RVYVVECSSYQIDLTPSLDPTVGILLNLTPDHLDRHGTMEHYAAIKERLVAGAGTAVIGVDDAYCQAIADRLERAGKRVV  242 (457)
T ss_pred             CEEEEEECCCHHHHHHCCCCCEEEEECCCHHHHHHCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHCCCEEE
T ss_conf             66999925752654400699889991788778655089999999999985579869996888889999999876388499


Q ss_pred             CCCCCCCCCCCCEEECCCEEEECCCCCC--CC---CCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHH
Q ss_conf             0364432223411212413541467642--12---345588510111001101222102222211000000001345443
Q gi|254781099|r  242 RISSQSLQSDSDLYIDESFLKCSATSEV--IF---DFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRL  316 (468)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~---~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~  316 (468)
                      .+....... ..++.++..+.....+..  ..   ...+++|.||++|++||+++|+.+|++.+.|.++|++|+|++|||
T Consensus       243 ~~s~~~~~~-~g~~~~~~~~~~~~~~~~~~~~~~~~~~~L~G~HN~~NalAAia~a~~lGi~~e~i~~aL~~F~Gl~hR~  321 (457)
T PRK01390        243 RISVEKPLA-RGIYADGGKLVRATGGARHEIADLAGIGSLRGRHNAQNAAAAVAACLALGVSPEEIQAGLRSFPGLAHRM  321 (457)
T ss_pred             EEECCCCCC-CCEEEECCEEEECCCCCEEEEEEHHHCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCE
T ss_conf             971676566-8649857889984798345443143234577542699999999999981898999999997489999852


Q ss_pred             HHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCE
Q ss_conf             32100343000002355675555553201333200120321012206898998427868999889989988863168988
Q gi|254781099|r  317 QTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINS  396 (468)
Q Consensus       317 E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~~~~~liG~~~~~i~~~~~~~~~~  396 (468)
                      |.+++.+|+.||||||||||+||.+||++++ +++||+||++|+.|+.+|.+.+.++.++++||++++.+.+.++..+++
T Consensus       322 E~V~~~~Gv~~iNDSKaTN~~at~~Al~s~~-~i~lI~GG~~K~~d~~~l~~~~~~v~~~~liG~~~~~~~~~l~~~~~~  400 (457)
T PRK01390        322 EQVGRRGKVLFVNDSKATNADAAAPALSSFP-NIYWIAGGKPKAGGIESLAPFFPRIAKAYLIGEAAEEFAATLGGAVPY  400 (457)
T ss_pred             EEEEECCCCEEECCCCCCCHHHHHHHHHCCC-CEEEEECCCCCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCE
T ss_conf             7975427833853776789899999997378-859994504788897999998743359999898889999987367987


Q ss_pred             EEECCHHHHHHHHHHHHH-HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             998799999999999998-44898599945221663134798999999999998637
Q gi|254781099|r  397 TLSKTLDQALKSVVRDVE-NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP  452 (468)
Q Consensus       397 ~~~~~~~~a~~~i~~~~~-~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~  452 (468)
                      ..+.++++|++.+.+.++ ..++||+|||||||||||||+||+|||++|+++|++|+
T Consensus       401 ~~~~~l~~av~~a~~~a~~~~~~gd~VLlSPacaSfD~f~nyeeRG~~Fk~~V~~L~  457 (457)
T PRK01390        401 EISGTLEAAVAAAARDAAASGAPEPVVLLSPACASFDQFKNFEVRGDAFRELVQALP  457 (457)
T ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             985989999999999998518999989979624040142699999999999998682


No 2  
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=833.82  Aligned_cols=436  Identities=29%  Similarity=0.434  Sum_probs=378.3

Q ss_pred             CC-CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC----HHHHHHHHCCCEEECCCC---CCCCCCCEEEECC
Q ss_conf             98-132189879998368548999999998598699981896----478899978989964531---5722588899888
Q gi|254781099|r    1 MK-LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP----CAVKQAKDMGIEVIDFRE---IPWSIISFLVLSP   72 (468)
Q Consensus         1 m~-~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~----~~~~~l~~~g~~~~~~~~---~~~~~~d~vv~Sp   72 (468)
                      |+ |++|+||+|+|+|+|+||+|+|++|+++|++|+++|.++    +..++|+..|+.+.....   ...+.+|+||+||
T Consensus         1 m~~~~~~~~k~i~viGlG~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~l~~~gi~~~~g~~~~~~~~~~~d~vV~SP   80 (450)
T PRK02472          1 MKTITTFQNKKVLVLGLAKSGYAAAKLLHKLGANVTVNDGKPFSENPAAQELLEEGIKVICGSHPLELLDENFDLMVKNP   80 (450)
T ss_pred             CCCCCCCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHCCCEEEECCCHHHHCCCCCCEEEECC
T ss_conf             97630358998999977899999999999886989998488665798999999679989978880786057887999899


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             86856755788899999769809983034223343015688689960345752157899999987310000000124432
Q gi|254781099|r   73 GIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPI  152 (468)
Q Consensus        73 gi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~  152 (468)
                      |||++    ||++++|+++|+||+||+||+++.     .+.|+|||||||||||||+|++|||+++|+++.++||||+|+
T Consensus        81 gI~~~----~p~~~~a~~~~i~v~~~~el~~~~-----~~~~~IaVTGTnGKTTTt~ll~~iL~~~g~~~~~~GNiG~p~  151 (450)
T PRK02472         81 GIPYD----NPMVEEALEKGIPIITEVELAYLI-----SEAPIIGITGSNGKTTTTTLIAEMLNAGGQHGLLAGNIGYPA  151 (450)
T ss_pred             CCCCC----CHHHHHHHHCCCCEEEHHHHHHHH-----CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             87999----999999998699674387888875-----159789982799973199999999997499739994167641


Q ss_pred             CCCC-CCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECC---CCCCCCCCHHHHH
Q ss_conf             2110-16888379992177543212233322101110021012221110000112210001013---4432247867899
Q gi|254781099|r  153 LNLE-YFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEK  228 (468)
Q Consensus       153 ~~~~-~~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~---~~iln~dd~~~~~  228 (468)
                      +++. ...+.|++|+|+|||||+++..++|+++|||||++||||||+|||+|.++|.+||+++.   ..++|.||+....
T Consensus       152 ~~~~~~~~~~d~~VlE~SSfql~~~~~~~p~iavitNI~~DHLD~h~s~e~Y~~aK~~i~~~~~~~~~~v~n~Dd~~~~~  231 (450)
T PRK02472        152 SEVAQKATADDTLVTELSSFQLMGVETFRPHIAVITNIFEAHLDYHGTFENYVAAKWNIQKNQTEDDYLVLNADQEEVKE  231 (450)
T ss_pred             HHHHHCCCCCCEEEEEECCCCHHHHCCCCCCEEEEECCCHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHH
T ss_conf             24554478987799990655141002258868999368877976634899999999999955996877999588799999


Q ss_pred             HHHHCCCCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCC
Q ss_conf             98740123430110364432223411212413541467642123455885101110011012221022222110000000
Q gi|254781099|r  229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLS  308 (468)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~  308 (468)
                      +....+.....+   +....  ....+.+...+............++++|.||++|+++|+++|+.+|++.+.|.++|++
T Consensus       232 l~~~~~~~~i~f---s~~~~--~~~~~~~~~~~~~~~~~~~~~~~l~l~G~HN~~NalaAia~a~~lGi~~~~i~~aL~~  306 (450)
T PRK02472        232 LAKQTKATVVPF---STTKE--VDGAYIKDGALYFKGEKIMAADDIVLPGEHNLENILAAIAVAKLAGVSNEAIAEVLST  306 (450)
T ss_pred             HHHHCCCEEEEE---CCCCC--CCCCEEECCEEEECCEEEEEHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             997579708985---36754--6651762787998884566423236775534999999999999829987899999874


Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEEECCCHHHHHH
Q ss_conf             01345443321003430000023556755555532013332001203210122068989984278689998899899888
Q gi|254781099|r  309 CGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFH  388 (468)
Q Consensus       309 f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~~~~~liG~~~~~i~~  388 (468)
                      |+|++||||.+++.+|+.||||||||||+||.+||+++.++++||+||++|+.|+.+|.+.+.++..++++|++++.+.+
T Consensus       307 F~Gl~hRlE~v~~~~Gv~~iNDSKaTN~~at~~Al~~~~~~iilI~GG~~Kg~d~~~l~~~~~~vk~v~~~G~~~~~i~~  386 (450)
T PRK02472        307 FTGVKHRLQYVGTINGRKFYNDSKATNILATQKALSGFNQPVILLAGGLDRGNEFDELIPYLKNVKAMVVFGETAPKLAR  386 (450)
T ss_pred             CCCCCEEEEEEEEECCEEEEECCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCHHHHHH
T ss_conf             48843379999997477898268888999999998458998799991555688879999997376899996889999999


Q ss_pred             HHHC-CCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             6316-8988998799999999999998448985999452216631347989999999999986379
Q gi|254781099|r  389 HFGG-KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG  453 (468)
Q Consensus       389 ~~~~-~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~  453 (468)
                      .+.. .+++..+.++++|++.+.   +.+++||+|||||||||||||+||+|||++|+++|++|.|
T Consensus       387 ~~~~~~~~~~~~~~l~~Av~~a~---~~a~~gd~VLlSPa~aSfD~f~nyeeRG~~F~~~V~~L~g  449 (450)
T PRK02472        387 AANKAGITIVEADNVEDAVPKAY---ALSEPGDVILLSPACASWDQYKTFEERGDEFIDAVHELKG  449 (450)
T ss_pred             HHHHCCCEEEECCCHHHHHHHHH---HHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCC
T ss_conf             99737971898799999999999---8588959899797330501205999999999999997479


No 3  
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=831.89  Aligned_cols=447  Identities=25%  Similarity=0.365  Sum_probs=374.9

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC--CHHHHHHHHCCCEE--E--CCCCCCCCCCCEEEECCCCCCC
Q ss_conf             3218987999836854899999999859869998189--64788999789899--6--4531572258889988886856
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEV--I--DFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~--~~~~~~l~~~g~~~--~--~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      .++++|+|+|+|+|+||+|+|++|+++|++|+++|.+  +.....++..+...  .  .+.+..++.+|+||+||||+++
T Consensus         3 ~~~~~k~vlV~GlG~sG~a~a~~L~~~G~~V~~~D~~~~~~~~~~l~~~~~~~~~~~g~~~~~~~~~~d~vV~SPGI~p~   82 (501)
T PRK02006          3 GDRQRPMVLVLGLGESGLAMARWCARHGCRLRVADTREAPPNLAALQAEGIDAEFVGGAFDPALLDGVELVALSPGLSPL   82 (501)
T ss_pred             CCCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCCCEEECCCCCHHHHCCCCEEEECCEECCC
T ss_conf             66689839998336889999999997898499998999986199998608981897788986784689999989900888


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHC----CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             75578889999976980998303422334301----56886899603457521578999999873100000001244322
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFS----SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPIL  153 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~----~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~  153 (468)
                      +|..+|++++|+++|+||+||+|||++.....    .+..|+|||||||||||||+|++|||+++|+++.++||||+|++
T Consensus        83 ~p~~~~~l~~A~~~gi~i~~eiel~~~~~~~~~~~~~~~~~iIaVTGTnGKTTTt~li~~iL~~~g~~~~~~GNIG~p~l  162 (501)
T PRK02006         83 EPALAALLAAARERGIPVWGELELFAQALAALGASRGYAPKVLAITGTNGKTTTTSLTGLLCERAGKKVAVAGNISPAAL  162 (501)
T ss_pred             CCCHHHHHHHHHHCCCCEEEHHHHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHH
T ss_conf             85431999999987995876899999887630222356874899938996687999999999976997465256461026


Q ss_pred             CC-----CCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHH
Q ss_conf             11-----0168883799921775432122333221011100210122211100001122100010134432247867899
Q gi|254781099|r  154 NL-----EYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEK  228 (468)
Q Consensus       154 ~~-----~~~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~  228 (468)
                      +.     ......|++|+|+||||||++..|+|+++|||||+|||||||+|||+|.++|.+||..++..|+|.||+....
T Consensus       163 ~~l~~~~~~~~~~d~~VlElSSfQLe~~~~~~p~vaVilNIs~DHLD~h~s~e~Y~~aK~rif~~~~~~V~n~DD~~~~~  242 (501)
T PRK02006        163 DKLAEAIDAAALPDVWVLELSSFQLETTHTFAPDAATVLNITQDHLDWHGSMAAYAAAKGRIFGPATVRVLNRDDALVMA  242 (501)
T ss_pred             HHHHHHHCCCCCCCEEEEEECHHHHCCCCCCCCCEEEEECCCHHHHHHHCCHHHHHHHHHHHHCCCCEEEEECCCHHHHH
T ss_conf             77876422577686899996646757565579678999078865644423799999999987234855999488888998


Q ss_pred             HHHHCCCCCCEEECCCCCCC-CCCCCEEECCC--EE--------------------------EECCCCCCCCCCCCCCCC
Q ss_conf             98740123430110364432-22341121241--35--------------------------414676421234558851
Q gi|254781099|r  229 IAYDMNFIGHSISRISSQSL-QSDSDLYIDES--FL--------------------------KCSATSEVIFDFSQETKK  279 (468)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~--~~--------------------------~~~~~~~~~~~~~~l~G~  279 (468)
                      +..........+........ .....+.....  ++                          ..........+.++++|.
T Consensus       243 ~~~~~~~~~~~~~fg~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~l~G~  322 (501)
T PRK02006        243 MAPPAAAADAPVTFGLDEPAQDGDYGLLRENGMAWLVEAEDRDAADEPAPTRRRKKDAAPPPDIALKRLMPADALRIRGL  322 (501)
T ss_pred             HHHHCCCCCEEEEECCCCCCCCCCEEEEECCCCEEEEECCCCCCCCCCHHHHHHCCCCCCCCCCCHHHCCCCHHCCCCCC
T ss_conf             76650566416885057756665402562377057873032210000001221023334443310110355201035672


Q ss_pred             HHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCC
Q ss_conf             01110011012221022222110000000013454433210034300000235567555555320133320012032101
Q gi|254781099|r  280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK  359 (468)
Q Consensus       280 HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K  359 (468)
                      ||++|++||+++|+.+|++.+.|.++|++|+|+|||||.+++.+|+.||||||||||+||.+||+++.++++||+||++|
T Consensus       323 HN~~NalAA~a~a~~lGi~~e~i~~aL~~F~GlpHR~E~V~~~~gv~~iNDSKaTN~~at~~Al~s~~~~iilI~GG~~K  402 (501)
T PRK02006        323 HNAANALAALALARAIGLPAAPLLHGLREYRGEPHRVEVIATIDDVDYVDDSKGTNVGATVAALDGLAQRVVLIAGGDGK  402 (501)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCEEEEEEECCEEEECCCCCCCHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             06999999999999859987898766315578765258999967889973787789899999997078974999805777


Q ss_pred             CCCHHHHHHHHCC-CCEEEEECCCHHHHHHHHHCC-CCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             2206898998427-868999889989988863168-98899879999999999999844898599945221663134798
Q gi|254781099|r  360 SDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGK-INSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNF  437 (468)
Q Consensus       360 ~~d~~~L~~~~~~-~~~~~liG~~~~~i~~~~~~~-~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y  437 (468)
                      +.||.+|.+.+.+ +..++++|++++.|.+.+... +++..+.++++|++.+.+   .+++||+|||||||||||||+||
T Consensus       403 ~~d~~~L~~~~~~~~k~vil~G~~~~~i~~~l~~~~~~~~~~~~l~~Av~~a~~---~a~~gd~VLlSPacaSfD~F~ny  479 (501)
T PRK02006        403 GQDFSPLAAPVARWARAVVLIGRDAPAIRAALADTGVPLVDAATLEEAVRAAAE---LAQPGDAVLLSPACASLDMFRNY  479 (501)
T ss_pred             CCCHHHHHHHHHHHCEEEEEECCCHHHHHHHHHCCCCEEEECCCHHHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCH
T ss_conf             779799999998537099998989999999975179807985999999999997---57897989989611030120699


Q ss_pred             HHHHHHHHHHHHHCCC
Q ss_conf             9999999999986379
Q gi|254781099|r  438 RERGFSFMSQVSEIPG  453 (468)
Q Consensus       438 ~~RG~~F~~~v~~l~~  453 (468)
                      +|||++|+++|++|..
T Consensus       480 eeRG~~F~~~V~~L~~  495 (501)
T PRK02006        480 AHRAQVFRAAVEELAL  495 (501)
T ss_pred             HHHHHHHHHHHHHHHH
T ss_conf             9999999999999998


No 4  
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=820.56  Aligned_cols=447  Identities=27%  Similarity=0.409  Sum_probs=367.7

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC-----HHHHHHHHCCCEEEC--CCCCCCCCCCEEEECCCCC
Q ss_conf             132189879998368548999999998598699981896-----478899978989964--5315722588899888868
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP-----CAVKQAKDMGIEVID--FREIPWSIISFLVLSPGIA   75 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~-----~~~~~l~~~g~~~~~--~~~~~~~~~d~vv~Spgi~   75 (468)
                      .++|+||+|+|+|+|+||+|+|++|+++|++|+++|+++     .....++..|+.+..  ..+.....+|+||+|||||
T Consensus         9 ~~~~~gk~v~V~GlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~l~~~g~~~~~g~~~~~~~~~~d~vV~SPGI~   88 (481)
T PRK01438          9 HDDWSGLRVVVAGLGVSGFPAADALHELGASVTVVADGDDDRSRERAALLEVLGATVRLGDGETTLPEGTELVVTSPGWR   88 (481)
T ss_pred             HHHCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHCCCEEEECCCHHHHHCCCCEEEECCCCC
T ss_conf             67718998999957588999999999679989999799874486899988854988996887566624899999899789


Q ss_pred             CCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             56755788899999769809983034223343015688689960345752157899999987310000000124432211
Q gi|254781099|r   76 LTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL  155 (468)
Q Consensus        76 ~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~  155 (468)
                      ++    ||++.+|++.|+||+||+||++++........|+|||||||||||||+|++|||+++|+++.++||||+|+++.
T Consensus        89 ~~----~p~~~~a~~~gi~i~~eiel~~~~~~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~~~GNIG~p~l~~  164 (481)
T PRK01438         89 PT----HPLLAAAAEAGIPVWGDVELAWRLRDPDGTPAPWLAVTGTNGKTTTVQMLASILRAAGLRAAAVGNIGVPVLDA  164 (481)
T ss_pred             CC----CHHHHHHHHCCCCEECHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHH
T ss_conf             98----99999999869938618999998752136888789993899746099999999996699707996256777764


Q ss_pred             CC-CCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCC-CCCCCCCHHHHHHHHHC
Q ss_conf             01-68883799921775432122333221011100210122211100001122100010134-43224786789998740
Q gi|254781099|r  156 EY-FSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH-AIICINDHQCEKIAYDM  233 (468)
Q Consensus       156 ~~-~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~-~iln~dd~~~~~~~~~~  233 (468)
                      .. ..+.+++|+|+|||||+++..++|+++|||||+|||||||+|||+|.++|.+||++... .++|.||+....+....
T Consensus       165 ~~~~~~~d~~V~ElSSfqL~~~~~~~p~iavitNIs~DHLD~h~s~e~Y~~aK~~If~~~~~~~v~n~dD~~~~~l~~~~  244 (481)
T PRK01438        165 VRGPDGYDVLAVELSSFQLHWAPSVRPHSAAVLNLAPDHLDWHGSMEAYAADKGRVYEGNTVACVYNVADPATEDLVREA  244 (481)
T ss_pred             HCCCCCCCEEEEECCCCCCCCCCCCCCCEEEEECCCHHHHHHHCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHC
T ss_conf             22888860899980476513344557648997068777866523598999999998627851499705778899999860


Q ss_pred             CCC------CCEEECCCCCCCCCCCCEEECCCEEEECCC---CCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHH
Q ss_conf             123------430110364432223411212413541467---64212345588510111001101222102222211000
Q gi|254781099|r  234 NFI------GHSISRISSQSLQSDSDLYIDESFLKCSAT---SEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKR  304 (468)
Q Consensus       234 ~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~  304 (468)
                      ...      .+..............+...++.++.....   .......++++|+||++|++||+++|+.+|++.+.|.+
T Consensus       245 ~~~~~~~~i~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~G~HN~~NalAA~a~a~~lGi~~~~i~~  324 (481)
T PRK01438        245 DVVEGARAIGFTLGTPGPSDLGIVDGILVDRAFVEDRFTSAQELATLSDVGPAAPHNVANALAAAALARAFGVSPAAVRD  324 (481)
T ss_pred             CCCCCCCEEEEECCCCCCCCCCEECCEEEECEEEEECCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             22447707887358887120121034553020343023453000106640676576999999999999982998899998


Q ss_pred             HCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC-CCCEEEEECCCH
Q ss_conf             0000013454433210034300000235567555555320133320012032101220689899842-786899988998
Q gi|254781099|r  305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSA  383 (468)
Q Consensus       305 ~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~-~~~~~~liG~~~  383 (468)
                      +|++|+|+|||||.+++.+|+.||||||||||+||.+||++++ +++||+||++|+.|+.+|.+.+. ++..++++|+++
T Consensus       325 aL~~F~Gl~hR~E~v~~~~GV~fiNDSKaTN~~A~~~AL~~~~-~i~lI~GG~~Kg~d~~~l~~~~~~~vk~~~l~G~~~  403 (481)
T PRK01438        325 GLRAFRPDAHRIEHVADADGVTYVDDSKATNPHAAEASLAAYP-SVVWIAGGLAKGAHFDDLVRAHAARLRGVVLIGADR  403 (481)
T ss_pred             HHHHCCCCCCEEEEEEEECCEEEECCCCCCCHHHHHHHHHHCC-CEEEEECCCCCCCCHHHHHHHHHHHCEEEEEECCCH
T ss_conf             8863489773378999999999980688789889999987249-889993786578898999999860133999977899


Q ss_pred             HHHHHHHHCCCC---EEE-ECCHHHHHHHHHH-HHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             998886316898---899-8799999999999-9984489859994522166313479899999999999863798
Q gi|254781099|r  384 MLFFHHFGGKIN---STL-SKTLDQALKSVVR-DVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI  454 (468)
Q Consensus       384 ~~i~~~~~~~~~---~~~-~~~~~~a~~~i~~-~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~~  454 (468)
                      ..|.+.+....+   ... ..+..++++.+++ +.+.+++||+|||||||||||||+||+|||++|+++|++|.|-
T Consensus       404 ~~i~~~~~~~~~~~~~~~~~~~~~~~l~~av~~a~~~a~~gd~VLlSPacaSfD~f~nyeeRG~~Fk~~V~~l~g~  479 (481)
T PRK01438        404 ALIREALARHAPDVPVVDVDRTDTEAMARAVRLAARLARPGDTVLLAPACASMDMFTNYAERGEAFAAAVRHLLGG  479 (481)
T ss_pred             HHHHHHHHHCCCCCCEEEECCCHHHHHHHHHHHHHHHCCCCCEEEECCHHHCCCCCCCHHHHHHHHHHHHHHHHCC
T ss_conf             9999999722898745773102378999999999963899898998950002022069999999999999972378


No 5  
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=809.83  Aligned_cols=430  Identities=32%  Similarity=0.424  Sum_probs=364.7

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCCH-----HHHHHHHCCCEEECCCC-------CCCCCCCEEEECCCCCCCC
Q ss_conf             99983685489999999985986999818964-----78899978989964531-------5722588899888868567
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHPC-----AVKQAKDMGIEVIDFRE-------IPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~-----~~~~l~~~g~~~~~~~~-------~~~~~~d~vv~Spgi~~~~   78 (468)
                      -+|+|+|+||+|+|++|+++|++|+++|+++.     ..++|...|+.+.....       .....+|+||+|||||++ 
T Consensus         3 a~V~GlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~L~~~gi~~~~g~~~~~~~~~~~~~~~d~vV~SPGI~~~-   81 (459)
T PRK02705          3 AHVIGLGRSGIAAARLLKAQGWEVVVSERNDSPELLERQQELEQEGITVELGKPLELESFQPWLDQPDLVVVSPGIPWD-   81 (459)
T ss_pred             EEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHCCCEEEECCCCCCCCHHHHCCCCCEEEECCCCCCC-
T ss_conf             9999548999999999997899599998989923478999998759869816766643013311678889989964998-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC--
Q ss_conf             557888999997698099830342233430156886899603457521578999999873100000001244322110--
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLE--  156 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~--  156 (468)
                         ||++++|+++|+||+||+||+++..    ...|+|||||||||||||+|++|||+.+|+++.++||||+|++++.  
T Consensus        82 ---~p~~~~a~~~gi~i~~eiel~~~~~----~~~~~IaVTGTnGKTTTt~ll~~iL~~~g~~~~~~GNIG~p~~~~~l~  154 (459)
T PRK02705         82 ---HPTLVELREKGIEVIGEMELAWRAL----KHIPWVGITGTNGKTTVTHLLAHILQAAGLNAPMCGNIGYAACELALL  154 (459)
T ss_pred             ---CHHHHHHHHCCCCEECHHHHHHHHH----CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEECCCCCCHHHHHHH
T ss_conf             ---9999999987997214999999985----049757771789727899999999998399853640137620444421


Q ss_pred             ---CCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHC
Q ss_conf             ---16888379992177543212233322101110021012221110000112210001013443224786789998740
Q gi|254781099|r  157 ---YFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM  233 (468)
Q Consensus       157 ---~~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~  233 (468)
                         ...+.||+|+|+||||||.+..++|+++|||||+|||||||+|||+|.++|.+|+++++..|+|.||+.++......
T Consensus       155 ~~~~~~~~d~~VlE~SSfQLe~~~~~~p~iavitNI~~DHLD~h~s~e~Y~~aK~~i~~~~~~~V~N~DD~~l~~~~~~~  234 (459)
T PRK02705        155 RSGKAEKPDWIVAELSSYQIESSPELAPKIGIWTTFTPDHLERHGTLENYFAIKASLLERSEIRILNGDDPYLRQGRSSW  234 (459)
T ss_pred             CCCCCCCCCEEEEECCHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHC
T ss_conf             34678876579997571331336677877899966887787664217789999997506598899938879999987643


Q ss_pred             CCCCCEEECCCC-CCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHH
Q ss_conf             123430110364-4322234112124135414676421234558851011100110122210222221100000000134
Q gi|254781099|r  234 NFIGHSISRISS-QSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGL  312 (468)
Q Consensus       234 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv  312 (468)
                      ... ..+..... .........+.+..++............++++|+||++|+++|+++|+.+|++.+.|.++|++|+|+
T Consensus       235 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~l~G~HN~~NalAAia~a~~lGi~~e~I~~aL~~F~Gl  313 (459)
T PRK02705        235 PKG-YWVSTQGKKSLLDQADFWIDQEGWVVERGEPLFPLEALKMPGAHNLQNLLLAVAAARLAGLSAEAIAKALRSFPGV  313 (459)
T ss_pred             CCC-EEEECCCCCCCCCCCCEEECCCCEEEECCEEEEEHHHCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCC
T ss_conf             774-7996556411211144488269879977805654042168767689999999999998588636678887508999


Q ss_pred             HHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC-CCCEEEEECCCHHHHHHHHH
Q ss_conf             54433210034300000235567555555320133320012032101220689899842-78689998899899888631
Q gi|254781099|r  313 THRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFG  391 (468)
Q Consensus       313 ~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~-~~~~~~liG~~~~~i~~~~~  391 (468)
                      |||||.|++.+|+.||||||||||+||.+||++++++++||+||++|+.|+.+|.+.+. ++..++++|++++.|.+.++
T Consensus       314 pHRlE~V~~~~gV~fiNDSKaTN~~a~~~Al~~~~~~iilI~GG~~K~~d~~~l~~~~~~~v~~v~~~G~~~~~i~~~l~  393 (459)
T PRK02705        314 PHRLERIGTINGIDFINDSKATNYDAAEVGLKAVPGPIILIAGGEAKQGDDSAWLKQIKAKAAAVLLFGEAAPELAQLLQ  393 (459)
T ss_pred             CCCEEEEEECCCEEEECCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCEEEEEECCCHHHHHHHHH
T ss_conf             98538987428878972787889899999998289986999567666787399999986406199998989999999997


Q ss_pred             CC---CCEEEECCHHHHHHHHHHHHHHCCCCC--EEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             68---988998799999999999998448985--99945221663134798999999999998637
Q gi|254781099|r  392 GK---INSTLSKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSFMSQVSEIP  452 (468)
Q Consensus       392 ~~---~~~~~~~~~~~a~~~i~~~~~~~~~gD--iVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~  452 (468)
                      ..   .++..+.++++|++.+.+.++   +||  +|||||||||||||+||+|||++|+++|++|-
T Consensus       394 ~~~~~~~~~~~~~l~~Av~~a~~~a~---~~~~~~VLlSPacaSfD~f~nyeeRG~~F~~~V~~l~  456 (459)
T PRK02705        394 ESGYTGEIEIVETLDEAVNRAFELAK---ELQAKSVLLSPACASFDQYQNFEERGDHFRQLIQELL  456 (459)
T ss_pred             HCCCCCCEEECCCHHHHHHHHHHHHH---CCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             36998776985999999999999876---5899989968744010132799999999999999986


No 6  
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=812.25  Aligned_cols=431  Identities=29%  Similarity=0.451  Sum_probs=366.3

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC--HHHHHHHH--CCCEEE--CCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             2189879998368548999999998598699981896--47889997--898996--45315722588899888868567
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKD--MGIEVI--DFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~--~~~~~l~~--~g~~~~--~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      ||+||+|+|+|+|+||+|+|++|+++|++|+++|+++  +...++..  .++.+.  .+.+.....+|+||+|||||++ 
T Consensus         2 ~~~~k~v~viGlG~sG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~~~i~~~~g~~~~~~~~~~d~vV~SPgI~~~-   80 (445)
T PRK04308          2 TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGKMFDGLVFYTGRLKDALDNGFDILALSPGISER-   80 (445)
T ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHCCCCCEEEECCCHHHHCCCCCEEEECCCCCCC-
T ss_conf             9799989999989999999999997899199997999953189997436996899378636501599999989953899-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-
Q ss_conf             5578889999976980998303422334301568868996034575215789999998731000000012443221101-
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEY-  157 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~-  157 (468)
                         ||++++|++.|+||+||+|++++....  ...|+|||||||||||||+|++|||+++|+++.++||||+|+++... 
T Consensus        81 ---~p~l~~a~~~gi~i~~~~el~~~~~~~--~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~~~GNiG~p~~~~~~~  155 (445)
T PRK04308         81 ---QPDIEAFKQNGGRVLGDIELLADIVNR--RGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAELQ  155 (445)
T ss_pred             ---CHHHHHHHHCCCCEECHHHHHHHHHHC--CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHH
T ss_conf             ---999999997599571599999999841--699579994899837799999999997599629985037521111444


Q ss_pred             --CCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             --688837999217754321223332210111002101222111000011221000101344322478678999874012
Q gi|254781099|r  158 --FSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF  235 (468)
Q Consensus       158 --~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~  235 (468)
                        ....|++|+|+|||||+.+..++|+++|||||+|||||||+||++|.++|.+||++++..++|.||+..+.+..... 
T Consensus       156 ~~~~~~d~~VlElSSfql~~~~~~~p~iavitNi~~DHLD~h~s~e~Y~~aK~~if~~~~~~vln~dd~~~~~~~~~~~-  234 (445)
T PRK04308        156 REGKKADVWVLELSSFQLENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGR-  234 (445)
T ss_pred             HCCCCCCEEEEEEECCCCCCCCCCCCCEEEECCCCHHHHHHHCCHHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHCCC-
T ss_conf             3278786799996033446655437638998589856754535999999999974457977999387199999986699-


Q ss_pred             CCCEEECCCCCCCCCCCCEEE--CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHH
Q ss_conf             343011036443222341121--241354146764212345588510111001101222102222211000000001345
Q gi|254781099|r  236 IGHSISRISSQSLQSDSDLYI--DESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLT  313 (468)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~  313 (468)
                         .+..+...   ...+++.  +...+............++++|.||++|+++|+++|+.+|++.+.|.++|++|+|+|
T Consensus       235 ---~v~~~~~~---~~~d~~~~~~~~~~~~~~~~l~~~~~l~l~G~HN~~NalAAia~a~~lGi~~~~I~~aL~~F~Gl~  308 (445)
T PRK04308        235 ---EVKWFSLE---HEADFWLERETGRLKQGNEDLIATQDIPLQGLHNAANVMAAVALCEAVGLPREALLEHVKTFQGLP  308 (445)
T ss_pred             ---CEEEEECC---CCCCEEEECCCCEEEECCCEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
T ss_conf             ---56998137---656368961663797468114543025667654798899999999982998899999987579999


Q ss_pred             HHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCC-CEEEEECCCHHHHHHHHHC
Q ss_conf             443321003430000023556755555532013332001203210122068989984278-6899988998998886316
Q gi|254781099|r  314 HRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGG  392 (468)
Q Consensus       314 ~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~-~~~~liG~~~~~i~~~~~~  392 (468)
                      ||||.+++.+|++||||||||||+||.+||+++.++++||+||++|+.|+.+|.+.+.+. ..++++|++++.+.+.+++
T Consensus       309 hR~E~v~~~~GV~~iNDSKaTn~~at~~Al~~~~~~i~lI~GG~~Kg~d~~~l~~~~~~~~~~v~~~G~~~~~i~~~l~~  388 (445)
T PRK04308        309 HRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDG  388 (445)
T ss_pred             CCEEEEEEECCEEEEECCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHCEEEEEECCCHHHHHHHHHH
T ss_conf             86289986489889807988888999999982779779997676677786999999875256999989799999998863


Q ss_pred             -CCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             -89889987999999999999984489859994522166313479899999999999863
Q gi|254781099|r  393 -KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       393 -~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                       .++...+.++++|++.+.+   .+++||+|||||||||||||+||+|||++|+++|++|
T Consensus       389 ~~~~~~~~~~l~~Av~~a~~---~a~~g~~VLlSPa~aSfD~f~nye~RG~~F~~~v~~L  445 (445)
T PRK04308        389 CGLNLTDCATLEEAVQTAYA---QAEAGDIVLLSPACASFDMFKGYAHRSEVFIEAFKAL  445 (445)
T ss_pred             CCCCEEECCCHHHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             79855876879999999997---4889898998973404013079999999999999739


No 7  
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=811.42  Aligned_cols=428  Identities=30%  Similarity=0.452  Sum_probs=357.1

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC--HHHHHHHHCCCEE--ECCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             132189879998368548999999998598699981896--4788999789899--645315722588899888868567
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEV--IDFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~--~~~~~l~~~g~~~--~~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      |+||+||+|+|+|+|+||+|+|++|.++|++|+++|++.  +..+.+ ..++.+  ..+.+.....+|+||+|||||++ 
T Consensus         1 ~~d~~~k~v~V~GlG~sG~s~~~~L~~~G~~v~~~D~~~~~~~~~~l-~~~~~~~~g~~~~~~~~~~d~vV~SPGI~~~-   78 (438)
T PRK03806          1 MADYQGKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKL-PENVERHTGSLNDEWLLAADLIVASPGIALA-   78 (438)
T ss_pred             CCCCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHH-HCCCCEEECCCCHHHHCCCCEEEECCCCCCC-
T ss_conf             97778998999945788899999999789969999899990057886-4588466577796680679999989978998-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             55788899999769809983034223343015688689960345752157899999987310000000124432211016
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYF  158 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~  158 (468)
                         ||++++|++.|+||+||+||+++.     .+.|+|||||||||||||+|++|||+++|+++.++||||+|++++ ..
T Consensus        79 ---~p~~~~a~~~~i~i~seiel~~~~-----~~~~iIaVTGTnGKTTTt~li~~iL~~~g~~~~~gGNiG~p~~~~-~~  149 (438)
T PRK03806         79 ---HPSLSAAADAGVEIVGDIELFCRE-----AQAPIVAITGSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LD  149 (438)
T ss_pred             ---CHHHHHHHHCCCCEEEHHHHHHCC-----CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH-HC
T ss_conf             ---989999998799477699997222-----799889994899848999999999986599756771577527775-13


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHH-HHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             8883799921775432122333221011100210122211-100001122100010134432247867899987401234
Q gi|254781099|r  159 SPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG  237 (468)
Q Consensus       159 ~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~-s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~  237 (468)
                      .+.|++|+|+|||||+++..++|+++|||||+|||||||+ +||+|.++|.+||++++..++|.||+....+...... .
T Consensus       150 ~~~d~~VlElSSfQLe~~~~~~p~vavilNi~~DHLDr~~~s~e~Y~~aK~rI~~~~~~~v~n~dD~~~~~~~~~~~~-~  228 (438)
T PRK03806        150 QDCELYVLELSSFQLETTSSLQAVAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADDALTMPVRGADER-C  228 (438)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHCCCC-E
T ss_conf             767579983245330023545763788635888788776545999999999886279689994751877986403565-5


Q ss_pred             CEEECCCCCCCCCCCCEEEC--CCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHH
Q ss_conf             30110364432223411212--4135414676421234558851011100110122210222221100000000134544
Q gi|254781099|r  238 HSISRISSQSLQSDSDLYID--ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHR  315 (468)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R  315 (468)
                        + .++...  .+......  ..++............++++|+||++|+++|+++|+.+|++.+.|.++|++|+|+|||
T Consensus       229 --i-~fg~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~G~HN~~NalaA~a~a~~lGi~~e~i~~aL~sF~gl~HR  303 (438)
T PRK03806        229 --V-SFGVNM--GDYHLNRQQGETWLRVKGEKVLNVKEMKLSGRHNYTNALAALALADAVGIPRASSLKALTTFTGLPHR  303 (438)
T ss_pred             --E-EEECCC--CCEEEEECCCCEEEEECCEEEEECHHCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCC
T ss_conf             --8-982356--64367605773689737803540121266672049889999999998399989986552047999973


Q ss_pred             HHHHCCCCCCEEECCCCCCCHHHHHHHHHCC--CCCCEEEECCCCCCCCHHHHHHHHCC-CCEEEEECCCHHHHHHHHHC
Q ss_conf             3321003430000023556755555532013--33200120321012206898998427-86899988998998886316
Q gi|254781099|r  316 LQTIARLGHVIFINDSKATNLHSVIHAFLNE--KRRIYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGG  392 (468)
Q Consensus       316 ~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~--~~~i~lI~GG~~K~~d~~~L~~~~~~-~~~~~liG~~~~~i~~~~~~  392 (468)
                      ||.+++.+|++||||||||||+||.+||+++  .++++||+||++|+.|+.+|.+.+.+ ...++++|++++.+.+....
T Consensus       304 lE~v~~~~gv~fiNDSKaTN~~a~~~Al~s~~~~~~i~lI~GG~~K~~d~~~l~~~~~~~~~~~~~~G~~~~~~~~~~~~  383 (438)
T PRK03806        304 FQLVLEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLLGGDGKSADFSPLARYLNGDNIRLYCFGRDGAQLAALRPE  383 (438)
T ss_pred             EEEEEEECCEEEEECCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCEEEEEECCCHHHHHHHCCC
T ss_conf             38999979999998972158999999998262039779995477555787999998612656999977788999964122


Q ss_pred             CCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             898899879999999999999844898599945221663134798999999999998637
Q gi|254781099|r  393 KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP  452 (468)
Q Consensus       393 ~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~  452 (468)
                      .  ...++++++|++.+.   +.+++||+|||||||||||||+||+|||++|+++|++|+
T Consensus       384 ~--~~~~~~l~~Av~~a~---~~a~~gd~VLlSPacaSfD~f~nye~RG~~F~~lv~~Lg  438 (438)
T PRK03806        384 V--AQLTETMEQAMRLLA---PRVQPGDMVLLSPACASLDQFKNFEQRGDEFARLAKELG  438 (438)
T ss_pred             C--CHHHHHHHHHHHHHH---HHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             0--415400999999999---866899989989745030142499999999999999629


No 8  
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=803.37  Aligned_cols=433  Identities=29%  Similarity=0.428  Sum_probs=364.4

Q ss_pred             CCCHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC--CHHHHHHHHC--CCEE--ECCCCCCCCCCCEEEECCCC
Q ss_conf             9813218987999836854899999999859869998189--6478899978--9899--64531572258889988886
Q gi|254781099|r    1 MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDM--GIEV--IDFREIPWSIISFLVLSPGI   74 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~--~~~~~~l~~~--g~~~--~~~~~~~~~~~d~vv~Spgi   74 (468)
                      |.|-. .++.++|+|+|+||+|+|++|+++|++|+++|++  ++....++..  ++.+  ..+....+..+|+||+||||
T Consensus         1 ~~~~~-~~~~~LV~G~G~sG~s~a~~L~~~G~~V~~~D~~~~~~~~~~~~~~~~~i~~~~g~~~~~~~~~~d~vv~SPgI   79 (448)
T PRK03803          1 MSLIA-SDGLRIVVGLGKSGMSLVRFLARQGYQFAVTDTRENPPELATLRRDYPQVEVRCGELDAEFLCQAEEIIVSPGL   79 (448)
T ss_pred             CCEEE-CCCCEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHCCCCEEEECCCCHHHHCCCCEEEECCCC
T ss_conf             96360-59958999989999999999997889599991899916799999747997799788897780789999989972


Q ss_pred             CCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             85675578889999976980998303422334301568868996034575215789999998731000000012443221
Q gi|254781099|r   75 ALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN  154 (468)
Q Consensus        75 ~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~  154 (468)
                      |++    ||++++|++.|+||+||+||+++.     .+.|+|||||||||||||+|++|||+.+|+++.++||||+|+++
T Consensus        80 ~~~----~p~~~~a~~~~i~i~~e~el~~~~-----~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~~gGNiG~p~~~  150 (448)
T PRK03803         80 ALA----TPALQAAAAAGIKISGDIELFARA-----AKAPIVAITGSNAKSTVTTLVGEMAKAAGKRVAVGGNLGTPALD  150 (448)
T ss_pred             CCC----CHHHHHHHHCCCCEECHHHHHHHH-----CCCCEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCHHHH
T ss_conf             999----999999998599683199998621-----78988998589983889999999998659837994032761366


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHC-
Q ss_conf             1016888379992177543212233322101110021012221110000112210001013443224786789998740-
Q gi|254781099|r  155 LEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM-  233 (468)
Q Consensus       155 ~~~~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~-  233 (468)
                      +. .++.|++|+|+|||||+++..++|+++|||||+|||||||+|||+|.++|.+||++++..++|.||+..+.+.... 
T Consensus       151 ~~-~~~~~~~VlElSSfqL~~~~~~~p~iaVitNI~~DHLD~h~s~e~Y~~aK~~If~~~~~~v~n~Dd~~~~~l~~~~~  229 (448)
T PRK03803        151 LL-SDDVELYVLELSSFQLETTDQLNAEVATVLNISEDHLDRHGGMLAYHQAKHRIFRGAKQVVVNRDDALTRPLVADGT  229 (448)
T ss_pred             HH-CCCCCEEEEECCCCHHHCCCCCCCCEEEEECCCHHHHHHHCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCC
T ss_conf             52-58887899986641120354568628998358753654633899999998777538878999586088888865488


Q ss_pred             CCCCCEEECCCCCCCCCCCCEEECCC--EEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHH
Q ss_conf             12343011036443222341121241--3541467642123455885101110011012221022222110000000013
Q gi|254781099|r  234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGG  311 (468)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~g  311 (468)
                      +...+.....   ... .........  ++............++++|.||++|++||+++|+.+|++.+.|.++|++|+|
T Consensus       230 ~~~~f~~~~~---~~~-~~~~~~~~g~~~~~~~~~~~~~~~~l~l~G~HN~~NalAA~a~a~~~Gi~~e~I~~aL~~F~G  305 (448)
T PRK03803        230 PCWSFGLNAP---DFG-AFGLREEDGEKYLAFGFERLLPVRELKIRGAHNQSNALAALALGEAAGLPMEAMLETLKEFKG  305 (448)
T ss_pred             CEEEEECCCC---CCC-CCCEEECCCEEEEECCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC
T ss_conf             5799835776---512-231695398399961653214333307676235998999999999829987898998863557


Q ss_pred             HHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCC----CCCCEEEECCCCCCCCHHHHHHHHCC-CCEEEEECCCHHHH
Q ss_conf             45443321003430000023556755555532013----33200120321012206898998427-86899988998998
Q gi|254781099|r  312 LTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE----KRRIYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLF  386 (468)
Q Consensus       312 v~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~----~~~i~lI~GG~~K~~d~~~L~~~~~~-~~~~~liG~~~~~i  386 (468)
                      +|||||.+++.+|++||||||||||+||.+||+++    +++++||+||++|+.|+.+|.+.+.+ +..++++|++++.+
T Consensus       306 l~hR~E~v~~~~Gv~fiNDSKaTN~~at~~Al~~~~~~~~~~iilI~GG~~K~~d~~~l~~~~~~~v~~v~l~G~~~~~i  385 (448)
T PRK03803        306 LEHRCQWVREVDGVRYYNDSKGTNVGATLAAIEGLGADIEGKLVLIAGGQGKGADFSELREPVAKYCRAVVLIGRDAELI  385 (448)
T ss_pred             CCEEEEEEEECCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCEEEEEECCCHHHH
T ss_conf             12057999961888999689989978999999964652368689993786666687999999973660999979599999


Q ss_pred             HHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             88631689889987999999999999984489859994522166313479899999999999863
Q gi|254781099|r  387 FHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       387 ~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                      .+.+...+++..+.++++|+..+.+   .+++||+|||||||||||||+||+|||++|+++|++|
T Consensus       386 ~~~l~~~~~~~~~~~l~~Av~~a~~---~a~~gd~VLlSPa~aSfD~f~nyeeRG~~F~~~V~~L  447 (448)
T PRK03803        386 EQALGDAVPLVRAATLEEAVTQAAE---LAQPGDAVLLSPACASLDMFKNFEERGRQFAQAVEGL  447 (448)
T ss_pred             HHHHCCCCCEEECCCHHHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9975068987994999999999998---5789898998974402013179999999999999975


No 9  
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=797.86  Aligned_cols=436  Identities=34%  Similarity=0.546  Sum_probs=360.1

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC--CCEEECCCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             132189879998368548999999998598699981896478899978--989964531572258889988886856755
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFREIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~--g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      |..|.+|+|+|+|+|+||+|+|++|+++|..| .+|+.+.....++..  ...+....+..++.+|+||+|||||++   
T Consensus         1 ~~~~~~K~v~V~GlG~sG~a~~~~L~~~~~~~-~~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~iV~SPGI~~~---   76 (450)
T PRK01368          1 MNSHTKQKIGVFGLGKTGISVYEELQNKYDLI-VYDDLKANRDIFEELFSKNAIIALSDSRWQNLDKIVLSPGIPLT---   76 (450)
T ss_pred             CCCCCCCEEEEEEECHHHHHHHHHHHHCCCEE-EEECCCCCHHHHHHHHCCCCEECCCCCCHHCCCEEEECCCCCCC---
T ss_conf             97668990899958787999999997199989-99899656478997521483602571115219999989961998---


Q ss_pred             CCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             78889999976980998303422334301568868996034575215789999998731000000012443221101688
Q gi|254781099|r   81 AHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSP  160 (468)
Q Consensus        81 ~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~~~  160 (468)
                       ||++++|++.|+||+||+||+++..    ...|+|||||||||||||+|++|||+++|+++.++||||+|++++  ..+
T Consensus        77 -~p~~~~a~~~~i~i~~eiel~~~~~----~~~~~IaITGTnGKTTTt~li~~iL~~~g~~~~~~GNIG~p~l~~--~~~  149 (450)
T PRK01368         77 -HEIVKIAKNFNIPITSDIDLLFEKS----KNLKFIAITGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALQA--KAS  149 (450)
T ss_pred             -CHHHHHHHHCCCCEEEHHHHHHHHC----CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHC--CCC
T ss_conf             -9999999987995876999999766----799779996899974899999999997599628962556366525--268


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             837999217754321223332210111002101222111000011221000101---34432247867899987401234
Q gi|254781099|r  161 NRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDMNFIG  237 (468)
Q Consensus       161 ~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~~~~~  237 (468)
                      .|++|+|+|||||++++.++|+++|||||+|||||||+|||+|.++|.+||+++   +..++|.||+.++.+........
T Consensus       150 ~d~~VlElSSfQl~~~~~~~p~iAVilNIs~DHLD~h~s~e~Y~~aK~~If~~~~~~~~~Vin~Dd~~~~~l~~~l~~~~  229 (450)
T PRK01368        150 KDGYVLELSSFQLDLVKTFTAKIAVLLNITPDHLDRHQDMNGYIAAKSKIFDRMDKDSYAVINIDNDYCREIFIKLQQEQ  229 (450)
T ss_pred             CCEEEEEECCCCHHCCCCCCCCEEEEECCCHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHCCCC
T ss_conf             97599993565220363479878999468877987726878999999999965898888999787488999998630045


Q ss_pred             -CEEECCCCCCCCCCCCEEECCCEEEE--CCC-CCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHH
Q ss_conf             -30110364432223411212413541--467-64212345588510111001101222102222211000000001345
Q gi|254781099|r  238 -HSISRISSQSLQSDSDLYIDESFLKC--SAT-SEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLT  313 (468)
Q Consensus       238 -~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~-~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~  313 (468)
                       .....+...... +............  ... ........+++|.||++|++||+++|+.+|++.+.|.++|++|+|+|
T Consensus       230 ~~~~i~f~~~~~~-~~g~~~~~~~~~~~~~~~~~~~~~~~~~L~G~HN~~NalAA~a~a~~lGi~~~~I~~aL~~F~glp  308 (450)
T PRK01368        230 RIKLIPFSVTKIL-ENGISVVDDKILDNFFDDISFKLPFNKNLQGKHNCENIAASYAVAKIIGVEPKKILESISSFQSLP  308 (450)
T ss_pred             CEEEEEECCCCCC-CCCEEEECCEEEEECCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCHH
T ss_conf             5169740345324-477488547335520155330045211357565899999999999980997777787642467700


Q ss_pred             HHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHCC
Q ss_conf             44332100343000002355675555553201333200120321012206898998427868999889989988863168
Q gi|254781099|r  314 HRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGK  393 (468)
Q Consensus       314 ~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~~~~~liG~~~~~i~~~~~~~  393 (468)
                      ||||++++.+|+.||||||||||+||.+||+++++ ++||+||++|+.|+.+|.+.+.++..++++|++.+.+.+.++..
T Consensus       309 HRlE~V~~~~gv~~iNDSKaTN~~a~~~Al~~~~~-i~lI~GG~~K~~d~~~l~~~~~~v~~~~l~G~~~~~~~~~~~~~  387 (450)
T PRK01368        309 HRMQYIGSINNISFYNDSKATNAISAVQSIKALDN-IYWLAGGIPKEGGIEEIKPYFSKIKKAYFYGQAKEMFANTAKNI  387 (450)
T ss_pred             HEEEEEEEECCEEEECCCCCCCHHHHHHHHHCCCC-EEEEEECCCCCCCHHHHHHHHHCCCEEEEECCCHHHHHHHCCCC
T ss_conf             14689999899999717887899999999856897-39999415777887999988743879999897899999860589


Q ss_pred             CCEEEECCHHHHHHHHHHHHHH-CCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             9889987999999999999984-489859994522166313479899999999999863
Q gi|254781099|r  394 INSTLSKTLDQALKSVVRDVEN-VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       394 ~~~~~~~~~~~a~~~i~~~~~~-~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                      +++..+.++++|++.+.+.+.. ..++++|||||||||||||+||+|||++|++||++|
T Consensus       388 ~~~~~~~~l~~av~~a~~~a~~~~~~~~~VLlSPacaSfD~f~nye~RG~~F~~lv~~L  446 (450)
T PRK01368        388 VDFVICDNLEQAFDLAYKDAVGDNAEVKNILLAPSCSSYDQFKNFEERGELFIKLSSIL  446 (450)
T ss_pred             CCEEECCCHHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             87696499999999999997557878997996860204013179999999999999998


No 10 
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=799.54  Aligned_cols=435  Identities=26%  Similarity=0.379  Sum_probs=358.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECC--CCCCCCCCCEEEECCCCCCCCCCCCHH
Q ss_conf             898799983685489999999985986999818964788999789899645--315722588899888868567557888
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF--REIPWSIISFLVLSPGIALTGENAHWC   84 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~--~~~~~~~~d~vv~Spgi~~~~~~~~~~   84 (468)
                      +||+|+|+|+|+||+|+|++|+++|++|+++|+++.....+...++.....  ....+.++|+||+|||||++    ||+
T Consensus        11 ~Gk~V~V~GlG~sG~a~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vV~SPGI~~~----~p~   86 (487)
T PRK03369         11 PGAPVLVAGAGVTGRAVLAALTRFGARPTVCDDDPDALRPHAERGVATVSSSDAVQQIADYALVVTSPGFPPT----APV   86 (487)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCCEECCCCCHHHHCCCCEEEECCCCCCC----CHH
T ss_conf             9898999915683899999999786979999898257799986599486376226564677889989957998----999


Q ss_pred             HHHHHHCCCEEEEEHHHHHHHHHHCC--CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99999769809983034223343015--6886899603457521578999999873100000001244322110168883
Q gi|254781099|r   85 VKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR  162 (468)
Q Consensus        85 ~~~a~~~gi~v~s~~el~~~~~~~~~--~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~~~~~  162 (468)
                      +++|++.|+||+||+||+++..+...  ...|+|||||||||||||+|++|||+.+|+++.++||||.|+++. ...+.|
T Consensus        87 l~~a~~~gi~i~~eieL~~~~~~~~~~~~~~~~IaVTGTnGKTTttsli~~iL~~~g~~~~~~GNiG~p~~~~-~~~~~~  165 (487)
T PRK03369         87 LAAAAAAGVPIWGDVELAWRLDAAGCYGPPRRWLVVTGTNGKTTTTSMLHAMLRAAGRRSVLCGNIGSPVLDV-LDEPAE  165 (487)
T ss_pred             HHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHH-CCCCCC
T ss_conf             9999988990765999999987444336766559997988727899999999985899859981366576641-247885


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEC
Q ss_conf             79992177543212233322101110021012221110000112210001013443224786789998740123430110
Q gi|254781099|r  163 FYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR  242 (468)
Q Consensus       163 ~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~~~~~~  242 (468)
                      ++|+|+|||||+++..++|+++|||||++||||||+|||+|.++|.+||.+ +..++|.||+....+.............
T Consensus       166 ~~V~ElSSfql~~~~~~~p~iaVitNI~~DHLD~h~s~e~Y~~aK~ri~~~-~~~v~n~DD~~~~~l~~~~~~~~~~~~~  244 (487)
T PRK03369        166 LLAVELSSFQLHWAPSLRPEAGAVLNIAEDHLDWHGTMAAYAAAKARALTG-RVAVAGLDDSRAAALLDTAPAPVRVGFR  244 (487)
T ss_pred             EEEEEECCCCCCCCCCCCCCEEEECCCCHHHHHHCCCHHHHHHHHHHHHCC-CEEEEECCCHHHHHHHHHCCCCEEEEEE
T ss_conf             899981365434466668547885278877875428999999997557339-8799968768899997427876799653


Q ss_pred             CCCCCCCCCCCEEECCCEEEE--CCCC--CCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHH
Q ss_conf             364432223411212413541--4676--421234558851011100110122210222221100000000134544332
Q gi|254781099|r  243 ISSQSLQSDSDLYIDESFLKC--SATS--EVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQT  318 (468)
Q Consensus       243 ~~~~~~~~~~~~~~~~~~~~~--~~~~--~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~  318 (468)
                      ....   ....+......+..  ....  ......++++|.||++|+++|++++..+|++.+.|.++|++|+|+|||||.
T Consensus       245 ~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~G~HNv~NalAA~a~a~~lGi~~~~i~~aL~~F~glphR~E~  321 (487)
T PRK03369        245 LGEP---AAGELGVRDGHLVDRAFADDLTLAPVDSIPVPGPVGVLDALAAAALARAVGVPAGAIADALASFRVGRHRAEV  321 (487)
T ss_pred             CCCC---CCCCEEEECCEEEEEECCCCCEEEEHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             2787---6442126536899841367736724664588635369989999999998499999999999857999985289


Q ss_pred             HCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC-CCCEEEEECCCHHHHHHHHHCCC---
Q ss_conf             10034300000235567555555320133320012032101220689899842-78689998899899888631689---
Q gi|254781099|r  319 IARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKI---  394 (468)
Q Consensus       319 i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~-~~~~~~liG~~~~~i~~~~~~~~---  394 (468)
                      +++.+|+.||||||||||+|+.+||++++ +++||+||++|+.|+.+|.+.+. ++..++++|++...+.+.+....   
T Consensus       322 v~~~~Gv~fiNDSKaTn~~a~~~Al~s~~-~iilI~GG~~Kg~~~~~L~~~~~~~v~~v~l~G~d~~~i~~~l~~~~~~~  400 (487)
T PRK03369        322 VAVADGITYVDDSKATNPHAARASILAYP-RVVWIAGGLLKGASVDALVAEMASRLVGAVLIGRDRAVVAEALSRHAPDV  400 (487)
T ss_pred             EEEECCEEEEECCCCCCHHHHHHHHHHCC-CEEEECCCCCCCCCHHHHHHHHHHHEEEEEEECCCHHHHHHHHHHHCCCC
T ss_conf             99999999982576689889999986155-50896155436777077899997542599997888899999997427766


Q ss_pred             CEEEECC--------------------------HHHH-HH-HHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             8899879--------------------------9999-99-999999844898599945221663134798999999999
Q gi|254781099|r  395 NSTLSKT--------------------------LDQA-LK-SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS  446 (468)
Q Consensus       395 ~~~~~~~--------------------------~~~a-~~-~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~  446 (468)
                      +...+.+                          +.++ ++ ++..+.+.++|||+|||||||||||||+||+|||++|++
T Consensus       401 ~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~AV~~A~~~a~~GdvVLLSPacaSfD~f~nye~RG~~F~~  480 (487)
T PRK03369        401 PVVEVVTGEDAGMPATPEACVLDVTKVDDAGGTLGDAVMTAAVAAARGLARPGDTVLLAPAGASFDQFTGYADRGDAFAA  480 (487)
T ss_pred             CCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCEEEECCHHHCHHCCCCHHHHHHHHHH
T ss_conf             52133113222210013454433332100112035779999999999748999989979555341030799999999999


Q ss_pred             HHHHC
Q ss_conf             99863
Q gi|254781099|r  447 QVSEI  451 (468)
Q Consensus       447 ~v~~l  451 (468)
                      +|++|
T Consensus       481 ~V~~l  485 (487)
T PRK03369        481 AVRAA  485 (487)
T ss_pred             HHHHH
T ss_conf             99997


No 11 
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=797.63  Aligned_cols=441  Identities=25%  Similarity=0.337  Sum_probs=354.6

Q ss_pred             CCCHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHH---HHCCCEE-ECCCCCCCCCCCEEEECCCCC
Q ss_conf             98132189879998368548999999998598699981-896478899---9789899-645315722588899888868
Q gi|254781099|r    1 MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD-DHPCAVKQA---KDMGIEV-IDFREIPWSIISFLVLSPGIA   75 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D-~~~~~~~~l---~~~g~~~-~~~~~~~~~~~d~vv~Spgi~   75 (468)
                      |+|++|+||+|+|+|+|+||+|+|++|+++|..+...+ ++.......   ...+..+ .+.....+..+|+||+|||||
T Consensus         1 m~~~~~~gkkv~V~GlG~sG~aaa~~L~~~g~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~vv~SPGi~   80 (468)
T PRK04690          1 MRISQLEGKRVALWGWGREGRAAYRALRAQLPAQPLTVFCNAEEVREVGALADAALLVETEASAQRLAAFEVVVKSPGIS   80 (468)
T ss_pred             CCHHHCCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHCCCCCEEECCCCHHHHHCCCEEEECCCCC
T ss_conf             97644397979998347879999999996699049997288324646676204575674677855761488999899579


Q ss_pred             CCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHC-CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             5675578889999976980998303422334301-568868996034575215789999998731000000012443221
Q gi|254781099|r   76 LTGENAHWCVKLANQFNVEIIGDIELFVRERRFS-SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN  154 (468)
Q Consensus        76 ~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~-~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~  154 (468)
                      ++    ||++.+|++.|+||+||+||+++..... ....|+|||||||||||||+||+|||+.+|+++.++||||+|+++
T Consensus        81 ~~----~p~~~~a~~~~i~i~~eiel~~~~~~~~~~~~~k~IaVTGTNGKTTTt~ll~~iL~~~g~~~~~~GNIG~P~~~  156 (468)
T PRK04690         81 PY----RPEALAAAAQGTPFIGGTALWFAEHAQPDGSVPGAVCVTGTKGKSTTTALLAHLLRAAGHRTALVGNIGQPLLE  156 (468)
T ss_pred             CC----CHHHHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCHHHHH
T ss_conf             86----89999999879948868999998753112567878999699858999999999998579982898677644676


Q ss_pred             CCC-CCCCCEEEEECCCCCCCCC--CCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC--CCCCCCCCCHHHHHH
Q ss_conf             101-6888379992177543212--23332210111002101222111000011221000101--344322478678999
Q gi|254781099|r  155 LEY-FSPNRFYVIECSSYQIELT--PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKI  229 (468)
Q Consensus       155 ~~~-~~~~~~~V~E~SSfQL~~~--~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~--~~~iln~dd~~~~~~  229 (468)
                      +.. .++.+++|+|+|||||+.+  ..++|+++|||||+|||||||+|||+|.++|++||.++  +..++|.+|+....+
T Consensus       157 ~~~~~~~~d~~VlElSSfQLe~~~~~~~~p~iavilNispDHLDrHgs~e~Y~~aK~~If~~~~~~~~vin~~D~~~~~~  236 (468)
T PRK04690        157 VLAPQPAPAYWAIELSSYQTGDVGRSGARPELAVVLNLFPEHLDWHGGEARYVRDKLSLVTEGRPRIALLNAADPRLAAL  236 (468)
T ss_pred             HHCCCCCCCEEEEEECCCHHHHHHHCCCCCCEEEEECCCHHHHHHCCCHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHH
T ss_conf             53247888579999432057654531478778753048887874608999999999999965799779997888899975


Q ss_pred             HHHCCCCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCH
Q ss_conf             87401234301103644322234112124135414676421234558851011100110122210222221100000000
Q gi|254781099|r  230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSC  309 (468)
Q Consensus       230 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f  309 (468)
                      ....    ..+..+...     ...+.....+............++++|.||++|+++|+++++.+|++.+.|.++|++|
T Consensus       237 ~~~~----~~v~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~l~L~G~HN~~NalAA~a~a~~lGv~~~~I~~aL~sF  307 (468)
T PRK04690        237 QLPD----SEVRWFNHP-----DGWHVRGDVVYRGEQAIFDTANVPLPGRHNRGNLCAVLAALEALGLDAAALAPAAASF  307 (468)
T ss_pred             HCCC----CCEEEECCC-----CCEEECCCEEEECCCCEECCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             2577----846995177-----7537606678835620111123677770048769999999998389889999987426


Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCC-CCCEEEECCCCCCCCHHHHHHHHCCCC--EEEEECCCHHHH
Q ss_conf             13454433210034300000235567555555320133-320012032101220689899842786--899988998998
Q gi|254781099|r  310 GGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK-RRIYWIAGGLSKSDDFSTLFPFISKIA--KAYFIGNSAMLF  386 (468)
Q Consensus       310 ~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~-~~i~lI~GG~~K~~d~~~L~~~~~~~~--~~~liG~~~~~i  386 (468)
                      +|+|||||++++.+|+.||||||||||+||.+||++++ ++++||+||++|+.|+.+|.+.+.+..  .++++|++++.+
T Consensus       308 ~glpHRlE~v~~~~gv~fiNDSKATN~~a~~~AL~~f~~~~iilI~GG~~Kg~d~~~l~~~~~~~~~~~vi~~G~~~~~i  387 (468)
T PRK04690        308 RPLPNRLQELGSVDGITYVNDSISTTPHASLAALDCFAGRRVALLVGGHDRGLDWTDFAAHMAQQAPLEIVTMGANGPRI  387 (468)
T ss_pred             CCCCCCEEEEEEECCEEEECCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEEECCCHHHH
T ss_conf             79997527999989999973787789899999997276685799973676677879999998633768999974788999


Q ss_pred             HHHHHC-----CCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHH-------HHHCCCC
Q ss_conf             886316-----8988998799999999999998448985999452216631347989999999999-------9863798
Q gi|254781099|r  387 FHHFGG-----KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQ-------VSEIPGI  454 (468)
Q Consensus       387 ~~~~~~-----~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~-------v~~l~~~  454 (468)
                      .+.+..     .+++..+.++++|++.+.+.  ...+||+|||||||||||||+||+|||++|++|       |+.++|.
T Consensus       388 ~~~~~~~~~~~~~~~~~~~~l~~Av~~a~~~--~~~~gd~VLLSPacASfD~F~nyeeRG~~Fk~L~~~~~~~~~~~~~~  465 (468)
T PRK04690        388 HALLAPLADAGRFGLHAADDLPHAMALARTA--LGAQGGVVLLSPGAPSFGAYRDYVARGRHFAQLAGFDPAAISAIPGL  465 (468)
T ss_pred             HHHHHHCCCCCCEEEEECCCHHHHHHHHHHH--CCCCCCEEEECCHHHCCCCCCCHHHHHHHHHHHHCCCHHHHHHCCCC
T ss_conf             9997523445631025406799999999996--05899989979531150041799999999999878087778526775


Q ss_pred             CC
Q ss_conf             52
Q gi|254781099|r  455 EM  456 (468)
Q Consensus       455 ~~  456 (468)
                      -|
T Consensus       466 ~~  467 (468)
T PRK04690        466 GV  467 (468)
T ss_pred             CC
T ss_conf             76


No 12 
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=796.33  Aligned_cols=437  Identities=37%  Similarity=0.524  Sum_probs=375.5

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH----HHHHHHCCCEEEC--CCCCCCCCCCEEEECCCCCC
Q ss_conf             13218987999836854899999999859869998189647----8899978989964--53157225888998888685
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID--FREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~----~~~l~~~g~~~~~--~~~~~~~~~d~vv~Spgi~~   76 (468)
                      |..|++++|+|+|+|+||+|+|++|+++|+.|.++|+++..    ...+...++.+..  +....+..+|+||.|||||+
T Consensus         2 ~~~~~~~kv~V~GLG~sG~a~a~~L~~~G~~v~v~D~~~~~~~~~~~~~~~~~i~~~~g~~~~~~~~~~d~vV~SPGi~~   81 (448)
T COG0771           2 MEDFQGKKVLVLGLGKSGLAAARFLLKLGAEVTVSDDRPAPEGLAAQPLLLEGIEVELGSHDDEDLAEFDLVVKSPGIPP   81 (448)
T ss_pred             CCCCCCCEEEEEECCCCCHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHCCCCEEECCCCCHHCCCCCCEEEECCCCCC
T ss_conf             51005997999926651099999999779869998389876532344442037223137641100134778998999999


Q ss_pred             CCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             67557888999997698099830342233430156886899603457521578999999873100000001244322110
Q gi|254781099|r   77 TGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLE  156 (468)
Q Consensus        77 ~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~  156 (468)
                      +    ||++++|++.|+||++|+|||++..    ...|+|||||||||||||+|++|||+++|+++.++||||+|++++.
T Consensus        82 ~----~p~v~~A~~~gi~i~~dieL~~r~~----~~~p~vaITGTNGKTTTTsli~~~l~~~G~~~~lgGNIG~p~l~~~  153 (448)
T COG0771          82 T----HPLVEAAKAAGIEIIGDIELFYRLS----GEAPIVAITGTNGKTTTTSLIAHLLKAAGLDALLGGNIGTPALELL  153 (448)
T ss_pred             C----CHHHHHHHHCCCCEEEHHHHHHHHC----CCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEECCCCCCCHHHHH
T ss_conf             8----8899999986993774888898744----8999899979996288999999999855998321351671378762


Q ss_pred             CC-CCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECC-CCCCCCCCHHHHHHHHHCC
Q ss_conf             16-888379992177543212233322101110021012221110000112210001013-4432247867899987401
Q gi|254781099|r  157 YF-SPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK-HAIICINDHQCEKIAYDMN  234 (468)
Q Consensus       157 ~~-~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~-~~iln~dd~~~~~~~~~~~  234 (468)
                      .. .+.|++|+|+|||||+++..++|++++||||++||||||+|||+|+++|++|+.++. .+|+|.||+++..+.... 
T Consensus       154 ~~~~~~d~~VlElSSfQL~~~~~~~P~iavilNi~~DHLD~H~s~e~Y~~aK~~i~~~~~~~~Vin~dd~~~~~~~~~~-  232 (448)
T COG0771         154 EQAEPADVYVLELSSFQLETTSSLRPEIAVILNISEDHLDRHGSMENYAAAKLRILEGQTEVAVINADDAYLKTLADEA-  232 (448)
T ss_pred             CCCCCCCEEEEECCCCCCCCCCCCCCCEEEEECCCHHHHHHCCCHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHC-
T ss_conf             0157898799992455516576678557999448877865606999999999999838962799837727776544303-


Q ss_pred             CCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHH
Q ss_conf             23430110364432223411212413541467642123455885101110011012221022222110000000013454
Q gi|254781099|r  235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTH  314 (468)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~  314 (468)
                       .......++...... ...+.......+..........++++|.||++|++||+|+|+.+|++.+.+.++|++|+|++|
T Consensus       233 -~~~~~~~fs~~~~~~-~~~~~~~~~~~~~~~~i~~~~~l~l~G~hn~~N~lAa~a~a~~~gv~~e~i~~~L~~F~gl~H  310 (448)
T COG0771         233 -TKARVIWFSFGEPLA-DGDYIYDGKLVFKGEKLLPADELKLPGAHNLENALAALALARALGVPPEAILEALSSFTGLPH  310 (448)
T ss_pred             -CCCEEEEEECCCCCC-CCCEEECCHHCCCCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCC
T ss_conf             -663268897466455-663343401103530003342158754524998999999999839998999999973899986


Q ss_pred             HHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCC-CEEEEECCCHHHHHHHHHCC
Q ss_conf             43321003430000023556755555532013332001203210122068989984278-68999889989988863168
Q gi|254781099|r  315 RLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGK  393 (468)
Q Consensus       315 R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~-~~~~liG~~~~~i~~~~~~~  393 (468)
                      |||.+++.+|+.||||||||||+||.+||.+++++++||+||++|+.|+.+|.+.+.+. ..+|++|+++..+.+.+++.
T Consensus       311 R~e~v~~~~gv~f~NDSKATN~~At~~AL~~~~~~v~lI~GG~~Kg~df~~L~~~~~~~~~~~~~~G~~~~~i~~~l~~~  390 (448)
T COG0771         311 RLEFVGEKDGVLFINDSKATNVDATLAALSGFDGPVILIAGGDDKGADFSPLAEILAKVIKKLVLIGEDAEKIAAALKEA  390 (448)
T ss_pred             CEEEEEECCCEEEECCCCCCCHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHCCEEEEEECCCHHHHHHHHHHC
T ss_conf             22798861988996078788888999999718997799977778888816889977415559999478889999998752


Q ss_pred             CC-EEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             98-8998799999999999998448985999452216631347989999999999986379
Q gi|254781099|r  394 IN-STLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG  453 (468)
Q Consensus       394 ~~-~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~  453 (468)
                      .+ ...+.++++|+..+..   .+++||+|||||||||||||+||+|||++|+++|++|.+
T Consensus       391 ~~~~~~~~~le~Av~~a~~---~a~~gd~VLLSPacASfDqf~~feeRG~~F~~~v~~l~~  448 (448)
T COG0771         391 GPSLVICETLEEAVQLARE---LAQPGDVVLLSPACASFDQFKNFEERGEEFKELVSELGG  448 (448)
T ss_pred             CCCEEECCCHHHHHHHHHH---HHCCCCEEEECCCCCCHHHHCCHHHHHHHHHHHHHHHCC
T ss_conf             7853614769999999998---725898699764421642223799999999999998549


No 13 
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=793.86  Aligned_cols=438  Identities=26%  Similarity=0.355  Sum_probs=354.4

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH-HHHHHHCCCEEECC--CCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             3218987999836854899999999859869998189647-88999789899645--31572258889988886856755
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-VKQAKDMGIEVIDF--REIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~-~~~l~~~g~~~~~~--~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      +.+++ ||+|+|+|+||+|+|++|+++|++|.++|+++.. ...++..++.....  ....+..+|+||+|||||++   
T Consensus        14 ~~l~~-kvlV~GlG~SG~s~a~~L~~~G~~v~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vV~SPGI~~~---   89 (476)
T PRK00141         14 DALRG-RVLVAGAGVSGLGIAKMLSELGCDVVVADDNETQRHMLIEVVDVADISTAQASDALDSYSIVVTSPGWRPD---   89 (476)
T ss_pred             HHHCC-CEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHCCCCEECCCCHHHHHCCCCEEEECCCCCCC---
T ss_conf             98699-88999227889999999997899799998998703578874798565155306564689999989978997---


Q ss_pred             CCHHHHHHHHCCCEEEEEHHHHHHHHHHCC--CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-CC
Q ss_conf             788899999769809983034223343015--688689960345752157899999987310000000124432211-01
Q gi|254781099|r   81 AHWCVKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EY  157 (468)
Q Consensus        81 ~~~~~~~a~~~gi~v~s~~el~~~~~~~~~--~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~-~~  157 (468)
                       ||++++|+++|+||+||+||+|+..+...  .+.++|||||||||||||+|++|||+++|+++.++||||+|+++. ..
T Consensus        90 -~p~l~~a~~~gi~viseiel~~~~~~~~~~~~~~~~IaVTGTnGKTTTtsli~~iL~~~g~~~~~~GNIG~p~~~~l~~  168 (476)
T PRK00141         90 -SPLLVDAQSAGLEVIGDVELAWRLDQAGVFGEPRTWLAVTGTNGKTTTTAMLAAMMQAGGFAAVAVGNIGIPVSAALVA  168 (476)
T ss_pred             -CHHHHHHHHCCCCEEEHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHC
T ss_conf             -9999999987995771999999861164336777638896899679899999999983799728995067246666525


Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             68883799921775432122333221011100210122211100001122100010134432247867899987401234
Q gi|254781099|r  158 FSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG  237 (468)
Q Consensus       158 ~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~  237 (468)
                      .++.|++|+|+|||||+++..++|+++|||||+|||||||+|||+|.++|++||.++ ..++|.||+....+........
T Consensus       169 ~~~~d~~VlElSSfQL~~~~~~~p~iaVilNIs~DHLD~h~s~e~Y~~aK~kI~~~~-~~vi~~Dd~~~~~~~~~~~~~~  247 (476)
T PRK00141        169 QNRIDVLVAELSSFQLHWAPTFTPDAGVVLNLAEDHIDWHGSMRDYALDKARVLTAP-VAVIGADDPYVVELTREADLSG  247 (476)
T ss_pred             CCCCCEEEEECCCCHHCCCCCCCCCEEEEECCCHHHHHHHCCHHHHHHHHHHHHCCC-CEEEECCCHHHHHHHHHCCCCC
T ss_conf             787758999778201200223686589872688789866269999999999873488-2499778789999887447886


Q ss_pred             CEEECCCCCCCCCCCCEEECCCEEE-ECC-CCC--CCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHH
Q ss_conf             3011036443222341121241354-146-764--212345588510111001101222102222211000000001345
Q gi|254781099|r  238 HSISRISSQSLQSDSDLYIDESFLK-CSA-TSE--VIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLT  313 (468)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~-~~~--~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~  313 (468)
                      ..  .+.... .....+......+. ... ...  .....++++|.||++|+++|+++++.+|++.+.|.++|++|+|+|
T Consensus       248 ~~--~~s~~~-~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~G~HNl~NalAA~a~a~~lGi~~e~I~~aL~~F~gl~  324 (476)
T PRK00141        248 LI--GFTLGE-PAEGQVGVRAGELVDNAFGDNVVLASADGINPAGPAGVLDALAAAAVARSQGVAPEAIARALAGFEVAG  324 (476)
T ss_pred             EE--EECCCC-CCCCCEEEECCEEEEEECCCCCEECCHHHCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCC
T ss_conf             79--852787-553524477688998515775032124323776533599999999999984999999999998568988


Q ss_pred             HHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC-CCCEEEEECCCHHHHHHHHHC
Q ss_conf             4433210034300000235567555555320133320012032101220689899842-786899988998998886316
Q gi|254781099|r  314 HRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGG  392 (468)
Q Consensus       314 ~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~-~~~~~~liG~~~~~i~~~~~~  392 (468)
                      ||||.+++.+|++||||||||||+||.+||++++ +++||+||++|+.|+.+|.+.+. ++..++++|++++.+.+.++.
T Consensus       325 HR~E~v~~~~gV~fiNDSKaTN~~at~~AL~~~~-~iilI~GG~~Kg~d~~~l~~~~~~~vk~v~l~G~~~~~i~~~l~~  403 (476)
T PRK00141        325 HRGQVVAEHDGVHFIDNSKATNPHAADSALAGHE-SVIWVAGGQLKGADIDELIATHGGRIKAALVLGADRAEIVAAVKE  403 (476)
T ss_pred             CCEEEEEEECCEEEECCCCCCCHHHHHHHHHHCC-CCEEEECCCCCCCCHHHHHHHHHHHCEEEEEECCCHHHHHHHHHH
T ss_conf             6127999989999981798999899999997288-739994476577787999999863310999976898999999985


Q ss_pred             CC---CEEEECC--HHHHHHHHHHHH-HHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             89---8899879--999999999999-84489859994522166313479899999999999863
Q gi|254781099|r  393 KI---NSTLSKT--LDQALKSVVRDV-ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       393 ~~---~~~~~~~--~~~a~~~i~~~~-~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                      ..   +...+..  ..++++.+++.+ +.+++||+|||||||||||||+||+|||++|+++|.++
T Consensus       404 ~~~~~~~~~~~~~~~~~~l~~av~~a~~~a~~gd~VLLSPacaSfD~f~nyeeRG~~F~~~V~~~  468 (476)
T PRK00141        404 HAPDAPVTVTDKTDPEEAMREAVAAAFSLAEPGDSVVLAPAAASLDMYTGMGQRGDLFAHYIIGT  468 (476)
T ss_pred             HCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHCCCCCHHHHHHHHHHHHHHH
T ss_conf             47888268861545788999999999973889898998945430205179999999999999999


No 14 
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramoylalanine-D-glutamate ligase (MurD). MurD catalyses the addition of d-glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-l-alanine. ; GO: 0005524 ATP binding, 0008764 UDP-N-acetylmuramoylalanine-D-glutamate ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=803.57  Aligned_cols=433  Identities=33%  Similarity=0.470  Sum_probs=359.7

Q ss_pred             EEEEECCCHHHH--HHHHHHHHCCCEEEEEECCCHHH----HHHHH--CCCEEECC---CCCCCCCCCEEEECCCCCCCC
Q ss_conf             799983685489--99999998598699981896478----89997--89899645---315722588899888868567
Q gi|254781099|r   10 SIAVFGLGRSGL--SAACALKDSGVHVIAWDDHPCAV----KQAKD--MGIEVIDF---REIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        10 ~v~i~G~G~sG~--s~A~~l~~~G~~V~~~D~~~~~~----~~l~~--~g~~~~~~---~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      +|+|+|+|+||+  |+|++|+++|..|.+.|+++...    .....  .++.....   .......+|+||.|||||++ 
T Consensus         1 ~i~i~GlG~tG~G~a~a~~L~~~g~~~~~~D~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~vv~SPGi~~~-   79 (476)
T TIGR01087         1 KILILGLGKTGRGVAVARFLKKKGAEVTVTDDDPEEELERSKGQLKLSEGVVLYTGGKDDLEDLNNADLVVLSPGIPPD-   79 (476)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHCCCCCCEEEEECCCCCCCCCCCCEEEEECCCCCCC-
T ss_conf             9789986751078999999997298799998452213431133124556413532675310123342079978989867-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
Q ss_conf             55788899999769809983034223343015688689960345752157899999987310000000124432211016
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYF  158 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~  158 (468)
                         ||++++|.++|+||+||+|||++..... .+.|+|||||||||||||+|++++|++.|.++.+|||||+|+++....
T Consensus        80 ---hp~~~~a~~~g~~v~gdi~L~~~~~~~~-~~~~~~aITGTnGKtTTT~L~~~~L~~~G~~a~~gGNIG~p~L~~~~~  155 (476)
T TIGR01087        80 ---HPLVQAAAKRGIPVVGDIELALRLVDFP-EPAKVVAITGTNGKTTTTSLLYHLLKAAGLKAVLGGNIGTPALEVLDQ  155 (476)
T ss_pred             ---CHHHHHHHHCCCEEEEHHHHHHHHCCCC-CCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHCC
T ss_conf             ---7799999966980898679999741578-987379997268607999999999984699778625788125553105


Q ss_pred             CCCCEEEEECCCCCCCCCCCCC--CCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHC
Q ss_conf             8883799921775432122333--2210111002101222111000011221000101---3443224786789998740
Q gi|254781099|r  159 SPNRFYVIECSSYQIELTPTID--PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDM  233 (468)
Q Consensus       159 ~~~~~~V~E~SSfQL~~~~~~~--PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~  233 (468)
                      ++.+++|+|+|||||++++.++  |.+++||||++||||||.|||+|.++|++|+.++   +..|+|.|+.+...+....
T Consensus       156 ~~~~~~VlElSSFQL~~~~~~~p~p~i~~~lNi~~DHLD~h~~~~~Y~~aK~~i~~~~~~~d~~v~n~d~~~~~~~~~~~  235 (476)
T TIGR01087       156 EGAELYVLELSSFQLETTESLRPAPEIALILNISEDHLDWHGSFEDYVAAKLKIFARQTEGDVAVLNADQAYDPRFTRLE  235 (476)
T ss_pred             CCCCEEEEEECCHHHCCCCCCCCCCEEEEEECCCHHHHCCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHCC
T ss_conf             88966999700032045755566512468706635630110798899999889852599876798812002550465212


Q ss_pred             CCCCCEEECCCCCC--CCCCCCEEECCCE--EEECCC--------CCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCC---
Q ss_conf             12343011036443--2223411212413--541467--------64212345588510111001101222102222---
Q gi|254781099|r  234 NFIGHSISRISSQS--LQSDSDLYIDESF--LKCSAT--------SEVIFDFSQETKKHNIQNLVTSAVVCMQLGLK---  298 (468)
Q Consensus       234 ~~~~~~~~~~~~~~--~~~~~~~~~~~~~--~~~~~~--------~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~---  298 (468)
                      ......+..+....  .............  +.....        ........+++|.||++|+++|+++++.+|++   
T Consensus       236 ~~~~~~~~~~~~~~CP~~~~~~l~~~~~~~~l~~~~e~~~~C~~~~~~~~~~~~l~g~h~~~n~laa~ala~~~g~~~~~  315 (476)
T TIGR01087       236 KKSKAQVVLFSVEKCPAEAEQGLEIRDGKEYLKPNDENDFACDDLTILPCEELKLLGLHNAENILAAIALAKSLGLNSDE  315 (476)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             46753078740445808899764123885263367876300001124332156767888999999999999982889760


Q ss_pred             -CCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCC--CEEEECCCCCCCCHHHHHHHHC-CCC
Q ss_conf             -211000000001345443321003430000023556755555532013332--0012032101220689899842-786
Q gi|254781099|r  299 -VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR--IYWIAGGLSKSDDFSTLFPFIS-KIA  374 (468)
Q Consensus       299 -~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~--i~lI~GG~~K~~d~~~L~~~~~-~~~  374 (468)
                       .+.+.++|++|+|++||||+|++.||+.||||||||||+||.+||.+++++  |+||+||++||.|+.+|.+.++ +.+
T Consensus       316 ~~~~~~~~l~~F~~~~HRlE~~~~~~G~~f~NDSKATn~~At~~AL~~~~~~~~~~LI~GG~~KG~df~~L~~~~~~~~~  395 (476)
T TIGR01087       316 ELEAILEALRSFKGLPHRLEYVGQKNGVHFINDSKATNVHATLAALSALKNPKRVILIVGGDDKGADFSPLAPALKKKVK  395 (476)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEEECCCEEEEECCCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHCCCEE
T ss_conf             16899999984579876268877728547982562121899999998479997189996034689984899998436507


Q ss_pred             EEEEECCCHHHHHHHHHCCCCEE------EECCHHHHHHHHHHHHHHCCCC--CEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             89998899899888631689889------9879999999999999844898--599945221663134798999999999
Q gi|254781099|r  375 KAYFIGNSAMLFFHHFGGKINST------LSKTLDQALKSVVRDVENVQLP--SIVLFSPGCASFDQYNNFRERGFSFMS  446 (468)
Q Consensus       375 ~~~liG~~~~~i~~~~~~~~~~~------~~~~~~~a~~~i~~~~~~~~~g--DiVLlSPa~aS~d~f~~y~~RG~~F~~  446 (468)
                      .++++|+++..|++.++......      .+.++++|++.+.   +.+++|  |+|||||||||||||+||+|||+.|++
T Consensus       396 ~~~~~G~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~Av~~a~---~~~~~g~~d~vLLSPacASFDqF~~y~eRGe~F~~  472 (476)
T TIGR01087       396 AVLAIGEDAAKIAKLLKEIGLVVKYGEETLVESLEEAVQAAR---EVAKEGNADVVLLSPACASFDQFKSYEERGEKFKE  472 (476)
T ss_pred             EEEEECCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH---HHHCCCCCCEEEECCCCCCHHHHCCHHHHHHHHHH
T ss_conf             999853547899998634276435465305778999999999---97127997679888641217773038888899999


Q ss_pred             HHHH
Q ss_conf             9986
Q gi|254781099|r  447 QVSE  450 (468)
Q Consensus       447 ~v~~  450 (468)
                      +|+.
T Consensus       473 ~v~~  476 (476)
T TIGR01087       473 LVRA  476 (476)
T ss_pred             HHHC
T ss_conf             9819


No 15 
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=787.99  Aligned_cols=429  Identities=24%  Similarity=0.355  Sum_probs=361.2

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH-----HHHHHHHCCCEEECCC--CCCCCCCCEEEECCCCCCC
Q ss_conf             21898799983685489999999985986999818964-----7889997898996453--1572258889988886856
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC-----AVKQAKDMGIEVIDFR--EIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~-----~~~~l~~~g~~~~~~~--~~~~~~~d~vv~Spgi~~~   77 (468)
                      -++||+|+|+|+|+||+|+|++|.++|++|+++|+++.     ...+++..|+.+....  ..++..+|+||+|||||++
T Consensus        11 ~l~~kkv~i~GlG~sG~a~a~~L~~~g~~v~~~D~~~~~~~~~~~~~l~~~gi~~~~g~~~~~~~~~~d~vv~SPgI~~~   90 (458)
T PRK01710         11 FIKNKKVAVVGIGVSNIPLIKFLVKLGAKVTAFDKKSEEELGEISLELKEKGVNLELGENYLDKLTGFDVIFKTPSMRID   90 (458)
T ss_pred             HHCCCEEEEEEECHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCEEEECCCHHHHCCCCCEEEECCCCCCC
T ss_conf             97899699997878899999999978897999989884314899999985799899578405423788889989987998


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC-C
Q ss_conf             755788899999769809983034223343015688689960345752157899999987310000000124432211-0
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-E  156 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~-~  156 (468)
                          ||++.+|++.|+||++|+|++++.     .+.|+|||||||||||||+|++|||+++|++++++||||+|++.. .
T Consensus        91 ----~p~~~~a~~~gi~v~~e~el~~~~-----~~~~~IaVTGTnGKTTTtsmi~~iL~~~g~~~~~gGNiG~p~~~~~~  161 (458)
T PRK01710         91 ----SPELVKAKEEGAYITSEMEEFIKY-----CPAKVFGITGSDGKTTTTTLIYEMLKEEGYKTWVGGNIGTPLFSNIE  161 (458)
T ss_pred             ----CHHHHHHHHCCCCEECHHHHHHHH-----CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHH
T ss_conf             ----999999998799374099999863-----75877999368984789999999999849975851662644688885


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHC
Q ss_conf             1688837999217754321223332210111002101222111000011221000101---3443224786789998740
Q gi|254781099|r  157 YFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDM  233 (468)
Q Consensus       157 ~~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~  233 (468)
                      ...+.|++|+|+|||||+.. .++|+++|||||++||||||+|||+|.++|++||.++   +..++|.||+....+....
T Consensus       162 ~~~~~d~~V~E~SS~ql~~~-~~~P~iaVitNi~~DHLD~h~s~e~Y~~aK~~i~~~~~~~~~~i~n~Dd~~~~~~~~~~  240 (458)
T PRK01710        162 EIKEEDKVVLELSSFQLMTM-DVSPEVAVVTNLSPNHLDVHKDMEEYVDAKKNIFKYQSSNDLLVLNKDNEITNGMEKEA  240 (458)
T ss_pred             HCCCCCEEEEEECHHHHHHC-CCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHC
T ss_conf             05788669999321555305-46887899835885365065419999999999996388773799937869999987763


Q ss_pred             CCCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHH
Q ss_conf             12343011036443222341121241354146764212345588510111001101222102222211000000001345
Q gi|254781099|r  234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLT  313 (468)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~  313 (468)
                      ......+   ...... ....+..+..+............++++|.||++|++||++++. +|++.+.|.++|++|+|++
T Consensus       241 ~~~~~~f---~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~l~l~G~HN~~N~lAA~aa~~-~gi~~e~i~~aL~~F~Gl~  315 (458)
T PRK01710        241 KGDVVKF---SRKEKL-KEGAYYKDGKLYIRGKEVCKKDDIKLKGMHNVENLLAAFCAVN-DDVSIESMKKVATTFTGVE  315 (458)
T ss_pred             CCCEEEE---CCCCCC-CCCCEEECCEEEECCCEECCHHHCCCCCHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHCCCHH
T ss_conf             6878995---366545-6673676688998784011324216776544999999999998-1999999999987543534


Q ss_pred             HHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHC-CCCEEEEECCCHHHHHHHHHC
Q ss_conf             4433210034300000235567555555320133320012032101220689899842-786899988998998886316
Q gi|254781099|r  314 HRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGG  392 (468)
Q Consensus       314 ~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~-~~~~~~liG~~~~~i~~~~~~  392 (468)
                      ||||.+++.+|++||||||||||+||++||++++++++||+||++|+.|+.+|.+.+. ++..++++|+++..+.+.++.
T Consensus       316 hR~E~v~~~~gv~~iNDSkaTn~~s~~~AL~~~~~~iilI~GG~~K~~d~~~l~~~~~~~~k~vi~~G~~~~~i~~~l~~  395 (458)
T PRK01710        316 HRCEFVREINGVKYYNDSIASSPTRTLAGLNAFEKPVILIAGGYDKKIPFEPLAEEGYEKIKILILMGDTKNKIKEAFKK  395 (458)
T ss_pred             HHHEEEEEECCEEEEECCCCCCHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHCCEEEEECCCHHHHHHHHHH
T ss_conf             23146578747679815766898999999971677729996465667886999998763052999978877999999987


Q ss_pred             -------CCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             -------89889987999999999999984489859994522166313479899999999999863
Q gi|254781099|r  393 -------KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       393 -------~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                             .+++..+.++++|++.+.+   .+++||+|||||||||||||+||+|||++|+++|++|
T Consensus       396 ~~~~~~~~~~~~~~~~l~~Av~~a~~---~a~~gd~VLlSPa~aSfD~f~nfeeRG~~F~~~V~~L  458 (458)
T PRK01710        396 VEEEKGIKIPIVIVNSLEEAVKVAKN---IAEKGDIITLSPACASFDMFPNFEIRGNKFKEIVNNL  458 (458)
T ss_pred             HHHHCCCCCCEEHHHHHHHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             66631688652337359999999997---5889798998973311035269999999999999739


No 16 
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=788.39  Aligned_cols=427  Identities=28%  Similarity=0.446  Sum_probs=354.0

Q ss_pred             CHHHCC-CEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCH-HHHHHHHCCCEEEC--CCCCCCCCCCEEEECCCCCC
Q ss_conf             132189-879998368548999999998598--6999818964-78899978989964--53157225888998888685
Q gi|254781099|r    3 LSSFRN-HSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPC-AVKQAKDMGIEVID--FREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus         3 ~~~~~~-k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~-~~~~l~~~g~~~~~--~~~~~~~~~d~vv~Spgi~~   76 (468)
                      |+.|.| |+|+|+|+|+||+|+|++|.++|.  .|.++|.++. ........++.+..  +.......+|+||+|||||+
T Consensus         1 ~~~~~~~KkvlV~GlG~sG~s~a~~L~~~~~~~~v~~~D~~~~~~~~~~l~~~~~~~~g~~~~~~l~~~d~vV~SPGI~~   80 (438)
T PRK04663          1 MDRWQGIKNVVVVGLGITGLSVVKHLRKTQPQLTVKVIDTRETPPGQEQLPEDVELHSGGWNQDWLAEADLVVTNPGIAL   80 (438)
T ss_pred             CCCCCCCCEEEEEEECHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHCCCEEEECCCCHHHHCCCCEEEECCCCCC
T ss_conf             94225997499990678589999999966998469996398893688762069769727889678368999998997699


Q ss_pred             CCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             67557888999997698099830342233430156886899603457521578999999873100000001244322110
Q gi|254781099|r   77 TGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLE  156 (468)
Q Consensus        77 ~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~  156 (468)
                      +    ||++++|++.|+||+||+||+.+.     .+.|+|||||||||||||+|++|||+++|+++.++||||+|++++.
T Consensus        81 ~----~p~~~~a~~~~i~i~~eiel~~~~-----~~~~iIaVTGTnGKTTTtsli~~iL~~~g~~~~~gGNiG~p~~~~~  151 (438)
T PRK04663         81 A----TPEIQPVLAKGIPVVGDIELFAWA-----VDKPVIAITGSNGKSTVTDLTGVMAKAAGVKVAVGGNIGVPALDLL  151 (438)
T ss_pred             C----CHHHHHHHHCCCCEECHHHHHHHH-----CCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHH
T ss_conf             8----989999998699370388999764-----5897899948998289999999999828997068721571688753


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             16888379992177543212233322101110021012221110000112210001013443224786789998740123
Q gi|254781099|r  157 YFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI  236 (468)
Q Consensus       157 ~~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~  236 (468)
                       ..+.|++|+|+|||||+++..++|+++|||||+|||||||+|||+|.++|.+||.+++..++|.||..........+..
T Consensus       152 -~~~~d~~VlElSSfQLe~~~~~~p~iavilNIs~DHLD~h~s~e~Y~~aK~rIf~~~~~~Ivn~dd~~~~~~~~~~~~~  230 (438)
T PRK04663        152 -EQDAELYVLELSSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMADYRQAKLRIFDHAELAVVNRDDKQTYPDTASLQLV  230 (438)
T ss_pred             -HCCCCEEEEECCCCCHHHHCCCCCCCHHHHCCCHHHHHHHCCHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHCCCCEE
T ss_conf             -0469789984451014340356863334406887687773699999999999853697899865359888776078579


Q ss_pred             CCEEECCCCCCCCCCCCEEECC--CEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHH
Q ss_conf             4301103644322234112124--13541467642123455885101110011012221022222110000000013454
Q gi|254781099|r  237 GHSISRISSQSLQSDSDLYIDE--SFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTH  314 (468)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~  314 (468)
                      .++..     ..  ........  .++............++++|.||++|+++|+++|+.+|++.+.|.++|++|+|+||
T Consensus       231 ~fg~~-----~~--~~~~~~~~~~~~~~~~~~~~~~~~~l~l~G~HN~~NalaA~a~a~~lGi~~e~I~~aL~~F~glpH  303 (438)
T PRK04663        231 TFGFD-----QQ--EYGLIEHQGREWLADNGQPVLASNELKLVGKHNVANSLVVLALLDAAGIDYRKTLDALKSYNGLTH  303 (438)
T ss_pred             EEECC-----CC--CCCEEEECCEEEEEECCEEEEEHHHHCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCC
T ss_conf             96046-----20--165597278699985887766314305664556877999999999839997898656533589887


Q ss_pred             HHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCC--CCCEEEECCCCCCCCHHHHHHHHCCCC-EEEEECCCHHHHHHHHH
Q ss_conf             433210034300000235567555555320133--320012032101220689899842786-89998899899888631
Q gi|254781099|r  315 RLQTIARLGHVIFINDSKATNLHSVIHAFLNEK--RRIYWIAGGLSKSDDFSTLFPFISKIA-KAYFIGNSAMLFFHHFG  391 (468)
Q Consensus       315 R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~--~~i~lI~GG~~K~~d~~~L~~~~~~~~-~~~liG~~~~~i~~~~~  391 (468)
                      |||.+++.+|++||||||||||+||.+||+++.  ++++||+||++|+.|+.+|.+.+.+.. .++++|+++..+.....
T Consensus       304 RlE~v~~~~gv~~iNDSKaTN~~a~~~Al~~~~~~~~i~lI~GG~~Kg~d~~~l~~~~~~~~~~~~~~G~~~~~~~~~~~  383 (438)
T PRK04663        304 RCQVVADNRGIKWVNDSKATNVASTLAALSGLNLEGKLYLLVGGVGKGADFSELKPVLATLNLQLCCFGEDGDQFMPLHP  383 (438)
T ss_pred             CEEEEEEECCEEEECCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCEEEEEECCCHHHHHHHCC
T ss_conf             52899998999997478778878999999836777847999657666668799999985237699998888999974324


Q ss_pred             CCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             6898899879999999999999844898599945221663134798999999999998637
Q gi|254781099|r  392 GKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP  452 (468)
Q Consensus       392 ~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~  452 (468)
                         ....+.++++|++.+.+   .+++||+|||||||||||||+||+|||++|+++|++|.
T Consensus       384 ---~~~~~~~l~~Av~~a~~---~a~~gd~vLlSPacaSfD~F~nyeeRG~~F~~lv~~la  438 (438)
T PRK04663        384 ---SARRFETMEDAIESISP---QLKSGDMVMLSPACASFDQFANFMARGDAFAELAKQYA  438 (438)
T ss_pred             ---CCEECCCHHHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             ---53440679999999998---67799989989744030030699999999999999749


No 17 
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=759.63  Aligned_cols=408  Identities=28%  Similarity=0.401  Sum_probs=338.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHH
Q ss_conf             87999836854899999999859869998189647889997898996453157225888998888685675578889999
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLA   88 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a   88 (468)
                      |||+|+|+|+||+|+|++|+++|+.|.++|+++......+..........+...+++|+||+|||||++    ||++++|
T Consensus         4 KkvlV~GlG~SG~s~a~~L~~~g~~v~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~d~vv~SPGi~~~----~p~~~~a   79 (418)
T PRK00683          4 QRVVVLGLGVTGKSVARFLAQKGVYVIGVDNSLEALQSCPYIHERYLEGAEEFPEQVDLVVRSPGIKPY----HPWVEAA   79 (418)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCEEEEECCCHHHHHHCCHHHHHCCCCHHHCCCCCCEEEECCCCCCC----CHHHHHH
T ss_conf             669998088879999999997829899982981454546145554056233242349899989985998----8999999


Q ss_pred             HHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEEC
Q ss_conf             97698099830342233430156886899603457521578999999873100000001244322110168883799921
Q gi|254781099|r   89 NQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIEC  168 (468)
Q Consensus        89 ~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~~~~~~~V~E~  168 (468)
                      ++.|+||+||+||+++...  ..+.|+|||||||||||||+|++|||+++|+++.++||||+|+++..  .+.+++|+|+
T Consensus        80 ~~~~i~i~seiel~~~~~~--~~~~~~IaITGTNGKTTTt~ll~~iL~~~g~~~~~~GNIG~p~l~~~--~~~~~~VlEl  155 (418)
T PRK00683         80 VALKIPVVTDIQLAFQTPE--FQRYPSLGITGSTGKTTTILFLEHLLRTLGIPAFAMGNIGLPILDGM--QQPGVRVVEI  155 (418)
T ss_pred             HHCCCCCCCHHHHHHHHHH--HCCCCEEEEECCCCCEEHHHHHHHHHHHCCCCCEEEECCCHHHHHHH--CCCCCEEEEE
T ss_conf             9869975407999974244--14798799976898660999999999867998188803465777643--2589469983


Q ss_pred             CCCCCCCCCCCCCCC--CEEEEECCCHHHHHHHHHHCCCCCCCEEEECCC--CCCCCCCHHHH-HHHHHCCCCCCEEECC
Q ss_conf             775432122333221--011100210122211100001122100010134--43224786789-9987401234301103
Q gi|254781099|r  169 SSYQIELTPTIDPSI--GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH--AIICINDHQCE-KIAYDMNFIGHSISRI  243 (468)
Q Consensus       169 SSfQL~~~~~~~Pdi--avITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~--~iln~dd~~~~-~~~~~~~~~~~~~~~~  243 (468)
                      |||||+.+..+.|.+  ||||||+|||||||+|||+|.++|.+|+.....  .++..++.... ......          
T Consensus       156 SSfQL~~~~~~~p~~~~avilNis~DHLD~H~s~e~Y~~aK~~I~~~~~~~~~~~~~~~~~~~~~~~~~~----------  225 (418)
T PRK00683        156 SSFQLADQEESIPVLSGGMILNISDNHLDYHGNLDAYFQAKQNIAKCLRNPDDLWVGDERSLGNSYLEYV----------  225 (418)
T ss_pred             EHHHHHHHHHCCCCCCHHHHCCCCCCHHCCCCCHHHHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHH----------
T ss_conf             1242321243077622121015784241221689999999999998467976468525411017888877----------


Q ss_pred             CCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCC-CCCCCCCHHHCCCHHHHHHHHHHHCCC
Q ss_conf             6443222341121241354146764212345588510111001101222102-222211000000001345443321003
Q gi|254781099|r  244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL-GLKVEEIKRALLSCGGLTHRLQTIARL  322 (468)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~l-Gi~~~~i~~~L~~f~gv~~R~E~i~~~  322 (468)
                            .......+.            ...+...+.||.+|+++|++++..+ |++.+.+.++|++|+|+|||||.+++.
T Consensus       226 ------~~~~~~~~~------------~~~l~~~~~hn~~N~~aA~a~a~~~~~i~~~~i~~al~~F~glpHR~E~v~~~  287 (418)
T PRK00683        226 ------QEIMRLLDK------------GSALKPLYLHDRYNYCAAYALANEVFPISPESFLEAVATFEKPPHRMEYLGEK  287 (418)
T ss_pred             ------HHHHHHHCC------------CCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCEEEEEEE
T ss_conf             ------777777445------------31016544032988999999999857999999999997348841113688881


Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCC-CCEEEEECCCHHHHHHHHHCCCCEEEECC
Q ss_conf             43000002355675555553201333200120321012206898998427-86899988998998886316898899879
Q gi|254781099|r  323 GHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINSTLSKT  401 (468)
Q Consensus       323 ~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~-~~~~~liG~~~~~i~~~~~~~~~~~~~~~  401 (468)
                      +|+.||||||||||+||.+||+++.++++||+||++|+.|+.+|.+.+.+ +..++++|++++.+.+.++..+++..+.+
T Consensus       288 ~Gv~fiNDSKaTN~~a~~~AL~s~~~~iilI~GG~~K~~d~~~L~~~~~~~vk~v~~~G~~~~~i~~~l~~~~~~~~~~~  367 (418)
T PRK00683        288 DGVHYINDSKATTVSAVEKALLAVGKDVIVILGGRNKGGDFPSLLPVLRQTAKHVVAMGECRQEIAQALSEKFPLTVVKD  367 (418)
T ss_pred             CCCEEECCCCCCCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCEEECCC
T ss_conf             78237637767898999999985678858997578766786999999863184999968899999998756998798598


Q ss_pred             HHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             999999999999844898599945221663134798999999999998637985
Q gi|254781099|r  402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE  455 (468)
Q Consensus       402 ~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~~~  455 (468)
                      +++|++.+.+   .+++||+|||||||||||||+||+|||++|+++|++|.+.+
T Consensus       368 l~eAv~~a~~---~a~~gd~VLLSPacaSfD~F~nyeeRG~~Fk~lV~~l~~~~  418 (418)
T PRK00683        368 LQEAVSCAQE---IAQPGDVILLSPGCASFDQFRSFEERGAYFKQLVGEMEALR  418 (418)
T ss_pred             HHHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999998---47898989989755010021599999999999999732169


No 18 
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional
Probab=100.00  E-value=0  Score=702.70  Aligned_cols=394  Identities=26%  Similarity=0.360  Sum_probs=310.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             79998368548999999998598699981896478899978989964531572258889988886856755788899999
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLAN   89 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a~   89 (468)
                      ||+|+|+|+||+|+|++|.++|..+ .+|++.... ..+..+....+..+.....+|++|+|||||++    ||++++|+
T Consensus         2 Ki~V~GlG~sG~s~a~~L~~~g~~~-i~dD~~~~~-~~~~~~~~~~~~~~~~~~~~d~vv~SPGI~~~----~p~~~~a~   75 (401)
T PRK03815          2 KISLFGYGKTTKALARFFVKNGGVD-IYDDKFTEP-KKDEEGNLLLPSNDFDPNKSDLEIPSPGIPPS----HPLIQKAK   75 (401)
T ss_pred             EEEEEEECHHHHHHHHHHHHCCCEE-EEECCCCCC-CHHHHHCCCCCHHHCCCHHCCEEEECCCCCCC----CHHHHHHH
T ss_conf             3999847771899999999487979-998999862-22464040068433580128689989985998----79999874


Q ss_pred             HCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECC
Q ss_conf             76980998303422334301568868996034575215789999998731000000012443221101688837999217
Q gi|254781099|r   90 QFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECS  169 (468)
Q Consensus        90 ~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~~~~~~~~~~~~V~E~S  169 (468)
                      +    |+||+|||++.      ..++|||||||||||||+|++|||++.|  +.++||||+|++++  ..+.+++|+|+|
T Consensus        76 ~----i~seiel~~~~------~~~~I~ITGTNGKsTtt~li~~iL~~~g--~~~~GNIG~Pl~~~--~~~~~~~VlElS  141 (401)
T PRK03815         76 N----LISEYDYFYSF------MPFSIWISGTNGKTTTTQMLTHLLEDFG--AVSGGNIGTPLAEL--DPNAKIWVLETS  141 (401)
T ss_pred             H----HHHHHHHHHHC------CCCCEEEECCCCHHHHHHHHHHHHHHCC--CCEECCCCHHHHHC--CCCCCEEEEEEC
T ss_conf             5----41499999852------7874899847777899999999998669--81304166438862--877887999934


Q ss_pred             CCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCC---CCCCCCHHHHHHHHHCCCCCCEEECCCCC
Q ss_conf             754321223332210111002101222111000011221000101344---32247867899987401234301103644
Q gi|254781099|r  170 SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHA---IICINDHQCEKIAYDMNFIGHSISRISSQ  246 (468)
Q Consensus       170 SfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~---iln~dd~~~~~~~~~~~~~~~~~~~~~~~  246 (468)
                      |||||++..++|+++|||||+|||||||+|||+|.++|.+||.++...   +++.+..       ..+.....+. +...
T Consensus       142 SfQLe~~~~~~p~iavilNis~DHLDrH~s~e~Y~~aK~~I~~~~~~~~~~i~~~~~~-------~~~~~~~~i~-~~~~  213 (401)
T PRK03815        142 SFTLHYTNKAKPNIYLLLPITPDHLSWHGSFENYEKAKLKPLKLMNEGSVAILPKKYK-------ETPTKAQKIS-YEDE  213 (401)
T ss_pred             HHHCCCCCCCCCCEEEEECCCCCHHCCCCCHHHHHHHHHHHHHHCCCCCEEEECHHHC-------CCCCCCEEEE-ECCH
T ss_conf             4540667566876898836882052362689999999999996288776799722330-------4766617997-2662


Q ss_pred             CCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCE
Q ss_conf             32223411212413541467642123455885101110011012221022222110000000013454433210034300
Q gi|254781099|r  247 SLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVI  326 (468)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~  326 (468)
                                  ..+.  .........+.+.|.|++.+++ |++++  ..+..+.+.++|++|+|+|||||.+++.+|+.
T Consensus       214 ------------~~~~--~~~~i~~~~i~~~~~~~~~~~~-a~~~~--~~~~~~~~~~~l~~F~gl~HRlE~v~~~~gv~  276 (401)
T PRK03815        214 ------------EDLA--EKFGIDTEKINFKGPFLLDALL-ALAVE--KILFDENDYERLNAFVIEAHKLEEFRDKQGRL  276 (401)
T ss_pred             ------------HHHH--HHCCCCHHHCCCCHHHHHHHHH-HHHHH--HCCCCHHHHHHHHHCCCCCCCEEEEEEECCEE
T ss_conf             ------------7778--7658877870564589999999-99998--55663558999984899888538999848989


Q ss_pred             EECCCCCCCHHHHHHHHHCCC-CCCEEEECCCCCCCCHHHHHHHHCCC-CEEEEECCCHHHHHHHHHC-CCCEEEECCHH
Q ss_conf             000235567555555320133-32001203210122068989984278-6899988998998886316-89889987999
Q gi|254781099|r  327 FINDSKATNLHSVIHAFLNEK-RRIYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGG-KINSTLSKTLD  403 (468)
Q Consensus       327 iIDDS~atnp~a~~~Al~~~~-~~i~lI~GG~~K~~d~~~L~~~~~~~-~~~~liG~~~~~i~~~~~~-~~~~~~~~~~~  403 (468)
                      ||||||||||+||.+||+++. ++++||+||++|+.|+.+|.+.+.+. ..++++|++++.+.+.+.. .+++..+.+++
T Consensus       277 fiNDSKATN~~At~~Al~~~~~~~iilI~GG~~Kg~d~~~L~~~i~~~~~~v~~~G~~~~~i~~~~~~~~~~~~~~~~l~  356 (401)
T PRK03815        277 WVDDSKATNIDATIQALKRYKDKKIHLILGGDDKGVDLTPLFEELKNFDIEIYAIGSNAEKILALAKEFNIKAQKCEFLE  356 (401)
T ss_pred             EECCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHCEEEEEECCCHHHHHHHHHHCCCCEEECCCHH
T ss_conf             96688789889999999837678679996376556787999999764056999987899999999875698469828699


Q ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             999999999984489859994522166313479899999999999863
Q gi|254781099|r  404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       404 ~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                      +|++.+.+   .+++||+|||||||||||||+||+|||++|+++|++|
T Consensus       357 eAv~~a~~---~a~~gdvVLLSPacASfD~FknyeeRG~~Fk~~V~~L  401 (401)
T PRK03815        357 KAVNEIKK---VLKQNEVALLSPAAASLDQFSSYAERGEKFKEFVLKL  401 (401)
T ss_pred             HHHHHHHH---HCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             99999998---5789798998974403002069999999999999739


No 19 
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional
Probab=100.00  E-value=0  Score=542.01  Aligned_cols=404  Identities=19%  Similarity=0.275  Sum_probs=304.3

Q ss_pred             CCCEEEEECCCHHHHH-HHHHHHHCCCEEEEEECCC-HHHHHHHHCCCEEEC-CCCCCCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             8987999836854899-9999998598699981896-478899978989964-531572258889988886856755788
Q gi|254781099|r    7 RNHSIAVFGLGRSGLS-AACALKDSGVHVIAWDDHP-CAVKQAKDMGIEVID-FREIPWSIISFLVLSPGIALTGENAHW   83 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s-~A~~l~~~G~~V~~~D~~~-~~~~~l~~~g~~~~~-~~~~~~~~~d~vv~Spgi~~~~~~~~~   83 (468)
                      +-|+|+++|+|++||| +|++|+++|++|+|+|.++ +..++|+..|+.+.. +....+..+|+||+|||||++    ||
T Consensus         7 ~~k~ih~iGigG~GmsalA~~l~~~G~~V~gsD~~~~~~~~~L~~~Gi~v~~g~~~~~l~~~d~vV~Sp~I~~~----~p   82 (459)
T PRK00421          7 RIKRIHFVGIGGIGMSGLAEVLLNLGYKVSGSDLKESAVTQRLLELGAIIFIGHDAENIKGADVVVVSSAIKPD----NP   82 (459)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCEEECCCCHHHCCCCCEEEECCCCCCC----CH
T ss_conf             67889999866888999999999689939998898997899999787999779897987999999989985998----99


Q ss_pred             HHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHC--CCCCCCCCCCCCCCCCCCC
Q ss_conf             89999976980998303422334301568868996034575215789999998731000--0000124432211016888
Q gi|254781099|r   84 CVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDV--QLGGNIGLPILNLEYFSPN  161 (468)
Q Consensus        84 ~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~--~~~GNiG~p~~~~~~~~~~  161 (468)
                      ++++|++.|+||+|++|++.+..    ...++|||||||||||||+|++|||+++|+++  .+||+++.. ......++.
T Consensus        83 ~~~~a~~~gi~v~~~~e~l~~~~----~~~~~IaVtGTnGKTTtT~ll~~il~~~g~~~~~~iGg~~~~~-~~~~~~~~~  157 (459)
T PRK00421         83 ELVAARELGIPVVRRAEMLAELM----RLRTSIAVAGTHGKTTTTSLLAHVLAEAGLDPTFIIGGILNAA-GTNARLGSS  157 (459)
T ss_pred             HHHHHHHCCCCEEEHHHHHHHHH----HCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCC-CCCCCCCCC
T ss_conf             99999987997988999999998----2596499977888611899999999976998748857533556-654525889


Q ss_pred             CEEEEEC----CCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHCC
Q ss_conf             3799921----7754321223332210111002101222111000011221000101---34432247867899987401
Q gi|254781099|r  162 RFYVIEC----SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDMN  234 (468)
Q Consensus       162 ~~~V~E~----SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~~  234 (468)
                      +++|+|+    |||+     .|+|+++|||||++||||||+|||+|.++|.+++++.   +.+|+|.||+..+.+.....
T Consensus       158 ~~~V~E~dE~d~sf~-----~~~P~iavitNI~~DHLD~h~s~e~Y~~ak~~~~~~~~~~g~~ViN~DD~~~~~l~~~~~  232 (459)
T PRK00421        158 DYFVAEADESDRSFL-----KLHPDIAVVTNIDADHLDYYGDFEDLKDAFQEFAHNLPFYGALVACGDDPELRELLPRVD  232 (459)
T ss_pred             CEEEEEECCCCCCHH-----HCCCCEEEEECCCHHHHHHCCCHHHHHHHHHHHHHCCCCCCCEECCCCCHHHHHHHHHCC
T ss_conf             889999535414364-----458989999179877865601899999999999971995472114687989999877438


Q ss_pred             CCCCEEECCCCCCCCCCCCEEECC--CEEEECCC-CCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHH
Q ss_conf             234301103644322234112124--13541467-642123455885101110011012221022222110000000013
Q gi|254781099|r  235 FIGHSISRISSQSLQSDSDLYIDE--SFLKCSAT-SEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGG  311 (468)
Q Consensus       235 ~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~-~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~g  311 (468)
                      .....+.......... .++....  ..+..... .......++++|.||++|++||+++|+.+|++.+.|.++|++|+|
T Consensus       233 ~~vitfg~~~~~d~~~-~~i~~~~~~~~f~~~~~~~~~~~~~l~l~G~HNv~NalAAia~a~~lGi~~e~i~~aL~~F~G  311 (459)
T PRK00421        233 RPVITYGFSEDADFRA-ENIRQDGGGSHFDVLREGEDLGDFTLPLPGRHNVLNALAAIAVALELGIDDEAIRKALATFKG  311 (459)
T ss_pred             CCCEEECCCCCCCEEE-EEEEEECCCEEEEEEECCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCC
T ss_conf             8600235687666678-889994892389998389378899956863889999999999999849999999999975357


Q ss_pred             HHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHC---C--CCCCEEEECC--CCCCCC-HHHHHHHHCCCCEEEEE----
Q ss_conf             4544332100343000002355675555553201---3--3320012032--101220-68989984278689998----
Q gi|254781099|r  312 LTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN---E--KRRIYWIAGG--LSKSDD-FSTLFPFISKIAKAYFI----  379 (468)
Q Consensus       312 v~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~---~--~~~i~lI~GG--~~K~~d-~~~L~~~~~~~~~~~li----  379 (468)
                      ++||||.+++.+|++|||| |||+|+++.++|++   .  .+|+++|..-  ..|-.+ +.++++.++..+.+++.    
T Consensus       312 v~~R~E~v~~~~gv~~idD-YAH~P~~i~a~l~alr~~~~~~rii~vfqPh~~sR~~~~~~e~a~~l~~aD~vil~~iy~  390 (459)
T PRK00421        312 VKRRFEEKGEVNGVVLIDD-YAHHPTEIKATLKAARQKYPDKRIVAVFQPHRYSRTRDLFDEFAEVLSDADEVILLDIYA  390 (459)
T ss_pred             CCEEEEEEEECCCEEEEEE-CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             4502799872288479973-568938999999999987689966999867420548999999999987199999888758


Q ss_pred             -------CCCHHHHHHHHHC--CCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             -------8998998886316--8988998799999999999998448985999452216
Q gi|254781099|r  380 -------GNSAMLFFHHFGG--KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCA  429 (468)
Q Consensus       380 -------G~~~~~i~~~~~~--~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~a  429 (468)
                             |.+.+.+++.+..  ..+...+.+.+++++.+.   +.+++||+||+-=++.
T Consensus       391 a~E~~~~g~~~~~i~~~i~~~~~~~~~~~~~~~~ai~~~~---~~a~~gDvVL~~GaGd  446 (459)
T PRK00421        391 AGEAPIPGVDSEDLARAIRKRGHVDVIFVPDVDDLAELLA---DVLQPGDLVLTMGAGD  446 (459)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCCEEEECCHHHHHHHHH---HHCCCCCEEEEECCCC
T ss_conf             8887657889999999998608988799699999999999---8589989999979999


No 20 
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramate-alanine ligase (MurC). MurC is an essential, cytoplasmic peptidoglycan biosynthetic enzyme, catalyzes the ATP-dependent ligation of L-alanine (Ala) and UDP-N-acetylmuramic acid (UNAM) to form UDP-N-acetylmuramyl-L-alanine (UNAM-Ala). The enzyme is a nonribosomal peptide ligase which utilises ATP to form an amide bond between L-alanine and UNAM.1 Mechanistic studies on the Escherichia coli MurC enzyme using oxygen isotope analyses demonstrated that the enzyme-catalyzed reaction proceeds through an acyl phosphate UNAM intermediate prior to L-alanine addition.; GO: 0005524 ATP binding, 0008763 UDP-N-acetylmuramate-L-alanine ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=478.21  Aligned_cols=400  Identities=22%  Similarity=0.297  Sum_probs=298.3

Q ss_pred             EEEEECCCHHHHH-HHHHHHHCCCEEEEEECC-CH-HHHHHHHCCCEEE-C-CCCCCCCC-----CCEEEEC-CCCCCCC
Q ss_conf             7999836854899-999999859869998189-64-7889997898996-4-53157225-----8889988-8868567
Q gi|254781099|r   10 SIAVFGLGRSGLS-AACALKDSGVHVIAWDDH-PC-AVKQAKDMGIEVI-D-FREIPWSI-----ISFLVLS-PGIALTG   78 (468)
Q Consensus        10 ~v~i~G~G~sG~s-~A~~l~~~G~~V~~~D~~-~~-~~~~l~~~g~~~~-~-~~~~~~~~-----~d~vv~S-pgi~~~~   78 (468)
                      +|+++|||++||| +|++|+++|++|+|||.. .. ..+.|+..|+++. + |....+..     +|+||+| ++||.+ 
T Consensus         1 ~iHFvGIGG~GMSglA~~L~~~G~~VsGSD~~~~~y~t~~L~~~Gi~I~~g~h~~~n~~~~p~g~~~vVv~S~~Ai~~~-   79 (491)
T TIGR01082         1 KIHFVGIGGIGMSGLAEILLNRGYKVSGSDIAENAYTTKRLEALGIKIYIGEHSAENLDDLPTGAADVVVVSAAAIKED-   79 (491)
T ss_pred             CEEEEECCHHCHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHCCCEECCCCCCHHHHCCCCCCCCCEEEEEEECCCCC-
T ss_conf             9578960620344899999857890877203356315899986787662799677982036789743799864033788-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH--CCCCCCCCCCCCCCC
Q ss_conf             557888999997698099830342233430156886899603457521578999999873100--000001244322110
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD--VQLGGNIGLPILNLE  156 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~--~~~~GNiG~p~~~~~  156 (468)
                         ||++++|++++|||+++.+.+..+++..  + ..|||||||||||||+||++||+++|++  +.+||.++- +-.-.
T Consensus        80 ---NpEi~~A~~~~IPv~~R~~~Lael~~~~--k-~~iaVaGtHGKTTTTamia~~~~~aGLdPt~~~GG~~~~-~~~Na  152 (491)
T TIGR01082        80 ---NPEIVEAKERGIPVIRRAEMLAELMRKR--K-ESIAVAGTHGKTTTTAMIAVILKEAGLDPTVIVGGEVKE-AGTNA  152 (491)
T ss_pred             ---CHHHHHHHHCCCCEECHHHHHHHHHHHH--C-CEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECCCCCC-CCCCE
T ss_conf             ---8889999964888133789999998620--8-707998368725689999999984499976898664366-57743


Q ss_pred             CCCC-CCEEEEECCCCCCCCC--C---CCCCCCCEEEEECCCHHH--HHHHHHHCCCCCCCEEEE---CCCCCCCCCCHH
Q ss_conf             1688-8379992177543212--2---333221011100210122--211100001122100010---134432247867
Q gi|254781099|r  157 YFSP-NRFYVIECSSYQIELT--P---TIDPSIGVLLNISPDHLD--RHHTLENYVNIKKKIVTM---SKHAIICINDHQ  225 (468)
Q Consensus       157 ~~~~-~~~~V~E~SSfQL~~~--~---~~~PdiavITNI~~DHLd--~~~s~e~y~~aK~~i~~~---~~~~iln~dd~~  225 (468)
                      .... .+++|.|+.    |+-  .   .++|+++|||||++||||  |++|+|++.++..++..+   .+.+++|.||+.
T Consensus       153 ~~g~~~~~lvaEaD----ESd~~~sFl~~~P~~ai~TNie~DH~D~tY~~~~E~~~~aF~~F~~~l~~~G~~v~c~DD~~  228 (491)
T TIGR01082       153 RLGSSGEYLVAEAD----ESDRSASFLHLQPEVAIVTNIEPDHLDNTYGSSLERLKAAFEKFIHNLPFYGLAVICADDPV  228 (491)
T ss_pred             EECCCCCEEEEEEE----ECCCCCCHHCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCHH
T ss_conf             57146867999987----23776401206985799747774347766645789999999999982788879999838654


Q ss_pred             HHHHHHHCCCCCCEE-ECCCCC---CCCCCCCEEECCC--EEEECCCCC--------CCCCCCCCCCCHHHHHCCCHHHH
Q ss_conf             899987401234301-103644---3222341121241--354146764--------21234558851011100110122
Q gi|254781099|r  226 CEKIAYDMNFIGHSI-SRISSQ---SLQSDSDLYIDES--FLKCSATSE--------VIFDFSQETKKHNIQNLVTSAVV  291 (468)
Q Consensus       226 ~~~~~~~~~~~~~~~-~~~~~~---~~~~~~~~~~~~~--~~~~~~~~~--------~~~~~~~l~G~HNi~NalaAia~  291 (468)
                      .+.+........... ..++..   .......+.....  .+.+.....        .....+++||+||++|+|||+|+
T Consensus       229 ~~~l~~~~~~~r~d~~~~y~~~~~~~~~~~~~~~~~~~~~~f~v~~~~~~~~~~~~G~~~~~~~~pG~HNvLNAlAA~av  308 (491)
T TIGR01082       229 LRKLVPKATESRKDVVITYGGSGEDADIRAENIQQSGAEFEFSVRLKGKLGEATTEGPLEFKLNLPGRHNVLNALAAIAV  308 (491)
T ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCCEEEEEEEEECCCEEEEEEEECCCCCCCEEEEEEEEEEECCCCCCHHHHHHHHHH
T ss_conf             78776355533870478668777641477887432264589999970452201110027999803872006789999988


Q ss_pred             HHCCCCCC---------CCCHHHCCCHHHHHHHHHHHCCCCC------CEEECCCCCCCHH---HHHHHHHCC----CCC
Q ss_conf             21022222---------1100000000134544332100343------0000023556755---555532013----332
Q gi|254781099|r  292 CMQLGLKV---------EEIKRALLSCGGLTHRLQTIARLGH------VIFINDSKATNLH---SVIHAFLNE----KRR  349 (468)
Q Consensus       292 a~~lGi~~---------~~i~~~L~~f~gv~~R~E~i~~~~g------v~iIDDS~atnp~---a~~~Al~~~----~~~  349 (468)
                      |..+|++.         +.|+++|++|+|++||||.+++.++      +.+||| |||.|.   +|++|++.+    .+|
T Consensus       309 a~~~g~~~~G~~~~~~~~~I~~~L~~F~G~~RRf~~~g~~~~~~n~g~~~~~DD-YAHHPtEi~aTl~aAr~~~~~k~~r  387 (491)
T TIGR01082       309 ALELGLDFYGKVIVDFLEAIKRALANFQGVKRRFEILGECNGGNNNGTVLLIDD-YAHHPTEIKATLAAARQVYPDKNRR  387 (491)
T ss_pred             HHHHCCCCCCCEEEEHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCCEEEEEEC-CCCCHHHHHHHHHHHHHHHCCCCCE
T ss_conf             887221236855641589999998506897310120100278987527999965-8999789999999998752117957


Q ss_pred             CEEEE-CC-CCCCC-CHHHHHHHHCC-CCEEEEE-----------CCCHHHHHHHHHC---CCCEEEECCHHHHHHHHHH
Q ss_conf             00120-32-10122-06898998427-8689998-----------8998998886316---8988998799999999999
Q gi|254781099|r  350 IYWIA-GG-LSKSD-DFSTLFPFISK-IAKAYFI-----------GNSAMLFFHHFGG---KINSTLSKTLDQALKSVVR  411 (468)
Q Consensus       350 i~lI~-GG-~~K~~-d~~~L~~~~~~-~~~~~li-----------G~~~~~i~~~~~~---~~~~~~~~~~~~a~~~i~~  411 (468)
                      +++|. .- ..|-. -+.++++.++. .+.+++.           |.+...+...+..   +.+...++.+.+..+.+. 
T Consensus       388 ~v~~FQPHrYsRT~~~~~~F~~~L~~haD~l~~~diY~A~E~~~~g~~~~~l~~~~~~~~~~~~~~f~~~~~~~~~~l~-  466 (491)
T TIGR01082       388 IVVVFQPHRYSRTKDLFDDFAKVLSDHADELILLDIYAAGEEPIAGIDGKSLARKITQKKGKEEPYFVPDLAEVVEFLA-  466 (491)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH-
T ss_conf             9999749856789988999999997308999981532113677678778999999862578777610421778999999-


Q ss_pred             HHHHCCCCCEEEEC
Q ss_conf             99844898599945
Q gi|254781099|r  412 DVENVQLPSIVLFS  425 (468)
Q Consensus       412 ~~~~~~~gDiVLlS  425 (468)
                        ..+++||++|+=
T Consensus       467 --~~~~~GD~~~~~  478 (491)
T TIGR01082       467 --EVLQSGDLILTM  478 (491)
T ss_pred             --HHCCCCCEEEEE
T ss_conf             --971699899996


No 21 
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=450.92  Aligned_cols=392  Identities=22%  Similarity=0.264  Sum_probs=289.1

Q ss_pred             EEEEECCCHHHHH-HHHHHHHCCCEEEEEECC-CHHHHHHHHCCCEEEC-CCCCCCCCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             7999836854899-999999859869998189-6478899978989964-531572258889988886856755788899
Q gi|254781099|r   10 SIAVFGLGRSGLS-AACALKDSGVHVIAWDDH-PCAVKQAKDMGIEVID-FREIPWSIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus        10 ~v~i~G~G~sG~s-~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g~~~~~-~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
                      +|+++|||++||| +|++|+++|++|+|||.+ .+..++|+..|+.++. +.+.++...+.||+|.+|+.    .||+++
T Consensus         9 ~iHfIGIgG~GMsglA~iL~~~G~~VsGSD~~~~~~t~~L~~~G~~i~~gh~~~ni~~~~~VV~s~Ai~~----~NpEi~   84 (459)
T COG0773           9 KIHFIGIGGIGMSGLAEILLNLGYKVSGSDLAESPMTQRLEALGIEIFIGHDAENILDADVVVVSNAIKE----DNPEIV   84 (459)
T ss_pred             EEEEEEECCCCHHHHHHHHHHCCCCEECCCCCCCHHHHHHHHCCCEEECCCCHHHCCCCCEEEEECCCCC----CCHHHH
T ss_conf             1799965505679999999967991177166526778999978996867979788589965999656579----998999


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHC-CCCC-C---CCCCCCCCCCCCCC
Q ss_conf             99976980998303422334301568868996034575215789999998731000-0000-1---24432211016888
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDV-QLGG-N---IGLPILNLEYFSPN  161 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~-~~~G-N---iG~p~~~~~~~~~~  161 (468)
                      +|++++||++++.|++...+..    ...|||+|||||||||+||+++|+++|+++ ++.| .   .|+.    ......
T Consensus        85 ~A~e~~ipi~~r~e~L~elm~~----~~~iaVaGTHGKTTTTsmla~vl~~~gldPtf~iGG~~~~~g~n----a~~g~~  156 (459)
T COG0773          85 AALERGIPVISRAEMLAELMRF----RTSIAVAGTHGKTTTTSMLAWVLEAAGLDPTFLIGGILKNFGTN----ARLGSG  156 (459)
T ss_pred             HHHHCCCCEECHHHHHHHHHHC----CEEEEEECCCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCC----CCCCCC
T ss_conf             9998599816289999999707----71699947887540899999999867999879977744557765----545888


Q ss_pred             CEEEEECC----CCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHCC
Q ss_conf             37999217----754321223332210111002101222111000011221000101---34432247867899987401
Q gi|254781099|r  162 RFYVIECS----SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDMN  234 (468)
Q Consensus       162 ~~~V~E~S----SfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~~  234 (468)
                      +|+|+|+.    ||     -.++|+++|+|||++||+|+|++++++.++...++++.   +..++|.||+.++.+.....
T Consensus       157 ~~fV~EADEsD~sF-----l~~~P~~aIvTNid~DH~D~y~~~~~i~~~F~~f~~~vp~~G~~v~~~dd~~l~~l~~~~~  231 (459)
T COG0773         157 DYFVAEADESDSSF-----LHYNPRVAIVTNIEFDHLDYYGDLEAIKQAFHHFVRNVPFYGRAVVCGDDPNLRELLSRGC  231 (459)
T ss_pred             CEEEEEECCCCCCC-----CCCCCCEEEEECCCCCCHHHHCCHHHHHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHCCC
T ss_conf             64999951541650-----2488978998078834001218999999999999983886655999788888999872225


Q ss_pred             CCCCEEECCCCC---CCCCCCCEEECCC--EEEECCCCC-CCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCC
Q ss_conf             234301103644---3222341121241--354146764-2123455885101110011012221022222110000000
Q gi|254781099|r  235 FIGHSISRISSQ---SLQSDSDLYIDES--FLKCSATSE-VIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLS  308 (468)
Q Consensus       235 ~~~~~~~~~~~~---~~~~~~~~~~~~~--~~~~~~~~~-~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~  308 (468)
                        ...+..++..   .... .++..+..  .+.+...++ .....++++|+||++|++||+|+|+.+|++.+.|+++|++
T Consensus       232 --~~~v~tyG~~~~ad~~a-~ni~~~~~~~~F~V~~~g~~~~~~~l~~pG~HNvlNAlaaia~a~~~Gi~~~~i~~aL~~  308 (459)
T COG0773         232 --WSPVVTYGFDDEADWRA-ENIRQDGSGTTFDVLFRGEELGEVKLPLPGRHNVLNALAAIAVARELGIDPEAIAEALAS  308 (459)
T ss_pred             --CCCEEEECCCCCCCEEE-EEEEEECCCCEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             --87379424787672899-976870664279999868556799972676226888999999999849998999999973


Q ss_pred             HHHHHHHHHHHCCCCCCEEECCCCCCCHH---HHHHHHHCCC---CCCEEEECC--CCCC-CCHHHHHHHHCCCCEEEEE
Q ss_conf             01345443321003430000023556755---5555320133---320012032--1012-2068989984278689998
Q gi|254781099|r  309 CGGLTHRLQTIARLGHVIFINDSKATNLH---SVIHAFLNEK---RRIYWIAGG--LSKS-DDFSTLFPFISKIAKAYFI  379 (468)
Q Consensus       309 f~gv~~R~E~i~~~~gv~iIDDS~atnp~---a~~~Al~~~~---~~i~lI~GG--~~K~-~d~~~L~~~~~~~~~~~li  379 (468)
                      |+|++||||..++.+++++||| |||.|.   +|++|++...   +|++.|.==  ..|- .-+.+..+.++..+.+++.
T Consensus       309 F~GvkRRfe~~g~~~~~~viDD-YaHHPtEI~aTL~aaR~~~~~~~rIvaifQPHrySRt~~~~~dF~~~l~~AD~v~l~  387 (459)
T COG0773         309 FQGVKRRFELKGEVNGVTVIDD-YAHHPTEIKATLAAARQKVPGGKRIVAVFQPHRYSRTRDLLDDFAKALSDADEVILL  387 (459)
T ss_pred             CCCCCEEEEEEEEECCEEEEEC-CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             8896413688646887899856-888979999999999976588866999977873175899999999888519999996


Q ss_pred             -----------C-CCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECC
Q ss_conf             -----------8-9989988863168988998799999999999998448985999452
Q gi|254781099|r  380 -----------G-NSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSP  426 (468)
Q Consensus       380 -----------G-~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSP  426 (468)
                                 | .+...+.+.+....... ++++++.++.+.   +.+++||+||+==
T Consensus       388 ~VY~A~e~~~~g~~~~~~l~~~i~~~~~~~-~~~~~~~~~~l~---~~~~~gD~il~mG  442 (459)
T COG0773         388 DVYAAGEEPIEGDVSSEDLAEKIRQPGHVD-VPDLDDLVELLA---KVAQPGDVILFMG  442 (459)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHCCCCCC-CCCHHHHHHHHH---HHCCCCCEEEEEC
T ss_conf             233357888767753999999851377014-788889999999---6478999899966


No 22 
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional
Probab=100.00  E-value=0  Score=416.77  Aligned_cols=320  Identities=22%  Similarity=0.273  Sum_probs=234.9

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCC-------------CC-CCC------CCCCCCCEEEEEC
Q ss_conf             156886899603457521578999999873100000001244-------------32-211------0168883799921
Q gi|254781099|r  109 SSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGL-------------PI-LNL------EYFSPNRFYVIEC  168 (468)
Q Consensus       109 ~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~-------------p~-~~~------~~~~~~~~~V~E~  168 (468)
                      ...+.++||||||||||||+.|++++|+..|+++.+.|++|.             |. +.+      ....+.+++|+|+
T Consensus        96 ~~~~l~vIgITGTnGKTTt~~~l~~iL~~~g~~~~~igT~g~~~~~~~~~~~lTTP~~l~L~~~l~~~~e~g~~~~vmEv  175 (481)
T PRK00139         96 PSDKLKLIGVTGTNGKTTTAYLIAQILRLLGKKAALIGTLGNGLGGTLIPSGLTTPEALDLQRLLAEAVDAGATHVAMEV  175 (481)
T ss_pred             CHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEECCCCEECCCEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             04318089995899843499999999987498631430221141873036678988768899999999987997799984


Q ss_pred             CCCCCC--CCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC--CCCCCCCCCHHHHHHHHHCCCCCCEEECCC
Q ss_conf             775432--1223332210111002101222111000011221000101--344322478678999874012343011036
Q gi|254781099|r  169 SSYQIE--LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGHSISRIS  244 (468)
Q Consensus       169 SSfQL~--~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~--~~~iln~dd~~~~~~~~~~~~~~~~~~~~~  244 (468)
                      ||+.|+  ++..++||++|+|||++||||+|||||+|+++|.+||...  +.+++|.||++...+..........+....
T Consensus       176 SShgl~q~Rv~gi~fdiav~TNIs~DHLD~Hgs~e~Y~~aK~~Lf~~~~~~~aViN~DD~~~~~~~~~~~~~~it~g~~~  255 (481)
T PRK00139        176 SSHALDQGRVDGLTFDVAVFTNLTRDHLDYHGTMEDYFAAKALLFAELGLKAAVINADDEVGARLLAALPATVVTYSIED  255 (481)
T ss_pred             CHHHHHHCCCCCCCCCEEEEECCCHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCHHHHHHHHHCCCCCCEECCCC
T ss_conf             30355522134887568999657677853437899999999999746578824994688899999997178852540478


Q ss_pred             C-CCCCC-CCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCC
Q ss_conf             4-43222-341121241354146764212345588510111001101222102222211000000001345443321003
Q gi|254781099|r  245 S-QSLQS-DSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARL  322 (468)
Q Consensus       245 ~-~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~  322 (468)
                      . ..... ......++..+............++++|.||++|+++|++++..+|++.+.|.++|++|++++||||.+...
T Consensus       256 ~~ad~~~~~i~~~~~g~~f~l~~~~~~~~v~l~l~G~hNv~NalaAiava~~lGi~~~~i~~~L~~~~~v~GRmE~i~~~  335 (481)
T PRK00139        256 HGADLRATDIEFSAQGVSFTLVTPWGEGEVESPLIGRFNVSNLLAAIAALLALGVPLEDILKALAKLRPVPGRMERVGAG  335 (481)
T ss_pred             CCCEEEEEEEEECCCCEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCEEEECC
T ss_conf             88608999999848961999995893799996788788898799999999983989899999983499999986899879


Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCC----CCCCEEEEC-CCCCCCCHHH-HHHHHCCCCEEEEE------CCCHHHHHHHH
Q ss_conf             430000023556755555532013----332001203-2101220689-89984278689998------89989988863
Q gi|254781099|r  323 GHVIFINDSKATNLHSVIHAFLNE----KRRIYWIAG-GLSKSDDFST-LFPFISKIAKAYFI------GNSAMLFFHHF  390 (468)
Q Consensus       323 ~gv~iIDDS~atnp~a~~~Al~~~----~~~i~lI~G-G~~K~~d~~~-L~~~~~~~~~~~li------G~~~~~i~~~~  390 (468)
                      ++.++|+| |||||+|+.++|+.+    .+|+++++| |-+|....++ |++.+.++.+.+++      .|+...|.+.+
T Consensus       336 ~~~~vivD-YAHtP~sl~~~L~~lr~~~~~rli~VfG~gG~Rd~~KR~~mg~ia~~~ad~vi~T~DnPr~Edp~~I~~~i  414 (481)
T PRK00139        336 GGPLVIVD-YAHTPDALEKVLDALRPHAKGRLICVFGCGGDRDKGKRPLMGAIAERLADVVIVTSDNPRSEDPAAIIADI  414 (481)
T ss_pred             CCCEEEEE-CCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEECCCCCCCCCHHHHHHHH
T ss_conf             99689997-68998999999999987648986999898677770141899999997199899939998998999999999


Q ss_pred             HCCC---CEEEECCHHHHHHHHHHHHHHCCCCCEEEEC-CCCCCCC
Q ss_conf             1689---8899879999999999999844898599945-2216631
Q gi|254781099|r  391 GGKI---NSTLSKTLDQALKSVVRDVENVQLPSIVLFS-PGCASFD  432 (468)
Q Consensus       391 ~~~~---~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlS-Pa~aS~d  432 (468)
                      ...+   ++....+..+|.+.+   ++.+++||+||+. .|--.|=
T Consensus       415 ~~g~~~~~~~~i~dR~~AI~~a---i~~a~~~d~vliaGKGhE~~q  457 (481)
T PRK00139        415 LAGITHANAVVIEDRAEAIKYA---IALAKPGDVVLIAGKGHEDYQ  457 (481)
T ss_pred             HHCCCCCCEEEECCHHHHHHHH---HHHCCCCCEEEEEECCCCCCE
T ss_conf             8269879928978999999999---985599999999735876668


No 23 
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents DP-N-acetylmuramoylalanyl-D-glutamate-2,6-diaminopimelate ligases (MurE; 6.3.2.13 from EC). An exception is found with Staphylococcus aureus, in which diaminopimelate is replaced by lysine in the peptidoglycan and MurE is (6.3.2.7 from EC). The Mycobacteria, part of the closest neighbouring branch outside of the low-GC Gram-positive bacteria, use diaminopimelate.; GO: 0005524 ATP binding, 0016881 acid-amino acid ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=404.59  Aligned_cols=314  Identities=21%  Similarity=0.279  Sum_probs=230.9

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCC-----------------------CCCCCCCCCEEEE
Q ss_conf             56886899603457521578999999873100000001244322-----------------------1101688837999
Q gi|254781099|r  110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPIL-----------------------NLEYFSPNRFYVI  166 (468)
Q Consensus       110 ~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~~-----------------------~~~~~~~~~~~V~  166 (468)
                      ..+-++|||||||||||||+|++++|+.+|.++.+.|.+|.-+.                       .-....+.+++||
T Consensus        85 s~~l~viGvTGTNGKTtt~~li~~~l~~~G~~tgliGT~g~~~~g~~~~~~~~~~TTP~~~~~q~~L~~~~~~g~~~~v~  164 (494)
T TIGR01085        85 SKKLKVIGVTGTNGKTTTTSLIAQLLELLGKKTGLIGTIGYRLGGNELIKDPASLTTPEALTLQKTLAEMVEAGAQYAVM  164 (494)
T ss_pred             CCCEEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             52516899971287448999999999867970899865453047763126655567997189999999999659979999


Q ss_pred             ECCCCCC--C--CCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEE--C-------CCCCCCCCCHHHHHHHHHC
Q ss_conf             2177543--2--122333221011100210122211100001122100010--1-------3443224786789998740
Q gi|254781099|r  167 ECSSYQI--E--LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM--S-------KHAIICINDHQCEKIAYDM  233 (468)
Q Consensus       167 E~SSfQL--~--~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~--~-------~~~iln~dd~~~~~~~~~~  233 (468)
                      |+|||-|  .  ++..++++++|+|||+.||||||||||||..+|.+||..  .       +.+|+|.||++...+....
T Consensus       165 EvSSHaL~q~TARV~~~~F~~~vFTNl~~DHLDfHgtmEnY~~aK~~LF~~~~~~~~~~~~~~aV~n~dD~~~~~f~~~~  244 (494)
T TIGR01085       165 EVSSHALAQGTARVEGVDFDAAVFTNLTRDHLDFHGTMENYFAAKAKLFTELGLKSDRRRARFAVINLDDEYGAQFVKRL  244 (494)
T ss_pred             EEEHHHHHCCCCEEECCEEEEEEEECCCHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHH
T ss_conf             86301242142111021157999607883023403348999999985244001367753566115886454469998610


Q ss_pred             CCCCCEEECCCCCC-------CC-CCCCEEECCCEEEECCCCC-CCCCCCCCCCCHHHHHCCCHHHHHHCCC-CCCCCCH
Q ss_conf             12343011036443-------22-2341121241354146764-2123455885101110011012221022-2221100
Q gi|254781099|r  234 NFIGHSISRISSQS-------LQ-SDSDLYIDESFLKCSATSE-VIFDFSQETKKHNIQNLVTSAVVCMQLG-LKVEEIK  303 (468)
Q Consensus       234 ~~~~~~~~~~~~~~-------~~-~~~~~~~~~~~~~~~~~~~-~~~~~~~l~G~HNi~NalaAia~a~~lG-i~~~~i~  303 (468)
                      +.............       +. ...........+.+..... .....++|+|.||++|+|||+|++..+| ++++++.
T Consensus       245 ~~~~~~~~~~~~A~~R~~~~~~~~~~~~~~~~G~~~~~~~~~g~~~~~~~~LiG~FNv~N~lAa~a~~~~~gg~~~~~~~  324 (494)
T TIGR01085       245 PKDITVSAITQKADWRGKAQDIKITDSGYSFEGQSFTFETPAGVEFKLHTPLIGRFNVYNLLAALATLLHLGGIDLEDIV  324 (494)
T ss_pred             HHHCEEEEEEECCCCCCCCCCCHHHCCCCEEEEEEEEEECCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             25225778850421263112401100001034566675246752068875361368899999999999973388899999


Q ss_pred             HHCCCHHHHHHHHHHHCCCC-CCEEECCCCCCCHHHHHHHHHCCC--------CCCEEE--ECCCCCCCCHHHH-HHHHC
Q ss_conf             00000013454433210034-300000235567555555320133--------320012--0321012206898-99842
Q gi|254781099|r  304 RALLSCGGLTHRLQTIARLG-HVIFINDSKATNLHSVIHAFLNEK--------RRIYWI--AGGLSKSDDFSTL-FPFIS  371 (468)
Q Consensus       304 ~~L~~f~gv~~R~E~i~~~~-gv~iIDDS~atnp~a~~~Al~~~~--------~~i~lI--~GG~~K~~d~~~L-~~~~~  371 (468)
                      +.|++|+||+||||.|.... +..+|=| |||+|+|..++|.++.        ++++.|  ||| ||+-.+||| ++++.
T Consensus       325 ~~l~~~~gv~GRmE~v~~~~~~f~V~VD-YAHTPDaLek~L~~lr~~~~~~~~g~L~~vFGcGG-dRDr~KRplMG~iA~  402 (494)
T TIGR01085       325 AALEKLRGVPGRMELVDGGQQKFLVIVD-YAHTPDALEKVLRTLRAIKLKHKKGRLIVVFGCGG-DRDRGKRPLMGAIAE  402 (494)
T ss_pred             HHHHHCCCCCCCCEEECCCCCCCEEEEE-ECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC-CCCCCCCHHHHHHHH
T ss_conf             8987348998731230278999607997-14880589999999999984258982799981578-998445758999999


Q ss_pred             CCCEEEEE------CCCHHHHHHHH-HCCCCEEE---ECCHHHHHHHHHHHHHHCCCCCEEEEC
Q ss_conf             78689998------89989988863-16898899---879999999999999844898599945
Q gi|254781099|r  372 KIAKAYFI------GNSAMLFFHHF-GGKINSTL---SKTLDQALKSVVRDVENVQLPSIVLFS  425 (468)
Q Consensus       372 ~~~~~~li------G~~~~~i~~~~-~~~~~~~~---~~~~~~a~~~i~~~~~~~~~gDiVLlS  425 (468)
                      ++.+.+++      +||...|.+.+ ++.-....   +....|..++|..+++++++||+||++
T Consensus       403 ~~AD~~ilT~DNPR~Edp~~I~~Di~~G~~~~~~~~~~~~i~DR~~AI~~Ai~~A~~gD~VLiA  466 (494)
T TIGR01085       403 QLADLIILTSDNPRSEDPEQIIADILAGISEKEKDKDVVIIADRRQAIRKAISNAKAGDVVLIA  466 (494)
T ss_pred             HHCCEEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCEEEEHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             8298689836885457979999999971477666751589601789999999840479889996


No 24 
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed
Probab=100.00  E-value=0  Score=391.70  Aligned_cols=323  Identities=17%  Similarity=0.217  Sum_probs=242.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCC----CCCCCCCCCCCCCCCEEEEECCCC-CCC---CCCCCCC
Q ss_conf             56886899603457521578999999873100000001----244322110168883799921775-432---1223332
Q gi|254781099|r  110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGN----IGLPILNLEYFSPNRFYVIECSSY-QIE---LTPTIDP  181 (468)
Q Consensus       110 ~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GN----iG~p~~~~~~~~~~~~~V~E~SSf-QL~---~~~~~~P  181 (468)
                      ..+.++||||||||||||+.|++++|+..|......||    +|+|++.+...++.+++|+|+++. +-+   .+..++|
T Consensus        97 ~~~~~vIgITGSnGKTTtk~~i~~iL~~~g~~~~t~gn~n~~iG~p~tl~~~~~~~~~~v~E~g~~~~gei~~~~~~~~p  176 (452)
T PRK10773         97 QVPARVVALTGSSGKTSVKEMTAAILSQCGNTLYTAGNLNNDIGVPLTLLRLTPEYDYAVIELGANHQGEIAWTVSLTRP  176 (452)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHCCCCCCHHHHHHCCCCC
T ss_conf             59975899991699625999999999972884124565268878660765079213357853237985356766400266


Q ss_pred             CCCEEEEECCCHHHHHHHHHHCCCCCCCEEEEC---CCCCCCCCCHHHHHHHHHCCCCCCEEECCCCCC----CC-CCCC
Q ss_conf             210111002101222111000011221000101---344322478678999874012343011036443----22-2341
Q gi|254781099|r  182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS---KHAIICINDHQCEKIAYDMNFIGHSISRISSQS----LQ-SDSD  253 (468)
Q Consensus       182 diavITNI~~DHLd~~~s~e~y~~aK~~i~~~~---~~~iln~dd~~~~~~~~~~~~~~~~~~~~~~~~----~~-~~~~  253 (468)
                      |++|||||++||||+|+|+|+|+++|++||++.   +.+++|.||+....+........  +..+....    .. .+..
T Consensus       177 diaviTNI~~dHLd~~gs~e~~~~aK~~Lf~~l~~~g~~IlN~Dd~~~~~~~~~~~~~~--v~~~~~~~~~~d~~~~~i~  254 (452)
T PRK10773        177 EAALVNNLAAAHLEGFGSLAGVAKAKGEIFTGLPENGIAIMNADNNDWLNWQSVIGSRK--VWRFSPNAANSDFTATNIH  254 (452)
T ss_pred             CEEEEEECCHHHHHCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHCCCE--EEEECCCCCCCCEEEEEEE
T ss_conf             75999842477654057699999999999817887989999798767999999837982--8998068777618999999


Q ss_pred             EEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCC
Q ss_conf             12124135414676421234558851011100110122210222221100000000134544332100343000002355
Q gi|254781099|r  254 LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKA  333 (468)
Q Consensus       254 ~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~a  333 (468)
                      .......+............++++|.||++|+++|++++..+|++++.|.++|++|++++||||.+...+|.++||||||
T Consensus       255 ~~~~g~~f~l~~~~~~~~v~l~l~G~hnv~NalaAiava~~lG~~~~~i~~~L~~~~~v~GRme~i~~~~g~~iIdDsYN  334 (452)
T PRK10773        255 VTSHGTEFTLHTPTGSVDVLLPLPGRHNIANALAAAALAMSVGATLDAVKAGLANLKAVPGRLFPIQLAENQLLLDDSYN  334 (452)
T ss_pred             EECCCCEEEEEECCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCEEEEECCCEEEEEEECCC
T ss_conf             91894189999679518999707617689989999999998599999999999728998674079973870899974256


Q ss_pred             CCHHHHHHHHHC---CCCCCEEEECCCCCCCC-----HHHHHHHHC--CCCEEEEECCCHHHHHHHHHCCCCEEEECCHH
Q ss_conf             675555553201---33320012032101220-----689899842--78689998899899888631689889987999
Q gi|254781099|r  334 TNLHSVIHAFLN---EKRRIYWIAGGLSKSDD-----FSTLFPFIS--KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD  403 (468)
Q Consensus       334 tnp~a~~~Al~~---~~~~i~lI~GG~~K~~d-----~~~L~~~~~--~~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~  403 (468)
                      +||+|+.+||+.   ++++.++|+|.+..-++     .+++++.+.  .++.++++|+....+.+..+   ...++.+.+
T Consensus       335 AnP~Sm~aal~~l~~~~~~ki~VLGdM~ELG~~s~~~H~~v~~~~~~~~id~v~~vG~~~~~~~~~~~---~~~~f~~~~  411 (452)
T PRK10773        335 ANVGSMTAAVQVLAEMPGYRVLVVGDMAELGAESEACHRQVGEAAKAAGIDRVLSVGKLSQAISTASG---VGEHFADKT  411 (452)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEEEECCHHHCCCHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHCC---CCCCCCCHH
T ss_conf             99799999999997577976999877377285789999999999997699999998878999987418---763369999


Q ss_pred             HHHHHHHHHHHHCCCCC--EEEECCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             99999999998448985--99945221663134798999999999998637
Q gi|254781099|r  404 QALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSFMSQVSEIP  452 (468)
Q Consensus       404 ~a~~~i~~~~~~~~~gD--iVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~  452 (468)
                      +....+.+   .++++|  +||+.   +|         ||.++.++|+.|.
T Consensus       412 ~~~~~l~~---~l~~~~~~~vLvK---GS---------r~~~le~iv~~L~  447 (452)
T PRK10773        412 ALIARLKA---LLAEQQVITILVK---GS---------RSAAMEEVVRALQ  447 (452)
T ss_pred             HHHHHHHH---HHHCCCCEEEEEE---CC---------CCCCHHHHHHHHH
T ss_conf             99999998---8744998489998---57---------5114999999999


No 25 
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional
Probab=100.00  E-value=0  Score=395.74  Aligned_cols=361  Identities=18%  Similarity=0.187  Sum_probs=265.7

Q ss_pred             CCCCCHHHHHHHHCCCE-E-EEEH--H------------HHHHHH---HHCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             75578889999976980-9-9830--3------------422334---30156886899603457521578999999873
Q gi|254781099|r   78 GENAHWCVKLANQFNVE-I-IGDI--E------------LFVRER---RFSSLQSPFIAVTGTNGKSSTVALISHVLRKN  138 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~-v-~s~~--e------------l~~~~~---~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~  138 (468)
                      .-+.|-.+.+|.++|-- + +++.  +            .+++.+   .+...+.++||||||||||||+.||+++|.+.
T Consensus       537 ~~DGH~Fi~~Ai~~GA~~~vv~~~~~~~~~p~I~V~Dt~~AL~~lA~~~r~~~~~~vIgITGSnGKTTTKeml~~iLs~~  616 (953)
T PRK11929        537 NFDGHAYLPQAFSAGACAAVVAHQVADVALPQLVLGDTLAALGRMATAWRSSFSLPVIAITGSNGKTTTKEMIAAILAQW  616 (953)
T ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCCCCCCEEEECCHHHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             77779999999986997999925666678897996898999999999999757997899967885078999999999851


Q ss_pred             H---HHC-CCCCC----CCCCCCCCCCCCCCCEEEEECC-CCC--C-CCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCC
Q ss_conf             1---000-00001----2443221101688837999217-754--3-212233322101110021012221110000112
Q gi|254781099|r  139 G---YDV-QLGGN----IGLPILNLEYFSPNRFYVIECS-SYQ--I-ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNI  206 (468)
Q Consensus       139 g---~~~-~~~GN----iG~p~~~~~~~~~~~~~V~E~S-SfQ--L-~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~a  206 (468)
                      +   +++ ...||    ||+|++.+......+++|+||+ |+.  + .+++.++||++|||||+++|||+|||+|+|+++
T Consensus       617 ~~~~~~v~~t~gN~NN~iGvPltll~l~~~~~~aVlEmGms~~GEI~~L~~i~~PdiaVITNIg~aHLe~fgs~e~Ia~a  696 (953)
T PRK11929        617 QGDDGRVTATEGNFNNEIGVPLTLLRLRARHRAAVFELGMNHPGEIARLAAIAAPTVALVTNAQREHQEFLHSVEAVARA  696 (953)
T ss_pred             CCCCCEEEECCCCCCCCCCCCHHHHCCCCCCHHHHHHHCCCCCCHHHHHHCCCCCCEEEEECCHHHHHHHHCCHHHHHHH
T ss_conf             77784388556743786667178757996346578765289622699860625897788744569987661899999999


Q ss_pred             CCCEEEEC---CCCCCCCCCHHHHHHHHHCCCCC---CEEECCCCCCCCCCC-CEEECCCEEEECCCCCCCCCCCCCCCC
Q ss_conf             21000101---34432247867899987401234---301103644322234-112124135414676421234558851
Q gi|254781099|r  207 KKKIVTMS---KHAIICINDHQCEKIAYDMNFIG---HSISRISSQSLQSDS-DLYIDESFLKCSATSEVIFDFSQETKK  279 (468)
Q Consensus       207 K~~i~~~~---~~~iln~dd~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~l~G~  279 (468)
                      |++||++.   +.+++|.||++...+........   +.+............ ........+............++++|.
T Consensus       697 K~eIf~~l~~~g~aIlN~DD~~~~~~~~~~~~~~i~~fg~~~~~~adi~~~~i~~~~~g~~~~~~~~~~~~~v~l~l~G~  776 (953)
T PRK11929        697 NGALINALPEDGIAVVNGDDPYAAIWAKLAGARRVLRFGLSLQPGLDVYAEDIVTQAAGTLCFVVTPAGSAYVDLPVPGE  776 (953)
T ss_pred             HHHHHHCCCCCCEEEEECCCHHHHHHHHHHCCCCEEEEEECCCCCCCEEEEEEEECCCCEEEEEEECCCEEEEEECCCCH
T ss_conf             99998315879799993886889999998457875999852589876899998986896499999789569999568979


Q ss_pred             HHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCC---C-CCCEEEEC
Q ss_conf             0111001101222102222211000000001345443321003430000023556755555532013---3-32001203
Q gi|254781099|r  280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE---K-RRIYWIAG  355 (468)
Q Consensus       280 HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~---~-~~i~lI~G  355 (468)
                      ||++|+++|++++..+|+++++|.++|.+|+++++|||.+...+|+++|||||+.||+||.+||+.+   + ++.++|+|
T Consensus       777 hnv~NaLaAiAva~~lGi~~~~i~~~L~~~~~~~gR~e~~~~~~g~~iIDDsYNANP~Sm~aAl~~L~~~~~~~kiaVLG  856 (953)
T PRK11929        777 HNLRNALAAIAIGLAAGAPLHQIIAALEGFQAVKGRMQRRQLSDGTVIIDDTYNANPDSMRAAIDVLARLPGPKRALVLG  856 (953)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCEEEEECCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCEEEEEC
T ss_conf             99999999999999939999999999866999999878999579979999784888999999999985287998699984


Q ss_pred             CCCCCCCH-----HHHHHHHC--CCCEEEEECCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             21012206-----89899842--786899988998998886316898899879999999999999844898599945221
Q gi|254781099|r  356 GLSKSDDF-----STLFPFIS--KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGC  428 (468)
Q Consensus       356 G~~K~~d~-----~~L~~~~~--~~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~  428 (468)
                      .+..-++.     .++++.+.  .++.++++|+....+.+.+... ...++.+.+++.+.+.   +..++||+||+.   
T Consensus       857 dM~ELG~~s~~~H~~ig~~~~~~~id~v~~vG~~~~~~~~~~~~~-~~~~~~~~~~l~~~L~---~~l~~~d~VLVK---  929 (953)
T PRK11929        857 DMLELGDNGPAMHREVGDYAREHSIDALITLGEASRDAAHAFGKA-ARACFASVDEIIAALR---GLLPSSDIVLIK---  929 (953)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHCCCC-CEEEECCHHHHHHHHH---HHCCCCCEEEEE---
T ss_conf             850024578999999999999759999999865799998656846-5788399999999998---558999999997---


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             66313479899999999999863798
Q gi|254781099|r  429 ASFDQYNNFRERGFSFMSQVSEIPGI  454 (468)
Q Consensus       429 aS~d~f~~y~~RG~~F~~~v~~l~~~  454 (468)
                      +|         ||.++.++|..|.+-
T Consensus       930 GS---------R~m~lE~iV~~l~~~  946 (953)
T PRK11929        930 GS---------RFMRLERVVTAFSTN  946 (953)
T ss_pred             CC---------CCCCHHHHHHHHHCC
T ss_conf             15---------604699999999729


No 26 
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional
Probab=100.00  E-value=0  Score=387.28  Aligned_cols=340  Identities=18%  Similarity=0.217  Sum_probs=239.8

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCC----------C-----------CCCCCCCCCEEEEE
Q ss_conf             15688689960345752157899999987310000000124432----------2-----------11016888379992
Q gi|254781099|r  109 SSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPI----------L-----------NLEYFSPNRFYVIE  167 (468)
Q Consensus       109 ~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~----------~-----------~~~~~~~~~~~V~E  167 (468)
                      ...+.++||||||||||||+.|+++||+..|+++.+.|++|.-+          +           ......+.+++|+|
T Consensus       107 ps~~l~vigVTGTNGKTTt~~~i~~il~~~g~~~~~iGTlg~~~~~~~~~~~~~TTP~~~~l~~~l~~~~~~g~~~~vmE  186 (953)
T PRK11929        107 PSQDLSVVAVTGTNGKTSCAQWLAQMLTRLGKPCGSIGTLGARLPDGQSLGGSLTTPDVITLHRLLARMRAAGADAVAME  186 (953)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             67588789997999799999999999986799889983245405876446789999489999999999997699799998


Q ss_pred             CCCCCCC--CCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEE---CCCCCCCCCCHHHHHHHHHCCCCCCEEEC
Q ss_conf             1775432--122333221011100210122211100001122100010---13443224786789998740123430110
Q gi|254781099|r  168 CSSYQIE--LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM---SKHAIICINDHQCEKIAYDMNFIGHSISR  242 (468)
Q Consensus       168 ~SSfQL~--~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~---~~~~iln~dd~~~~~~~~~~~~~~~~~~~  242 (468)
                      +||+.|+  ++..++++++++||+++||||||+|||+|.++|.+||..   .+.+|+|.||++.+.+.............
T Consensus       187 vSSHgL~q~Rv~gi~fdvaifTNls~DHLDyH~tme~Y~~aK~~LF~~l~~~~~aViN~Dd~~~~~l~~~~~~~~~~~~~  266 (953)
T PRK11929        187 ASSHGLEQGRLDGIRFAVAGFTNLTRDHLDYHGTMEDYEQAKAALFEQWPPLGAAVINADDPAGERLLASLPAALLTGYA  266 (953)
T ss_pred             ECHHHHHHHHHCCCCCCEEEEECCCHHHHHHCCCHHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCEEEEE
T ss_conf             33067764342087878899947976786654899999999999998741086699979888899999871278589993


Q ss_pred             CCC--CCCC-CCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHH
Q ss_conf             364--4322-2341121241354146764212345588510111001101222102222211000000001345443321
Q gi|254781099|r  243 ISS--QSLQ-SDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTI  319 (468)
Q Consensus       243 ~~~--~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i  319 (468)
                      ...  .... .......++..+............++++|.||++|+++|++++..+|++.+.|.++|+.++++|||||.|
T Consensus       267 ~~~~~ad~~~~~i~~~~~g~~f~l~~~~~~~~~~~~L~G~fNv~N~laA~a~~~~~g~~~~~i~~~l~~~~~vpGRmE~v  346 (953)
T PRK11929        267 LQGSPADVHAYDLQATAHGQVFTLALPDGEAQIVTGLLGRHNISNLLLVAGALSKLGWPLPQIARELAAVSPVDGRLERV  346 (953)
T ss_pred             CCCCCCCEEEEEEEECCCCCEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             36787748999999828986899997892799980686312499999999999983999999999886179988875996


Q ss_pred             C---CCCCCEEECCCCCCCHHHHHHHHHCC------CCCCEEEEC-CCCCCCCHHH-HHHHHCCCCEEEEE------CCC
Q ss_conf             0---03430000023556755555532013------332001203-2101220689-89984278689998------899
Q gi|254781099|r  320 A---RLGHVIFINDSKATNLHSVIHAFLNE------KRRIYWIAG-GLSKSDDFST-LFPFISKIAKAYFI------GNS  382 (468)
Q Consensus       320 ~---~~~gv~iIDDS~atnp~a~~~Al~~~------~~~i~lI~G-G~~K~~d~~~-L~~~~~~~~~~~li------G~~  382 (468)
                      .   ..++..+|=| |||||+|...+|++.      .+|++++.| |-+|+...++ |++.+.++.+.+++      .||
T Consensus       347 ~~~~~~~~~~viVD-YAHTpdAl~~~L~~lr~~~~~~~rli~VfGcgGdRD~~KRp~Mg~iA~~~aD~viiT~DNPR~Ed  425 (953)
T PRK11929        347 GPTASAQGPLVVVD-YAHTPDALARALTALRPVAEANGRLVCVFGCGGNRDKGKRPEMGRIAAELADRVIVTSDNPRDEA  425 (953)
T ss_pred             ECCCCCCCCEEEEE-CCCCHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHCCEEEECCCCCCCCC
T ss_conf             15666789669998-67898999999999997614698099998987877610348999999984998998689989999


Q ss_pred             HHHHHHHHHCCC----CEEEECCHHHHHHHHHHHHHHCCCCCEEEEC-CCCCCCCCCC----CHHHHHHHHHHHHHHCC
Q ss_conf             899888631689----8899879999999999999844898599945-2216631347----98999999999998637
Q gi|254781099|r  383 AMLFFHHFGGKI----NSTLSKTLDQALKSVVRDVENVQLPSIVLFS-PGCASFDQYN----NFRERGFSFMSQVSEIP  452 (468)
Q Consensus       383 ~~~i~~~~~~~~----~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlS-Pa~aS~d~f~----~y~~RG~~F~~~v~~l~  452 (468)
                      ...|.+.+...+    +.....+..+|   |.+++..+++||+||++ -|--.|-.+.    -|.||=..=..+..+..
T Consensus       426 p~~I~~dI~~g~~~~~~~~~i~dR~~A---I~~ai~~a~~~D~vliaGKGhE~yQ~i~~~~~~f~Dre~~~~~~~~~~~  501 (953)
T PRK11929        426 PEDIIDQILAGIPAGARALRQSDRALA---IMQAIWMAKPGDVILLAGKGHETYQDIGGRKLFFDDRQWARLALLLPHA  501 (953)
T ss_pred             HHHHHHHHHHCCCCCCCEEEECCHHHH---HHHHHHHCCCCCEEEEEECCCCCCEEECCEEECCCCHHHHHHHHHHHHH
T ss_conf             999999998565668866997799999---9999984799998999876865637879996237809999999986654


No 27 
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; InterPro: IPR005863   The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment. The peptidoglycan layer gives the cell wall its strength, and helps maintain the overall shape of the cell. The basic peptidoglycan structure of both Gram-positive and Gram-negative bacteria is comprised of a sheet of glycan chains connected by short cross-linking polypeptides. Biosynthesis of peptidoglycan is a multi-step (11-12 steps) process comprising three main stages:    (1) formation of UDP-N-acetylmuramic acid (UDPMurNAc) from N-acetylglucosamine (GlcNAc). (2) addition of a short polypeptide chain to the UDPMurNAc. (3) addition of a second GlcNAc to the disaccharide-pentapeptide building block and transport of this unit through the cytoplasmic membrane and incorporation into the growing peptidoglycan layer.    Stage two involves four key Mur ligase enzymes: MurC (6.3.2.8 from EC) , MurD (6.3.2.9 from EC) , MurE (6.3.2.13 from EC)  and MurF (6.3.2.10 from EC) . These four Mur ligases are responsible for the successive additions of L-alanine, D-glutamate, meso-diaminopimelate or L-lysine, and D-alanyl-D-alanine to UDP-N-acetylmuramic acid. All four Mur ligases are topologically similar to one another, even though they display low sequence identity. They are each composed of three domains: an N-terminal Rossmann-fold domain responsible for binding the UDPMurNAc substrate; a central domain (similar to ATP-binding domains of several ATPases and GTPases); and a C-terminal domain (similar to dihydrofolate reductase fold) that appears to be associated with binding the incoming amino acid. The conserved sequence motifs found in the four Mur enzymes also map to other members of the Mur ligase family, including folylpolyglutamate synthetase, cyanophycin synthetase and the capB enzyme from Bacillales .    This entry represents UDP-N-acetylmuramoyl-tripeptide-D-alanyl-D-alanine ligase (MurF, 6.3.2.15 from EC), which is required to catalyze the final step in the synthesis of the cytoplasmic precursor of the bacterial cell wall peptidoglycan.  ATP + UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminoheptanedioate + D-alanyl-D-alanine = ADP + phosphate + UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-6-carboxy-L-lysyl-D-alanyl-D-alanine.. The crystal structure of the MurF apo-enzyme has been determined and refined to 2.3 A resolution. It contains three consecutive open alpha/beta-sheet domains. The topology of the N-terminal domain of MurF is unique, while its central and C-terminal domains exhibit similar mononucleotide and dinucleotide-binding folds to MurD. The apo-enzyme of MurF crystal structure reveals an open conformation with the three domains juxtaposed in a crescent-like arrangement creating a wide-open space where substrates are expected to bind. As such, catalysis is not feasible and significant domain closure is expected upon substrate binding . ; GO: 0005524 ATP binding, 0008766 UDP-N-acetylmuramoylalanyl-D-glutamyl-26-diaminopimelate-D-alanyl-D-alanine ligase activity, 0008360 regulation of cell shape, 0009252 peptidoglycan biosynthetic process, 0009273 peptidoglycan-based cell wall biogenesis, 0051301 cell division, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=387.54  Aligned_cols=331  Identities=21%  Similarity=0.274  Sum_probs=262.0

Q ss_pred             CCCCCC--EEEEECCCCCCHHHHHHHHHHHHHHH----HCCCCCC----CCCCCCCCCCCCCCCEEEEECC-CCC--C-C
Q ss_conf             156886--89960345752157899999987310----0000001----2443221101688837999217-754--3-2
Q gi|254781099|r  109 SSLQSP--FIAVTGTNGKSSTVALISHVLRKNGY----DVQLGGN----IGLPILNLEYFSPNRFYVIECS-SYQ--I-E  174 (468)
Q Consensus       109 ~~~~~~--vI~VTGT~GKTTt~~ll~~iL~~~g~----~~~~~GN----iG~p~~~~~~~~~~~~~V~E~S-SfQ--L-~  174 (468)
                      ...+.+  +||||||+||||||+|+++||++.+.    -....||    ||+|++.+....+.||+|+||. |++  + +
T Consensus        78 ~~~~~~~~~igiTGS~GKTTtKEm~~~iL~~~~~~~~aV~~t~GN~Nn~iGlPltlL~~~~~~~~aV~EmG~s~~GEI~~  157 (462)
T TIGR01143        78 EKFSAKRRVIGITGSSGKTTTKEMLAAILSHKYKDSEAVLATPGNFNNEIGLPLTLLRATEDHDYAVLEMGASHPGEIAY  157 (462)
T ss_pred             HHCCCCEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCCCCHHH
T ss_conf             74399758999856896067999999999853597532362488767613567887507888805999843898873789


Q ss_pred             CCCCCCCCCCEEEEECCCHHHH---HHHHHHCCCCCCCEEEE---CCCCCCCCCCHHHHHHHHHCCCCCCE-EECCCCCC
Q ss_conf             1223332210111002101222---11100001122100010---13443224786789998740123430-11036443
Q gi|254781099|r  175 LTPTIDPSIGVLLNISPDHLDR---HHTLENYVNIKKKIVTM---SKHAIICINDHQCEKIAYDMNFIGHS-ISRISSQS  247 (468)
Q Consensus       175 ~~~~~~PdiavITNI~~DHLd~---~~s~e~y~~aK~~i~~~---~~~~iln~dd~~~~~~~~~~~~~~~~-~~~~~~~~  247 (468)
                      +++..+|||+|||||+++||+.   ||+++.++++|++|+++   .+.+|+|.||+....+.......... +..|+...
T Consensus       158 L~~i~~P~ia~itNi~~AHl~~F~~Fgs~~~Ia~aK~EI~~~~~~~~~a~~n~d~~~~~~~~~~~~~~~~~~~~~Fg~~~  237 (462)
T TIGR01143       158 LAEIAKPDIALITNIGEAHLEGFGDFGSLEGIAEAKGEILQGLKENGIAVINADDPALAKFKKRLKILNKAKVLSFGLEG  237 (462)
T ss_pred             HHHHHCCCEEEEECCHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHCCCCCCCCEEEECCCC
T ss_conf             99861998699917047876115787538999999999970789775898535256889999841115786478814777


Q ss_pred             -----CCCCCCEEECCCEEEECCCCCCCCCCCC-CCCCH-HHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHC
Q ss_conf             -----2223411212413541467642123455-88510-1110011012221022222110000000013454433210
Q gi|254781099|r  248 -----LQSDSDLYIDESFLKCSATSEVIFDFSQ-ETKKH-NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIA  320 (468)
Q Consensus       248 -----~~~~~~~~~~~~~~~~~~~~~~~~~~~~-l~G~H-Ni~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~  320 (468)
                           ...+..+......+.+....+.....+| +.|.| |+.|++||+|++..+|++.+++.++|+.+++++||++.+.
T Consensus       238 ~~~d~~~~~~~~~~~g~~f~~~~~~~~~~v~LP~~~G~h~n~~NalaA~Ala~~lG~~~~~~~~gL~~~~~~~gR~~~~~  317 (462)
T TIGR01143       238 KYADVSAEDVSLSELGTGFTLVTPGGEIEVELPILLGRHPNVENALAAAALALALGLPLEEIAEGLSELKPVKGRLEVIQ  317 (462)
T ss_pred             CCCCEEEECCEECCCCCEEEEEECCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             63436884321215333589986370899983112088188999999999999809888899989764278876507898


Q ss_pred             CCCCCEEECCCCCCCHHHHHHHHHC---CC-----CCCEEEECCCCCCCCH-----HHHHHHHC--CCCEEEEECCCH--
Q ss_conf             0343000002355675555553201---33-----3200120321012206-----89899842--786899988998--
Q gi|254781099|r  321 RLGHVIFINDSKATNLHSVIHAFLN---EK-----RRIYWIAGGLSKSDDF-----STLFPFIS--KIAKAYFIGNSA--  383 (468)
Q Consensus       321 ~~~gv~iIDDS~atnp~a~~~Al~~---~~-----~~i~lI~GG~~K~~d~-----~~L~~~~~--~~~~~~liG~~~--  383 (468)
                      ..+|+++||||||.||+||.+||+.   ++     ++.++|+|-+..-++.     .++++.+.  .+..++++|+..  
T Consensus       318 ~~~g~~~IdD~YNAnp~Sm~AAl~~L~~~~~~~E~g~~~~VLG~M~ELG~~s~~~H~~vg~~a~~~~~~~~~~~G~~~~~  397 (462)
T TIGR01143       318 TKKGLTLIDDTYNANPDSMRAALDALARFPGKGEVGKKILVLGDMLELGELSEELHAEVGRYAAALGIDLVFLVGEEASP  397 (462)
T ss_pred             ECCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             64874898441359889999999996138888863546899838453117999999999999986287389984773350


Q ss_pred             ---HHHHHHHHC-----CCCEEEECCHHHHHHHHHHH-HHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             ---998886316-----89889987999999999999-984489859994522166313479899999999999863
Q gi|254781099|r  384 ---MLFFHHFGG-----KINSTLSKTLDQALKSVVRD-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI  451 (468)
Q Consensus       384 ---~~i~~~~~~-----~~~~~~~~~~~~a~~~i~~~-~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l  451 (468)
                         ..+.+.+..     +....++.+.++.+..+... -...+.||+||+.   +|         ||..-.++|..|
T Consensus       398 ~~~~~~~~~~~~~e~~~~~~~~~f~~~~~l~~~L~~~~~~~~~~~~~vLvK---GS---------R~~~le~vv~~L  462 (462)
T TIGR01143       398 NTVAVIADSLGSGEKLVKKQGKHFADKDELLAFLKDLNELQVGEGDVVLVK---GS---------RSVKLEKVVEAL  462 (462)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCEEEEE---CC---------CHHHHHHHHHCC
T ss_conf             269999998558965046888751798899999875331125786089995---36---------423678998409


No 28 
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional
Probab=100.00  E-value=0  Score=370.58  Aligned_cols=329  Identities=19%  Similarity=0.219  Sum_probs=248.4

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCC----CCCCCCCCCCCCCCCEEEEECC-CCC--CC-CCCCCC
Q ss_conf             156886899603457521578999999873100000001----2443221101688837999217-754--32-122333
Q gi|254781099|r  109 SSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGN----IGLPILNLEYFSPNRFYVIECS-SYQ--IE-LTPTID  180 (468)
Q Consensus       109 ~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GN----iG~p~~~~~~~~~~~~~V~E~S-SfQ--L~-~~~~~~  180 (468)
                      ...+.||||||||||||||+.||+++|...+.-...-||    ||+|++.+....+++++|+||. |.+  ++ ++..++
T Consensus       106 ~~~~~~VIgITGSnGKTttKe~L~~iLs~~~~v~~T~gn~Nn~IGvPLTll~l~~~~e~aVlEmG~s~~GEI~~L~~i~~  185 (824)
T PRK11930        106 KQFDIPIIGITGSNGKTIVKEWLYQLLSPDYNIVRSPRSYNSQIGVPLSVWQMNEEHELGIFEAGISTMGEMEALQKIIK  185 (824)
T ss_pred             HHCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEECCCCCCCCCCCHHHHHHCCCCCCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             74899899994999789999999999745786852887668742589998649845808999907898146999953527


Q ss_pred             CCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEECCCCCCCC----CCCCEEE
Q ss_conf             221011100210122211100001122100010134432247867899987401234301103644322----2341121
Q gi|254781099|r  181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQ----SDSDLYI  256 (468)
Q Consensus       181 PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~  256 (468)
                      |+++|||||+++|+|.|+|+|+++++|.+||+..+..++|.||+...............+.+.......    .......
T Consensus       186 P~igVITNIg~aHle~fgS~e~ia~eK~eL~~~~~~~i~n~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  265 (824)
T PRK11930        186 PTIGILTNIGGAHQENFFDIQEKCMEKLKLFKDCDVIIYNGDNEEISNCIHKSNLTRREIAWSRTDSEAPLYISRSEKKE  265 (824)
T ss_pred             CCEEEEECCCHHHHHHCCCHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHCCCCCEEEEECCCCCCCEEEEEEEECC
T ss_conf             99999907509876645899999999999762178179946857899999763367628998347866534666543058


Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCH
Q ss_conf             24135414676421234558851011100110122210222221100000000134544332100343000002355675
Q gi|254781099|r  257 DESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL  336 (468)
Q Consensus       257 ~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp  336 (468)
                      +...+.....+......+|++|.||++|+++|++++..+|++++.|.++|++|+++++|||.....+|.++|||||+.||
T Consensus       266 ~~~~~~~~~~~~~~~~~lp~~G~h~v~NAlaA~ava~~lGv~~~~i~~~L~~~~p~~~Rlev~~g~~g~~iIdDsYNAnP  345 (824)
T PRK11930        266 FHTHIQYRYLGMDRYFQIPFIDDASIENSIHCLAVALYLMYSADQITKRFARLEPVEMRLEVKEGINNCTLINDSYNSDL  345 (824)
T ss_pred             CCEEEEEEECCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCEEEEEECCCCCEEEECCCCCCH
T ss_conf             81699999689069999369988999999999999998399999999998418965451379997998099956666998


Q ss_pred             HHHHHHHHCC-----CCCCEEEECCCCC-----CCCHHHHHHHHC--CCCEEEEECCCHHHHHHHHHCCCCEEEECCHHH
Q ss_conf             5555532013-----3320012032101-----220689899842--786899988998998886316898899879999
Q gi|254781099|r  337 HSVIHAFLNE-----KRRIYWIAGGLSK-----SDDFSTLFPFIS--KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ  404 (468)
Q Consensus       337 ~a~~~Al~~~-----~~~i~lI~GG~~K-----~~d~~~L~~~~~--~~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~~  404 (468)
                      +|+.+||+.+     .+|.++|||.+..     ..-+++.++.++  .+..++.+|+........+. ..+...+.+.++
T Consensus       346 ~Sm~aALdtL~~~~~~~RrI~ILgDMlElG~~~~~ly~~Vg~l~~~~~i~~ligiG~~~~~~~~~~~-~~~~~~~~~~~~  424 (824)
T PRK11930        346 ASLDIALDFLERRKQSKKKTLILSDILQSGQSPEELYRKVAQLISSAKINRVIGIGEEISSEAKKFE-GIEKYFFKDTEA  424 (824)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEECCHHHCCCCCHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHCC-CCCEEEECCHHH
T ss_conf             9999999999740357856999877443287607899999999997688789981889999998645-776589568999


Q ss_pred             HHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             9999999998448985999452216631347989999999999986379
Q gi|254781099|r  405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG  453 (468)
Q Consensus       405 a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~  453 (468)
                      .++....   ...++++||+.   -+         |..+|.+++..|..
T Consensus       425 ~l~~~~~---~~~~~~~iLik---Ga---------r~~~~e~i~~~l~~  458 (824)
T PRK11930        425 FLASLEK---KKFSNELILIK---GS---------RKFQFEQISERLEL  458 (824)
T ss_pred             HHHCCCC---CCCCCCEEEEE---CC---------CCCCHHHHHHHHHH
T ss_conf             9742741---13689779980---55---------45668999999964


No 29 
>COG0770 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=363.58  Aligned_cols=325  Identities=22%  Similarity=0.289  Sum_probs=248.0

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCC----CCCCCCCCCCCCCCCEEEEECC-CCC--C-CCCCCCCC
Q ss_conf             56886899603457521578999999873100000001----2443221101688837999217-754--3-21223332
Q gi|254781099|r  110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGN----IGLPILNLEYFSPNRFYVIECS-SYQ--I-ELTPTIDP  181 (468)
Q Consensus       110 ~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GN----iG~p~~~~~~~~~~~~~V~E~S-SfQ--L-~~~~~~~P  181 (468)
                      ..+.|+||||||+|||||++|+++||+..+.-....||    ||+|++.+....++|++|+||+ +++  + +.+...+|
T Consensus       100 ~~~~kvIaITGS~GKTTTKe~la~iL~~~~~v~~t~gn~Nn~iGlPltll~~~~~~e~~VlEmG~~~~GeI~~l~~i~~P  179 (451)
T COG0770         100 KFNAKVIAITGSNGKTTTKEMLAAILSTKGKVHATPGNFNNEIGLPLTLLRLPADTEYAVLEMGMNHPGEIAELSEIARP  179 (451)
T ss_pred             HCCCCEEEEECCCCCHHHHHHHHHHHHHCCEEECCCCCCCCCCCCHHHHHHCCCCCCEEEEECCCCCCCCHHHHHCCCCC
T ss_conf             36996899958997076999999998636807467876686544156897477766479998689977747888440589


Q ss_pred             CCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECC---CCCCCCCCHHHHHHHHHCCCCCCEEECCCCC---C-CCCCCCE
Q ss_conf             2101110021012221110000112210001013---4432247867899987401234301103644---3-2223411
Q gi|254781099|r  182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAYDMNFIGHSISRISSQ---S-LQSDSDL  254 (468)
Q Consensus       182 diavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~---~~iln~dd~~~~~~~~~~~~~~~~~~~~~~~---~-~~~~~~~  254 (468)
                      ++++||||+++||++|||.|+++++|.+|+.+..   .+++|.|++...........  ..+..++..   . ...+...
T Consensus       180 ~iavItnIg~aHle~fgs~e~Ia~aK~Ei~~~~~~~g~ai~n~d~~~~~~~~~~~~~--~~v~~fg~~~~~d~~~~~i~~  257 (451)
T COG0770         180 DIAVITNIGEAHLEGFGSREGIAEAKAEILAGLRPEGIAILNADNPLLKNWAAKIGN--AKVLSFGLNNGGDFRATNIHL  257 (451)
T ss_pred             CEEEECCHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHCCC--CCEEEECCCCCCCEEEEEEEE
T ss_conf             889983805999874288999999999998156878679987861777877763578--757997688777525677898


Q ss_pred             EECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCC
Q ss_conf             21241354146764212345588510111001101222102222211000000001345443321003430000023556
Q gi|254781099|r  255 YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKAT  334 (468)
Q Consensus       255 ~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~at  334 (468)
                      ......+............++++|+||+.|+++|+++|+.+|++.++|.++|+.+++++||+|.+...+|.++||||||.
T Consensus       258 ~~~~~~f~~~~~~~~~~~~l~~~G~hn~~NalaA~a~a~~lG~~~e~i~~~L~~~~~~~gR~~~~~~~~g~~iIdD~YNA  337 (451)
T COG0770         258 DEEGSSFTLDIEGGEAEFELPLPGRHNVTNALAAAALALELGLDLEEIAAGLKELKPVKGRLEVILLANGKTLIDDSYNA  337 (451)
T ss_pred             CCCCEEEEEEECCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEEEECCCCC
T ss_conf             38850799980683379994578476899999999999981999999999998637888663367648981899737889


Q ss_pred             CHHHHHHHHHCC---CCCC-EEEECCCCCCCC-----HHHHHHHHCC--CCEEEEECCCHHHHHHHHHCCCCEEEECCHH
Q ss_conf             755555532013---3320-012032101220-----6898998427--8689998899899888631689889987999
Q gi|254781099|r  335 NLHSVIHAFLNE---KRRI-YWIAGGLSKSDD-----FSTLFPFISK--IAKAYFIGNSAMLFFHHFGGKINSTLSKTLD  403 (468)
Q Consensus       335 np~a~~~Al~~~---~~~i-~lI~GG~~K~~d-----~~~L~~~~~~--~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~  403 (468)
                      ||+||.+|++.+   +++- ++|+|++..-++     ..++++.+..  ++.++++|+....+.+.++..  ..++.+-+
T Consensus       338 np~sm~aai~~l~~~~~~~~i~VlGdM~ELG~~s~~~H~~v~~~~~~~~~d~v~~~G~~~~~i~~~~~~~--~~~f~~~~  415 (451)
T COG0770         338 NPDSMRAALDLLAALPGRKGIAVLGDMLELGEESEELHEEVGEYAVEAGIDLVFLVGELSKAIAEALGNK--GIYFADKE  415 (451)
T ss_pred             CHHHHHHHHHHHHHCCCCCCEEEECCHHHHCCCHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHCCCC--EEECCCHH
T ss_conf             9899999999996376688579947766638548999999999998569509999762069999865777--58607779


Q ss_pred             HHHHHHHHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             99999999998448985999452216631347989999999999986379
Q gi|254781099|r  404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG  453 (468)
Q Consensus       404 ~a~~~i~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~  453 (468)
                      +....+.   ...++||+||+.   +|         ||..+.++|..|-+
T Consensus       416 ~l~~~l~---~~l~~gd~vLvK---gS---------r~~~le~vv~~l~~  450 (451)
T COG0770         416 ELITSLK---ALLRKGDVVLVK---GS---------RGMKLEKVVDALLG  450 (451)
T ss_pred             HHHHHHH---HHCCCCCEEEEE---CC---------CCCCHHHHHHHHHC
T ss_conf             9999999---856778789997---37---------64657999999831


No 30 
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase; InterPro: IPR005757    The tripeptide L-ananyl-gamma-D-glutamyl-meso-diaminopimelic acid is efficiently re-cycled during the formation of bacterial cell wall murein. UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase is an essential enzyme in this process which links the tripeptide to UDP-N-acetylmuramate.; GO: 0016874 ligase activity, 0007047 cell wall organization and biogenesis.
Probab=100.00  E-value=0  Score=348.82  Aligned_cols=404  Identities=19%  Similarity=0.190  Sum_probs=286.1

Q ss_pred             EEEEECCCHHHH-HHHHHHHHCCCEEEEEECC--CHHHHHHHHCCCEEECCCC-CCC-C-CCCEEEECCCCCCCCCCCCH
Q ss_conf             799983685489-9999999859869998189--6478899978989964531-572-2-58889988886856755788
Q gi|254781099|r   10 SIAVFGLGRSGL-SAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFRE-IPW-S-IISFLVLSPGIALTGENAHW   83 (468)
Q Consensus        10 ~v~i~G~G~sG~-s~A~~l~~~G~~V~~~D~~--~~~~~~l~~~g~~~~~~~~-~~~-~-~~d~vv~Spgi~~~~~~~~~   83 (468)
                      +|+|+||++|=| .+|.+.++.||+|+|||.+  ||+.+.||..||+++...+ ..+ . .+|++|+    .......+|
T Consensus         1 ~IHIlGIcGTFMGG~A~~A~~~G~~VtGsDa~vYPPMST~LE~~GIe~~~gfD~~QL~~~~pD~~vi----GNa~~RG~p   76 (459)
T TIGR01081         1 HIHILGICGTFMGGLAMLAKQLGHEVTGSDANVYPPMSTLLEAQGIEIIEGFDAAQLEPFKPDLVVI----GNAMKRGNP   76 (459)
T ss_pred             CEEEEEECHHHHHHHHHHHHHCCCEECCCCCCCCCCHHHHHHHCCCEEECCCCHHHCCCCCCCEEEE----CCCCCCCCH
T ss_conf             9589972513278999999874955701356558865688875573032277844400348887998----463316744


Q ss_pred             HHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHC-CCC----CCCCCCCCC----
Q ss_conf             89999976980998303422334301568868996034575215789999998731000-000----012443221----
Q gi|254781099|r   84 CVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDV-QLG----GNIGLPILN----  154 (468)
Q Consensus        84 ~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~-~~~----GNiG~p~~~----  154 (468)
                      ++++..+.++|.+|.++   ++......+.=|+||+||||||||++|++++|+.+|+++ +++    ||.|++.-.    
T Consensus        77 ~VE~vL~~nl~Y~SGPQ---WL~d~~L~drWVlaV~GTHGKTTT~~M~~WvLE~~G~~pGFliGGv~gNFgvSArLg~~p  153 (459)
T TIGR01081        77 CVEAVLEKNLPYTSGPQ---WLHDFVLRDRWVLAVAGTHGKTTTASMLAWVLEQCGLKPGFLIGGVPGNFGVSARLGETP  153 (459)
T ss_pred             HHHHHHHCCCCCCCCCC---HHHHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHCCCCCCCEECCCCCCCCEEEECCCCC
T ss_conf             67898726895021751---056334213427895078860468899999998637988726734245342142068775


Q ss_pred             -CCCCCCCCEEEEECCCC----CCCCCC--CCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEE---ECCCCCCCCCCH
Q ss_conf             -10168883799921775----432122--33322101110021012221110000112210001---013443224786
Q gi|254781099|r  155 -LEYFSPNRFYVIECSSY----QIELTP--TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDH  224 (468)
Q Consensus       155 -~~~~~~~~~~V~E~SSf----QL~~~~--~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~---~~~~~iln~dd~  224 (468)
                       .......+|+|+|+.-|    -=.+.+  +++|...|+.||+.||-|.|.+++.+.+-.-.+++   ..+..+.+..+.
T Consensus       154 r~dp~~~S~fFviEADEYD~AFFDKRSKFVHY~PRTlvlNNleFDHADIFddL~AI~~QFHhlvR~vP~~G~i~~~~~~~  233 (459)
T TIGR01081       154 RQDPNSQSPFFVIEADEYDTAFFDKRSKFVHYRPRTLVLNNLEFDHADIFDDLKAIQRQFHHLVRTVPGEGLILAPERDQ  233 (459)
T ss_pred             CCCCCCCCCEEEEECCCCCCCCCCCCCCEEECCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCEEECCCHHH
T ss_conf             66745468757995356565100254331202760014515554445578768998740306889646886484350146


Q ss_pred             HHHH-HHHHCCCCCCEEECCCCCCCCCCCCEEECCCEEE-ECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCC
Q ss_conf             7899-9874012343011036443222341121241354-1467642123455885101110011012221022222110
Q gi|254781099|r  225 QCEK-IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLK-CSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEI  302 (468)
Q Consensus       225 ~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i  302 (468)
                      ..+. +...+.............  . -..+..|...+. .....+.-...+.+.|.||..|+|+|||+|++.|+.++..
T Consensus       234 ~l~~~l~~GCWs~~e~~G~~~~W--~-A~~~~~D~S~f~Vll~G~~vg~VkW~lvG~HN~~NaL~aIAAArHvGV~~~~A  310 (459)
T TIGR01081       234 SLKDTLAKGCWSEQEFLGEQGEW--Q-AEKITADASEFEVLLDGEKVGEVKWSLVGEHNMHNALMAIAAARHVGVAIEDA  310 (459)
T ss_pred             HHHHHHHHCCCCCHHCCCCCCCH--H-HHHHCCCCHHHHHHHCCCEEEEEEEEECCCCCHHHHHHHHHHHHCCCCCHHHH
T ss_conf             89999860687201124677750--5-76540451000220178436776533304600135899998742167687899


Q ss_pred             HHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCC------CCCEEEECCC---CC-CCCHHHHHHHHCC
Q ss_conf             000000013454433210034300000235567555555320133------3200120321---01-2206898998427
Q gi|254781099|r  303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK------RRIYWIAGGL---SK-SDDFSTLFPFISK  372 (468)
Q Consensus       303 ~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~------~~i~lI~GG~---~K-~~d~~~L~~~~~~  372 (468)
                      .++|-.|..++||||..++.||+++||| +||-|.|..+.|..+.      .||+.+|==+   -| |.-+..|...+.+
T Consensus       311 c~ALG~F~N~kRRlE~kG~~Ng~TVYDD-FAHHP~AI~~Tl~~LR~kVGG~~rIlAVLEPRSnTMKlG~~K~~la~sL~~  389 (459)
T TIGR01081       311 CEALGSFVNAKRRLELKGEANGVTVYDD-FAHHPTAIEATLAALRDKVGGGARILAVLEPRSNTMKLGVHKDDLAPSLGR  389 (459)
T ss_pred             HHHHCCCCCCCEEEEEEEEEEEEEEECC-CCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             9870320012001567211313787327-667868999999998752399706999877874410034325566676660


Q ss_pred             CCEEEEEC-CCHHHHHHHHHC--CCCEEEECCHHHHHHHHHHHHHHCCCCCEEE-ECCC
Q ss_conf             86899988-998998886316--8988998799999999999998448985999-4522
Q gi|254781099|r  373 IAKAYFIG-NSAMLFFHHFGG--KINSTLSKTLDQALKSVVRDVENVQLPSIVL-FSPG  427 (468)
Q Consensus       373 ~~~~~liG-~~~~~i~~~~~~--~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVL-lSPa  427 (468)
                      .+.++++- +.-+.-.+....  .-+..+..++|.-+..|.   +.+++||-|| +|-|
T Consensus       390 AD~Vf~~~p~~~~W~V~e~~~~~~~p~~~~~~~D~~v~~iv---k~A~~gD~ILVMSNG  445 (459)
T TIGR01081       390 ADEVFLLQPEQIPWEVAEVAEQCVQPANVSADLDELVAMIV---KEAQPGDHILVMSNG  445 (459)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHH---HHCCCCCEEEEEECC
T ss_conf             03565316898870599999860240211010789999999---605888758997468


No 31 
>COG0769 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=1e-41  Score=307.07  Aligned_cols=321  Identities=19%  Similarity=0.212  Sum_probs=217.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCC---------------------CCCCCCCCCCEEEEECC
Q ss_conf             688689960345752157899999987310000000124432---------------------21101688837999217
Q gi|254781099|r  111 LQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPI---------------------LNLEYFSPNRFYVIECS  169 (468)
Q Consensus       111 ~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~GNiG~p~---------------------~~~~~~~~~~~~V~E~S  169 (468)
                      .+.++|+||||||||||++|+.++++..|+++.+.|.+|.-+                     +.-......++.|+|+|
T Consensus        89 ~~l~vigvTGTNgKTt~t~~~~~~~~~~g~~~~~~gT~g~~~~~~~~~~~~~tTP~~~~l~~~~~~~~d~~~e~~vmEvs  168 (475)
T COG0769          89 GKLKVIGVTGTNGKTTTTSLLAQILKKLGKKTALIGTEGDELSPGILEPTGLTTPEALDLQNLLRDLLDRGAEIAVMEVS  168 (475)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEC
T ss_conf             78518986387857999999999988629825899977663268863456678921789999999999738809998850


Q ss_pred             CCCC--CCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEE---ECCCCCCCCCCHHHHHHHHHCCCCCCEEECCC
Q ss_conf             7543--212233322101110021012221110000112210001---01344322478678999874012343011036
Q gi|254781099|r  170 SYQI--ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMNFIGHSISRIS  244 (468)
Q Consensus       170 SfQL--~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~---~~~~~iln~dd~~~~~~~~~~~~~~~~~~~~~  244 (468)
                      |+-|  .+......+++++||+++||||+|++||+|..+|..+|.   ..+..++|.||++..............+..++
T Consensus       169 sh~l~~~Rv~~~~f~v~~ftnls~DHlD~h~t~e~Y~~aK~~lf~~~~~~~~~Vin~dd~~~~~~~~~~~~~~~~~~~~~  248 (475)
T COG0769         169 SHGLVQGRVEGVTFDVGVFTNLSRDHLDYHGTMEYYGAAKAVLFESLPHSGEAVINPDDGHGLDYKERLKNALGDYITYG  248 (475)
T ss_pred             HHHHHHCCCCCCEEEEECCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCHHHHHHHHHHHCCCCEEEEC
T ss_conf             34797578656359886456656666523574999998898776405788747987788038889999985688789968


Q ss_pred             CCCCCCC-----CCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHH
Q ss_conf             4432223-----41121241354146764212345588510111001101222102222211000000001345443321
Q gi|254781099|r  245 SQSLQSD-----SDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTI  319 (468)
Q Consensus       245 ~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i  319 (468)
                      .......     ......................++++|.||++|+|+|++++..+|+|.+.|.++|++|+|++||||.+
T Consensus       249 ~~~~~~~~~~~~i~~~~~g~~~~~~~~~~~~~~~~~L~G~fNv~NaLaA~a~~~~lG~~~e~i~~~l~~~~~v~GRmE~v  328 (475)
T COG0769         249 CDFKRPDLDYRGIEESSSGSDFVFEPSGGIGEYELPLPGLFNVYNALAAVAAALALGVDLEDILAGLETLKPVPGRMELV  328 (475)
T ss_pred             CCCCCCCHHHCCCEEEECCCEEEEECCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             89963121222611421354058863787326860412277899999999999874999999999997468999860687


Q ss_pred             CCCCCCEEECCCCCCCHHHHHHHHHCCC----CCCEEEEC-CCCCCCCHHHH-HHHHCCCCEEEEE------CCCHHHHH
Q ss_conf             0034300000235567555555320133----32001203-21012206898-9984278689998------89989988
Q gi|254781099|r  320 ARLGHVIFINDSKATNLHSVIHAFLNEK----RRIYWIAG-GLSKSDDFSTL-FPFISKIAKAYFI------GNSAMLFF  387 (468)
Q Consensus       320 ~~~~gv~iIDDS~atnp~a~~~Al~~~~----~~i~lI~G-G~~K~~d~~~L-~~~~~~~~~~~li------G~~~~~i~  387 (468)
                      .. ++..++.| |||||++..++|....    ++++++.| |-||+..++++ .....+..+.+++      +++...+.
T Consensus       329 ~~-~~~~v~VD-yAHnPd~le~~L~~~~~~~~g~li~VfG~gGDrD~~kr~~mg~ia~~~ad~vivt~dnpR~edp~~i~  406 (475)
T COG0769         329 NI-GGKLVIVD-YAHNPDGLEKALRAVRLHAAGRLIVVFGCGGDRDKSKRPDMGAIAEQLADIVIVTSDNPRSEDPAVIL  406 (475)
T ss_pred             CC-CCCEEEEE-ECCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEECCCCCCCCCHHHHH
T ss_conf             38-99769999-53486999999999875349848999776688753430315999985599369918998876889999


Q ss_pred             HHHHCCCCEEE-ECCHHHHHHHHHHHHHHCCCCCEEE-ECCCCCCCCC
Q ss_conf             86316898899-8799999999999998448985999-4522166313
Q gi|254781099|r  388 HHFGGKINSTL-SKTLDQALKSVVRDVENVQLPSIVL-FSPGCASFDQ  433 (468)
Q Consensus       388 ~~~~~~~~~~~-~~~~~~a~~~i~~~~~~~~~gDiVL-lSPa~aS~d~  433 (468)
                      +.+...+.... +....+..+++.++...++++|+|| .-.|+..+=.
T Consensus       407 ~~i~~g~~~~~~~~~~~dr~~AI~~ai~~a~~~D~vliagkGhe~yq~  454 (475)
T COG0769         407 ADILAGIEAPEKYEIIEDREEAIRKALDLAKEGDVVLIAGKGHETYQI  454 (475)
T ss_pred             HHHHHCCCCCCCEEECHHHHHHHHHHHHHHCCCCEEEEEEECCHHHHH
T ss_conf             999836476641430110999999999863248878996423513563


No 32 
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810    Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria. The polymer has a backbone of L-aspartic acid, with most Asp side chain carboxyl groups attached to L-arginine. The polymer is made by this enzyme, cyanophycin synthetase, and degraded by cyanophycinase. Heterologously expressed cyanophycin synthetase in Escherichia coli produces a closely related, water-soluble polymer with some Arg replaced by Lys. It is unclear whether enzymes that produce soluble cyanophycin-like polymers in vivo in non-Cyanobacterial species should be designated as cyanophycin synthetase itself or as a related enzyme. Cyanophycin synthesis is analogous to polyhydroxyalkanoic acid (PHA) biosynthesis, except that PHA polymers lack nitrogen and may be made under nitrogen-limiting conditions .; GO: 0005524 ATP binding, 0016874 ligase activity, 0009059 macromolecule biosynthetic process.
Probab=100.00  E-value=2.9e-35  Score=262.50  Aligned_cols=345  Identities=21%  Similarity=0.277  Sum_probs=232.1

Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCC---C-
Q ss_conf             888685675578889999976980998303422334301568868996034575215789999998731000000---0-
Q gi|254781099|r   71 SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLG---G-  146 (468)
Q Consensus        71 Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~---G-  146 (468)
                      |||+..+..   |.-=..|+-+.+|++-+  |.   +......|||+||||||||||+.|++|||+..|+.+.+.   | 
T Consensus       454 aPGlrMH~~---PS~G~pR~Va~Ai~d~L--FP---~~~~grIPiV~vTGTNGKTt~~RL~Ahil~~~G~~vG~T~tDG~  525 (876)
T TIGR02068       454 APGLRMHLA---PSQGKPRNVAKAIVDML--FP---EEDDGRIPIVAVTGTNGKTTTTRLVAHILKQTGKVVGMTTTDGV  525 (876)
T ss_pred             CCCHHHCCC---CCCCCCCCCCHHHHHHC--CC---CCCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCE
T ss_conf             766344467---77746987102687522--88---87898344888726898355788999999856982764203767


Q ss_pred             -----------CCCCCCC--CCCCCCCCCEEEEECCCCCC--CCCCCCCCCCCEEEEEC-CCHHHHH--HHHHHCCCCCC
Q ss_conf             -----------1244322--11016888379992177543--21223332210111002-1012221--11000011221
Q gi|254781099|r  147 -----------NIGLPIL--NLEYFSPNRFYVIECSSYQI--ELTPTIDPSIGVLLNIS-PDHLDRH--HTLENYVNIKK  208 (468)
Q Consensus       147 -----------NiG~p~~--~~~~~~~~~~~V~E~SSfQL--~~~~~~~PdiavITNI~-~DHLd~~--~s~e~y~~aK~  208 (468)
                                 |-| |.+  .+..++.-|.+|+|-.+=.+  +..-+=++++||||||+ .|||...  .++|..+..|.
T Consensus       526 Yi~~~~v~~GDntG-P~SAr~~L~d~~VdaAVLEtarGGiLR~GLafD~c~VGvVtNi~~~DHLG~~dInt~e~La~Vk~  604 (876)
T TIGR02068       526 YIGKKLVEKGDNTG-PKSARRILADPTVDAAVLETARGGILREGLAFDRCDVGVVTNIADGDHLGLGDINTIEDLADVKR  604 (876)
T ss_pred             EECCEEEECCCCCC-HHHHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHEE
T ss_conf             75576662478987-15730122788801899862787220665010321416898337766357886004788875101


Q ss_pred             CEEE---ECCCCCCCCCCHHHHHHHHHCCCCCCEEECCCCCCC------CCCCCEEECCCEEEECCCC-CCCCC---CCC
Q ss_conf             0001---013443224786789998740123430110364432------2234112124135414676-42123---455
Q gi|254781099|r  209 KIVT---MSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSL------QSDSDLYIDESFLKCSATS-EVIFD---FSQ  275 (468)
Q Consensus       209 ~i~~---~~~~~iln~dd~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~-~~~~~---~~~  275 (468)
                      -+.+   ..+.+|||.+||....|++.++-....+.-......      ....-.|.+++.+...... .....   ..|
T Consensus       605 vv~e~V~pDG~AVLNA~DP~va~mA~~~~G~i~YF~~~~~~~~~~~H~~~G~~avy~~~G~ivia~G~~~~~~~~~~~iP  684 (876)
T TIGR02068       605 VVVEVVKPDGYAVLNADDPMVAAMAEKCKGKIAYFSMDPNNPTVAKHIAKGGRAVYYENGYIVIAKGGAEVAIARIAEIP  684 (876)
T ss_pred             EEEEEECCCCCEEECCCCCHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCEEEEEECCEEEEEECCCCHHHHHHHHCC
T ss_conf             26788858982786478855799984289618986218625899999855989999867879997478322678997288


Q ss_pred             CC----CCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHH----HHHHHHHHCCCCCCEEECCCCCCCHHHH---HHHHH
Q ss_conf             88----5101110011012221022222110000000013----4544332100343000002355675555---55320
Q gi|254781099|r  276 ET----KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGG----LTHRLQTIARLGHVIFINDSKATNLHSV---IHAFL  344 (468)
Q Consensus       276 l~----G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~g----v~~R~E~i~~~~gv~iIDDS~atnp~a~---~~Al~  344 (468)
                      +.    -.|+++|+|||+++|..++||++.|+++|++|..    -|+||.. .+.++..++=| |+|||+|.   .+|++
T Consensus       685 lT~GG~~~F~ieN~LAA~aAA~~~~v~ie~Ir~G~~tF~~d~~~~PGrfnL-Fn~~~~~~lvD-Y~HNp~~~~av~~a~~  762 (876)
T TIGR02068       685 LTMGGRVAFQIENALAAVAAAWALGVDIELIRAGIRTFKADAAQAPGRFNL-FNLGGAHVLVD-YGHNPAAIEAVVEAIR  762 (876)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCHHHCCCCEEEE-EECCCCEEEEE-CCCCHHHHHHHHHHHH
T ss_conf             675771578888999999998534898999998987330101068950322-22588289996-5779789999999996


Q ss_pred             CCC--CCCEEEEC-CCCCCCCHHHHHHHHCCC-CEEEEE-----------CCCHHHHHHHHHCCC-CEEEECCHHHHHHH
Q ss_conf             133--32001203-210122068989984278-689998-----------899899888631689-88998799999999
Q gi|254781099|r  345 NEK--RRIYWIAG-GLSKSDDFSTLFPFISKI-AKAYFI-----------GNSAMLFFHHFGGKI-NSTLSKTLDQALKS  408 (468)
Q Consensus       345 ~~~--~~i~lI~G-G~~K~~d~~~L~~~~~~~-~~~~li-----------G~~~~~i~~~~~~~~-~~~~~~~~~~a~~~  408 (468)
                      +++  +++.+|-| |+-+..|+..+++.+... +.+++.           |+-...+.+.+.... +...+...-+-.++
T Consensus       763 ~~~A~rr~gV~ggpGDR~De~l~~~G~~~g~~FD~i~~keD~~~rGkR~~G~a~~Ll~~G~~~~~~~~~~i~~i~de~~A  842 (876)
T TIGR02068       763 NLPARRRIGVIGGPGDRRDEDLVKLGEILGGAFDQIILKEDDDLRGKRARGEAAALLRQGLIQAAMRKAAIEEILDETEA  842 (876)
T ss_pred             HCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             17878478998078778658899999997540687999627453578887358999996353057765679999889999


Q ss_pred             HHHHHHHCCCCCEEEECC
Q ss_conf             999998448985999452
Q gi|254781099|r  409 VVRDVENVQLPSIVLFSP  426 (468)
Q Consensus       409 i~~~~~~~~~gDiVLlSP  426 (468)
                      +.++.+.+.+||.||+=|
T Consensus       843 i~~~L~~~~~GdL~vi~~  860 (876)
T TIGR02068       843 IKAALDSLEAGDLVVILP  860 (876)
T ss_pred             HHHHHHHCCCCCEEEEEC
T ss_conf             999984214688699970


No 33 
>pfam08245 Mur_ligase_M Mur ligase middle domain.
Probab=99.98  E-value=3.1e-33  Score=248.47  Aligned_cols=175  Identities=28%  Similarity=0.338  Sum_probs=128.6

Q ss_pred             EECCCCCCHHHHHHHHHHHHHHHHCCCCCC----CCCCCCCCCC-CCCCCEEEEECCCCCCCC---CCCCCCCCCEEEEE
Q ss_conf             603457521578999999873100000001----2443221101-688837999217754321---22333221011100
Q gi|254781099|r  118 VTGTNGKSSTVALISHVLRKNGYDVQLGGN----IGLPILNLEY-FSPNRFYVIECSSYQIEL---TPTIDPSIGVLLNI  189 (468)
Q Consensus       118 VTGT~GKTTt~~ll~~iL~~~g~~~~~~GN----iG~p~~~~~~-~~~~~~~V~E~SSfQL~~---~~~~~PdiavITNI  189 (468)
                      ||||||||||++||++||+.+|+++.+.||    ||+|+..... ..+.+++|+|+||+++..   ...++|+++|||||
T Consensus         1 VTGT~GKTTt~~ml~~iL~~~g~~~~~~g~~~~~ig~~~~~~~~~~~~~~~~V~E~~~~~~~~~~l~~~~~P~iaviTNi   80 (188)
T pfam08245         1 ITGTNGKTTTTELIAALLSAAGGVVGTGGNTNNAIGLPLLLALMERKGADYAVLELSSFGLGEGRLEGLAKPDIAVITNI   80 (188)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHCCCCCCCEEEEECC
T ss_conf             93758689999999999983899899838847457799999766646996899983277710765527778999999457


Q ss_pred             CCCHHHHHHHHHHCCCCCCCEEEECC---CCCCCCCCHHHHHHHHHCCCCCCEEECCCCCCCCCCC-CEEECCC-EEEEC
Q ss_conf             21012221110000112210001013---4432247867899987401234301103644322234-1121241-35414
Q gi|254781099|r  190 SPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDS-DLYIDES-FLKCS  264 (468)
Q Consensus       190 ~~DHLd~~~s~e~y~~aK~~i~~~~~---~~iln~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~-~~~~~  264 (468)
                      ++||||+|+++|+|+++|.+|+++.+   .+|+|.||+....+..........+............ .....+. +....
T Consensus        81 ~~DHld~~~s~e~~~~~K~~i~~~~~~~g~~v~n~Dd~~~~~~~~~~~~~~~t~g~~~~~d~~~~~i~~~~~~~~~~~~~  160 (188)
T pfam08245        81 SPDHLDYHGTMENYAAAKAEIFEGLPEDGIAVINADDPELAKRLKNAGAKVITFGLENEADDRAANIYVSSEGGKIVLFT  160 (188)
T ss_pred             HHHHHHHHCCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHCCCCEEEEECCCCCCEEEEEEEECCCCCEEEEEE
T ss_conf             65564662179999999999997299999999989888899999866984699856876560446789958996899996


Q ss_pred             CCCCCCCCCCCCCCCHHHHHCCCHHHHH
Q ss_conf             6764212345588510111001101222
Q gi|254781099|r  265 ATSEVIFDFSQETKKHNIQNLVTSAVVC  292 (468)
Q Consensus       265 ~~~~~~~~~~~l~G~HNi~NalaAia~a  292 (468)
                      .........++++|+||++|+++|+++|
T Consensus       161 ~~~~~~~~~l~l~G~HNv~NalaAia~A  188 (188)
T pfam08245       161 VPGGELEISLPLPGRHNVYNALAALAAA  188 (188)
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHC
T ss_conf             2993899998866399999999999959


No 34 
>PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional
Probab=99.95  E-value=2.7e-26  Score=200.60  Aligned_cols=327  Identities=17%  Similarity=0.202  Sum_probs=194.8

Q ss_pred             CCCHHHHHHHHC---CCEE-EEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC-------C-
Q ss_conf             578889999976---9809-983034223343015688689960345752157899999987310000000-------1-
Q gi|254781099|r   80 NAHWCVKLANQF---NVEI-IGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGG-------N-  147 (468)
Q Consensus        80 ~~~~~~~~a~~~---gi~v-~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~G-------N-  147 (468)
                      ..+.++....+.   +|.. +.++.-.+..+.......|+|-|+|||||.||++||+++|+++|++|.+--       | 
T Consensus        12 ~l~~wl~~l~~l~~~~i~lgL~ri~~ll~~lg~p~~~~~~IhVaGTNGKGSt~~~l~~il~~~G~~vG~ftSPHl~~~~E   91 (416)
T PRK10846         12 PLASWLSYLENLHSKTIDLGLERVSQVAARLDVLKPAPFVFTVAGTNGKGTTCRTLESILMAAGYRVGVYSSPHLVRYTE   91 (416)
T ss_pred             CHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCEECCCCCCCEEE
T ss_conf             89999999997489988698599999999729986579989996885579999999999998799730778886795101


Q ss_pred             ---C-CCCCCC-------------------------------CCCCCCCCEEEEECC-CCCCCCCCCCCCCCCEEEEECC
Q ss_conf             ---2-443221-------------------------------101688837999217-7543212233322101110021
Q gi|254781099|r  148 ---I-GLPILN-------------------------------LEYFSPNRFYVIECS-SYQIELTPTIDPSIGVLLNISP  191 (468)
Q Consensus       148 ---i-G~p~~~-------------------------------~~~~~~~~~~V~E~S-SfQL~~~~~~~PdiavITNI~~  191 (468)
                         | |.|+++                               .-...+.|++|+|+. --.||.++.+.|+++|||||+.
T Consensus        92 Ri~ing~~Is~~~~~~~~~~v~~~~~~~~lT~FE~~T~~A~~~F~~~~vD~aVlEvGLGGrlDATNvi~~~vsvIT~Igl  171 (416)
T PRK10846         92 RVRVQGQELPESAHTASFAEIEAARGDISLTYFEYGTLSALWLFKQAQLDVVILEVGLGGRLDATNIVDADVAVITSIAL  171 (416)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCEEEHHHCCCCCCEEEECCCCH
T ss_conf             56799912898999999999887506888769999999999999856999899983575134321388887799887047


Q ss_pred             CHHHHHH-HHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCC
Q ss_conf             0122211-100001122100010134432247867899987401234301103644322234112124135414676421
Q gi|254781099|r  192 DHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVI  270 (468)
Q Consensus       192 DHLd~~~-s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  270 (468)
                      ||.|+.| |+|+++.+|..|++...+.++...+ ....+................     +..+......+.+.... ..
T Consensus       172 DH~~~LG~Tle~IA~EKAGIik~g~pvV~g~~~-~~~~i~~~a~~~~a~l~~~~~-----d~~~~~~~~~~~~~~~~-~~  244 (416)
T PRK10846        172 DHTDWLGPDRESIGREKAGIFRSEKPAVVGEPE-MPSTIADVAQEKGALLQRRGV-----DWNYSVTDHDWAFSDGD-GT  244 (416)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHCCCCEEECCC-----CEEEEECCCEEEEECCC-CC
T ss_conf             642001799999999875342279808985853-789999999970997798178-----40798538737997588-62


Q ss_pred             CCCCCCCCCHHHHHCCCHHHHHHCCCC--CCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHH---HHC
Q ss_conf             234558851011100110122210222--221100000000134544332100343000002355675555553---201
Q gi|254781099|r  271 FDFSQETKKHNIQNLVTSAVVCMQLGL--KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA---FLN  345 (468)
Q Consensus       271 ~~~~~l~G~HNi~NalaAia~a~~lGi--~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~A---l~~  345 (468)
                      ...++++ .+...|+..|+++...++.  +.+.+.++|++.. .|||||.+. .+...++|  -||||+++.+-   |+.
T Consensus       245 ~~~l~l~-~~~~~Naa~Al~al~~~~~~i~~~~i~~gL~~~~-wpGR~e~i~-~~p~iiLD--gAHN~~aa~~L~~~l~~  319 (416)
T PRK10846        245 LENLPLP-NVPQPNAATALAALRASGLEVSENAIRDGIASAI-LPGRFQIVS-ESPRVIFD--VAHNPHAAEYLTGRLKA  319 (416)
T ss_pred             CCCCCCC-HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCC-CCCCEEEEC-CCCCEEEE--CCCCHHHHHHHHHHHHH
T ss_conf             5248886-5799999999999997399999999999998577-787512414-79857777--78599999999999996


Q ss_pred             C--CCCCEEEECCCCCCCCHHHHHHHHCCC-CEEEEEC------CCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHC
Q ss_conf             3--332001203210122068989984278-6899988------998998886316898899879999999999999844
Q gi|254781099|r  346 E--KRRIYWIAGGLSKSDDFSTLFPFISKI-AKAYFIG------NSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENV  416 (468)
Q Consensus       346 ~--~~~i~lI~GG~~K~~d~~~L~~~~~~~-~~~~liG------~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~  416 (468)
                      .  .+++++|+| ..++.|+..+.+.+... ..++++.      .+.+.+.+.+..   ...+.+..+|.+.+.   ..+
T Consensus       320 ~~~~~k~~~V~g-~l~dKD~~~~l~~L~~~~d~~~~~~~~~~Ra~~~~~L~~~l~~---~~~~~~~~~A~~~al---~~a  392 (416)
T PRK10846        320 LPKNGRVLAVIG-MLHDKDIAGTLAWLKSVVDDWYCAPLEGPRGATAEQLLEHLGN---GKSFDSVAQAWDAAM---ADA  392 (416)
T ss_pred             CCCCCCEEEEEE-CCCCCCHHHHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHC---CCCCCCHHHHHHHHH---HHC
T ss_conf             077996899984-1378999999998664468999958999777999999998602---766699999999999---847


Q ss_pred             CCCCEEEEC
Q ss_conf             898599945
Q gi|254781099|r  417 QLPSIVLFS  425 (468)
Q Consensus       417 ~~gDiVLlS  425 (468)
                      +++|+||.-
T Consensus       393 ~~~d~IlV~  401 (416)
T PRK10846        393 KPEDTVLVC  401 (416)
T ss_pred             CCCCEEEEE
T ss_conf             999859997


No 35 
>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism]
Probab=99.94  E-value=1.7e-25  Score=195.02  Aligned_cols=304  Identities=22%  Similarity=0.272  Sum_probs=193.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC-------C----C-CCCCCC------------------------
Q ss_conf             688689960345752157899999987310000000-------1----2-443221------------------------
Q gi|254781099|r  111 LQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGG-------N----I-GLPILN------------------------  154 (468)
Q Consensus       111 ~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~G-------N----i-G~p~~~------------------------  154 (468)
                      ...|+|-|+|||||.||++|+.+||.++|+++..--       |    | |.|+++                        
T Consensus        42 ~~~~vIhVaGTNGKGSt~afl~siL~~aG~~VG~yTSPHL~~~~ERI~ing~~Isd~~~~~~~~~ve~~~~~~~~~~~T~  121 (427)
T COG0285          42 KSPPVIHVAGTNGKGSTCAFLESILREAGYKVGVYTSPHLLSFNERIRINGEPISDEELAAAFERVEEAAGSLDLISLTY  121 (427)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEECCCCCCCCCEEEEECCEECCHHHHHHHHHHHHHHHCCCCCCCCCH
T ss_conf             14986999378984249999999999759871467887607642179999998889999999999999752366678747


Q ss_pred             ----------CCCCCCCCEEEEECC-CCCCCCCCCCCCCCCEEEEECCCHHHHHH-HHHHCCCCCCCEEEECCCCCCCC-
Q ss_conf             ----------101688837999217-75432122333221011100210122211-10000112210001013443224-
Q gi|254781099|r  155 ----------LEYFSPNRFYVIECS-SYQIELTPTIDPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICI-  221 (468)
Q Consensus       155 ----------~~~~~~~~~~V~E~S-SfQL~~~~~~~PdiavITNI~~DHLd~~~-s~e~y~~aK~~i~~~~~~~iln~-  221 (468)
                                .-...+.|++|+|+. -=.||.++.+.|.++|||+|+-||.++.| |+|.++..|+.|++...+.++.. 
T Consensus       122 FE~~Ta~Af~~F~~~~vD~aIlEVGLGGRlDATNVi~p~vsvIT~I~lDH~~~LG~tie~IA~EKAGI~k~g~P~v~~~~  201 (427)
T COG0285         122 FEVLTAMAFLYFAEAKVDVAILEVGLGGRLDATNVIEPDVSVITSIGLDHTAFLGDTLESIAREKAGIIKAGKPAVIGEQ  201 (427)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHCCCCCEEEECCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCEEECCC
T ss_conf             99999999999976899989996055666443221687668976647257888686699999986401257995798888


Q ss_pred             CCHHHHHH-HHHCCCCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCH-HHHHCCCHHHHHHCCC--C
Q ss_conf             78678999-874012343011036443222341121241354146764212345588510-1110011012221022--2
Q gi|254781099|r  222 NDHQCEKI-AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKH-NIQNLVTSAVVCMQLG--L  297 (468)
Q Consensus       222 dd~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~H-Ni~NalaAia~a~~lG--i  297 (468)
                      +.|..... .......................     +..+............++++|.| ++.||..|++++..++  +
T Consensus       202 ~~p~a~~vi~~~a~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~lp~l~~~~Q~~NAa~Ai~al~~l~~~i  276 (427)
T COG0285         202 QPPEALNVIAERAEELGAPLFVLGPDFQVLEE-----GNGFSFQGGGGLLDLPLPLLGGHHQIENAALAIAALEALGKEI  276 (427)
T ss_pred             CCHHHHHHHHHHHHHCCCCEEECCCCHHHCCC-----CCEEEEECCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             98789999999987518974651733221046-----5268873377045541665663057888999999999831428


Q ss_pred             CCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHH---HHCCCC--C-CEEEECCCCCCCCHHHHHHHHC
Q ss_conf             221100000000134544332100343000002355675555553---201333--2-0012032101220689899842
Q gi|254781099|r  298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA---FLNEKR--R-IYWIAGGLSKSDDFSTLFPFIS  371 (468)
Q Consensus       298 ~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~A---l~~~~~--~-i~lI~GG~~K~~d~~~L~~~~~  371 (468)
                      +.+.|.++|++-. .|||||.+. .+...++|-  ||||+|+.+-   |.....  + +++|.|.. ++.|...+.+.+.
T Consensus       277 ~~~~i~~gl~~~~-wpGR~e~l~-~~p~i~lDg--AHNp~aa~~La~~l~~~~~~~~~~~~v~g~l-~dKd~~~~l~~L~  351 (427)
T COG0285         277 SEEAIRKGLANVD-WPGRLERLS-ENPLILLDG--AHNPHAARALAETLKTLFNDRPRLTLVFGML-KDKDIAGMLAALL  351 (427)
T ss_pred             CHHHHHHHHHHCC-CCCEEEEEC-CCCEEEEEC--CCCHHHHHHHHHHHHHHHCCCCCEEEEEEEE-CCCCHHHHHHHHH
T ss_conf             8999999998676-873378833-797499988--8999999999999997733577528999832-5888899999740


Q ss_pred             CC-CEEEEEC------CCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCCCCCC
Q ss_conf             78-6899988------998998886316898899879999999999999844898599945221663
Q gi|254781099|r  372 KI-AKAYFIG------NSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASF  431 (468)
Q Consensus       372 ~~-~~~~liG------~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa~aS~  431 (468)
                      .. ..+++..      .+.+.+.+......... ..+.+++++.+...   ..+.|.||.-   -||
T Consensus       352 ~~~~~~~~~~~~~~ra~~~~~l~~~~~~~~~~~-~~~~~~a~~~~~~~---~~~~~~ilV~---GSl  411 (427)
T COG0285         352 PIVDEIYTTPLPWPRALDAEELLAFAGERGGVE-LDDVAEALELALEK---ADEDDLVLVT---GSL  411 (427)
T ss_pred             CCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCC-HHHHHHHHHHHHHH---CCCCCEEEEE---ECH
T ss_conf             647689982589735489999999987635785-00399999999971---5799749998---239


No 36 
>TIGR01499 folC FolC bifunctional protein; InterPro: IPR001645   Folylpolyglutamate synthase 6.3.2.17 from EC (FPGS) is responsible for the addition of a polyglutamate tail to folate and folate derivatives, is an ATP-dependent enzyme isolated from eukaryotic and bacterial sources, where it plays a key role in the retention of the intracellular folate pool Its sequence is moderately conserved between prokaryotes (gene folC) and eukaryotes.   FPGS belongs to a protein family that contains a number of related peptidoglycan synthetases (Mur) 6.3.2. from EC (see ).   A crystal structure of the MgATP complex of the enzyme from Lactobacillus casei reveals that folylpolyglutamate synthetase is a modular protein consisting of two domains, one with a typical mononucleotide-binding fold and the other strikingly similar to the folate-binding enzyme dihydrofolate reductase. The active site of the enzyme is located in a large interdomain cleft adjacent to an ATP-binding P-loop motif. Opposite this site, in the C domain, a cavity likely to be the folate binding site has been identified, and inspection of this cavity and the surrounding protein structure suggests that the glutamate tail of the substrate may project into the active site. A further feature of the structure is a well defined Omega loop, which contributes both to the active site and to interdomain interactions .; GO: 0004326 tetrahydrofolylpolyglutamate synthase activity, 0005524 ATP binding, 0009396 folic acid and derivative biosynthetic process.
Probab=99.91  E-value=2.9e-24  Score=186.59  Aligned_cols=258  Identities=22%  Similarity=0.240  Sum_probs=178.3

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHH-HHHHHHCCCCC-------C--C---CCCCCC-------------------------
Q ss_conf             86899603457521578999999-87310000000-------1--2---443221-------------------------
Q gi|254781099|r  113 SPFIAVTGTNGKSSTVALISHVL-RKNGYDVQLGG-------N--I---GLPILN-------------------------  154 (468)
Q Consensus       113 ~~vI~VTGT~GKTTt~~ll~~iL-~~~g~~~~~~G-------N--i---G~p~~~-------------------------  154 (468)
                      .|+|=|+|||||-||++||.+|| +.+|++|..-=       |  |   |.|+.+                         
T Consensus        21 ~~~IHVaGTNGKGST~a~l~~iL~~~~G~~VG~fTSPHl~~f~ERI~~nG~~i~d~~~~~~~~~~~~~~~~~~~~~~~~~  100 (460)
T TIGR01499        21 LPVIHVAGTNGKGSTCAFLESILREAAGYKVGLFTSPHLVSFNERIRVNGEPISDEELAQAFEQVRPILKKLSQETEYSQ  100 (460)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHCCCEEEEEECCEEEEEEEEEEECCEECCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             97799972068758999999998875397788887373874223478988576889999999999998753310135877


Q ss_pred             -------------CCCC-CCCCEEEEECC-CCCCCCCCCCC-CCCCEEEEECCCHHHHHH-HHHHCCCCCCCEEEECCCC
Q ss_conf             -------------1016-88837999217-75432122333-221011100210122211-1000011221000101344
Q gi|254781099|r  155 -------------LEYF-SPNRFYVIECS-SYQIELTPTID-PSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHA  217 (468)
Q Consensus       155 -------------~~~~-~~~~~~V~E~S-SfQL~~~~~~~-PdiavITNI~~DHLd~~~-s~e~y~~aK~~i~~~~~~~  217 (468)
                                   .-.. .+.|++|+|+. -=.||.|+.+. |.+.+||+|+.||.++.| |+++++..|+.|++...+.
T Consensus       101 ~t~FE~~T~~Af~~F~~~~~vd~av~EVGlGGrlDaTNv~~~p~~~~iT~ig~DH~~~LG~t~~~IA~eKAGI~k~g~P~  180 (460)
T TIGR01499       101 PTFFELLTLLAFLYFAQLAQVDVAVLEVGLGGRLDATNVVEKPLVSVITSIGLDHTEILGDTLEEIAWEKAGIIKEGVPI  180 (460)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCEEEEECCCCHHHHHHHCCCHHHHHHHHHHHHCCCCCE
T ss_conf             77899999999999998508828999873765445544113863799727776888650533799999745762167656


Q ss_pred             CCCC-CCHHHHHHHHHCC-CCC-CEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCC---CCCCCCCHHHHHCCCHHHH
Q ss_conf             3224-7867899987401-234-30110364432223411212413541467642123---4558851011100110122
Q gi|254781099|r  218 IICI-NDHQCEKIAYDMN-FIG-HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFD---FSQETKKHNIQNLVTSAVV  291 (468)
Q Consensus       218 iln~-dd~~~~~~~~~~~-~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~l~G~HNi~NalaAia~  291 (468)
                      ++.- +.++......... ..+ ..+.............-...+..+.+.........   .+.++|.|++.|+..|+++
T Consensus       181 v~~~~~~~ea~~v~~~~A~~~~~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~L~G~~Q~~Na~~A~~~  260 (460)
T TIGR01499       181 VTGEVQEPEALEVLKKKAEEKGAAPLQVVGKDFDIKEKDENLNGEKFSFSGENLFLEPLLAKLSLLGDHQAENAALALAA  260 (460)
T ss_pred             EEECCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCEEEECCCCCCCHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             87148866899999999997168604650341322111122465212223555421001355565679999999999999


Q ss_pred             HHCCCCC------CCCCH-HHCCCHHHHHHHHHHHCCCC-----CCEEECCCCCCCHHHHHHHHHCC------CCCCEEE
Q ss_conf             2102222------21100-00000013454433210034-----30000023556755555532013------3320012
Q gi|254781099|r  292 CMQLGLK------VEEIK-RALLSCGGLTHRLQTIARLG-----HVIFINDSKATNLHSVIHAFLNE------KRRIYWI  353 (468)
Q Consensus       292 a~~lGi~------~~~i~-~~L~~f~gv~~R~E~i~~~~-----gv~iIDDS~atnp~a~~~Al~~~------~~~i~lI  353 (468)
                      +..++-.      ...++ ++|++.. .|||||++....     +..|+=|. ||||+|+.+..+.+      .+++.+|
T Consensus       261 ~~~l~~~~~~~~~~~~~~~~GL~~~~-wpGR~e~~~~~~~~~~~~p~~~lDG-AHNp~~~~~l~~~~~~~~~~~~~~~~~  338 (460)
T TIGR01499       261 LEVLGKQSSEKLSEAAIRSEGLASTI-WPGRLEILSEDKDAKAANPNILLDG-AHNPHSAEALVEWLKEKEFNGRPITLL  338 (460)
T ss_pred             HHHHCCCCCCCCCHHHHHHHHHHHHC-CCCCEEEEECCCCHHHCCCEEEEEC-CCCHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             99850235666676678889888511-1220113303541223387179952-768789999999999986269971888


Q ss_pred             ECCCCCCCCHHHHHHHHCCC
Q ss_conf             03210122068989984278
Q gi|254781099|r  354 AGGLSKSDDFSTLFPFISKI  373 (468)
Q Consensus       354 ~GG~~K~~d~~~L~~~~~~~  373 (468)
                      .|.. ++-|...+...+...
T Consensus       339 ~~~l-~~Kd~~~~l~~L~~~  357 (460)
T TIGR01499       339 FGAL-ADKDAAAMLALLREL  357 (460)
T ss_pred             EEEC-CCCCHHHHHHHHHHH
T ss_conf             8611-368878998887874


No 37 
>KOG2525 consensus
Probab=99.53  E-value=5.5e-14  Score=115.65  Aligned_cols=211  Identities=20%  Similarity=0.151  Sum_probs=138.7

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCC-----C----C---CCCCCC-------------------------
Q ss_conf             88689960345752157899999987310000000-----1----2---443221-------------------------
Q gi|254781099|r  112 QSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGG-----N----I---GLPILN-------------------------  154 (468)
Q Consensus       112 ~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~G-----N----i---G~p~~~-------------------------  154 (468)
                      +-++|-|+||+||-||++++..||++.|+++..--     +    |   |.|++.                         
T Consensus        71 ~l~iIHVAGTkGKGStcaF~~SILr~~g~rtG~yTSPHLl~vrErIriNGqpIS~e~F~~~f~~v~~~lk~~~~~~~~~p  150 (496)
T KOG2525          71 SLNIIHVAGTKGKGSTCAFTESILRQQGLRTGFYTSPHLLSVRERIRINGQPISEEKFTKYFWEVYERLKSTKLKEVSMP  150 (496)
T ss_pred             HEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHCCHHHEEEECCEECCHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             22479982378986458989999984263663226800155324588899878999999999999998877630656787


Q ss_pred             ------------CCCCCCCCEEEEECCC-CCCCCCCCC-CCCCCEEEEECCCHHHHHH-HHHHCCCCCCCEEEECCCCCC
Q ss_conf             ------------1016888379992177-543212233-3221011100210122211-100001122100010134432
Q gi|254781099|r  155 ------------LEYFSPNRFYVIECSS-YQIELTPTI-DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAII  219 (468)
Q Consensus       155 ------------~~~~~~~~~~V~E~SS-fQL~~~~~~-~PdiavITNI~~DHLd~~~-s~e~y~~aK~~i~~~~~~~il  219 (468)
                                  .-...+.|++|+|+.= =.+|.++.+ +|-+..||+|+-||++..| ++++++..|+.||..+.++..
T Consensus       151 ~yF~fLT~lAF~~F~~enVdvaViEvGlGG~~DaTNvI~kpvvcgITslG~DH~~~LG~tL~eIA~eKAGIfK~gvpaft  230 (496)
T KOG2525         151 TYFEFLTLLAFHVFVKENVDVAVIEVGLGGELDATNVIEKPVVCGITSLGLDHTSFLGNTLSEIAWEKAGIFKEGVPAFT  230 (496)
T ss_pred             CHHHHHHHHHHEEEEECCCCEEEEEECCCCCCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEE
T ss_conf             35556675442015555886899984356665665331364589984057752888865899998874462405885487


Q ss_pred             CCCCHHHHHHHHHCC-CCCCEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCC--
Q ss_conf             247867899987401-23430110364432223411212413541467642123455885101110011012221022--
Q gi|254781099|r  220 CINDHQCEKIAYDMN-FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG--  296 (468)
Q Consensus       220 n~dd~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lG--  296 (468)
                      ....++......... ...............                  +.....+.+.|.|+..|+..|+.++...=  
T Consensus       231 ~~q~~e~~nvL~~ra~e~~~~L~~v~p~~~~------------------~ls~~~lgl~g~hq~~na~lA~~L~~~~~~~  292 (496)
T KOG2525         231 VPQPPEALNVLKERASELGVPLFVVPPLEAY------------------ELSGVNLGLIGTHQWSNASLAVQLASEWLIQ  292 (496)
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCEECCCCHHH------------------HHCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             5885788999999887337883553881465------------------5048765400651344357898889999986


Q ss_pred             -----------------CCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHH
Q ss_conf             -----------------22211000000001345443321003430000023556755555532
Q gi|254781099|r  297 -----------------LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF  343 (468)
Q Consensus       297 -----------------i~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al  343 (468)
                                       ++ .....+|+++. -|||.|.+..-++++|+=| =|||++|+.+.-
T Consensus       293 ~~~~~~~~~~~~~~~~~i~-~~~l~GL~~~~-wPGR~qil~~~~~~~~llD-GAHt~eSaea~~  353 (496)
T KOG2525         293 NGRVAEGVLDALQTSGLIP-PAFLSGLASTD-WPGRLQILEYGRGVTWLLD-GAHTKESAEACA  353 (496)
T ss_pred             CCCCCCCCCCCCCCCCCCC-HHHHCCHHHCC-CCCCEEEEECCCCCEEEEC-CCCCHHHHHHHH
T ss_conf             3850105787322366789-89961203245-7870689862898579965-899989999999


No 38 
>pfam02875 Mur_ligase_C Mur ligase family, glutamate ligase domain. This family contains a number of related ligase enzymes which have EC numbers 6.3.2.*. This family includes: MurC, MurD, MurE, MurF, Mpl and FolC. MurC, MurD, Mure and MurF catalyse consecutive steps in the synthesis of peptidoglycan. Peptidoglycan consists of a sheet of two sugar derivatives, with one of these N-acetylmuramic acid attaching to a small pentapeptide. The pentapeptide is is made of L-alanine, D-glutamic acid, Meso-diaminopimelic acid and D-alanyl alanine. The peptide moiety is synthesized by successively adding these amino acids to UDP-N-acetylmuramic acid. MurC transfers the L-alanine, MurD transfers the D-glutamate, MurE transfers the diaminopimelic acid, and MurF transfers the D-alanyl alanine. This family also includes Folylpolyglutamate synthase that transfers glutamate to folylpolyglutamate.
Probab=98.51  E-value=8.5e-08  Score=72.91  Aligned_cols=70  Identities=20%  Similarity=0.321  Sum_probs=52.4

Q ss_pred             HHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCC----CCCCEEEEC-CCCCCCCHHH-HHHHHCCCCEEEEECCC
Q ss_conf             45443321003430000023556755555532013----332001203-2101220689-89984278689998899
Q gi|254781099|r  312 LTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE----KRRIYWIAG-GLSKSDDFST-LFPFISKIAKAYFIGNS  382 (468)
Q Consensus       312 v~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~----~~~i~lI~G-G~~K~~d~~~-L~~~~~~~~~~~liG~~  382 (468)
                      +|||||.+...+++++|+| |||||+|+.++|+.+    .+++++|+| +.+|..++++ +++...+....+++..+
T Consensus         1 vpGR~e~i~~~~~~~vi~D-yaHnp~~~~a~l~~~~~~~~~r~i~V~G~~g~r~~~~r~~~g~~a~~~ad~viit~~   76 (87)
T pfam02875         1 VPGRLEVVGENNGVLVIDD-YAHNPDALEAALQALKELFDGRLILVFGAGGDRDAEFHALLGALAAALADVVILTGD   76 (87)
T ss_pred             CCCCCEEEECCCCCEEEEE-CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             9997389865899789996-789969999999999862688789999998888678999999999971999999998


No 39 
>PRK13984 putative oxidoreductase; Provisional
Probab=98.13  E-value=2.8e-05  Score=55.54  Aligned_cols=68  Identities=22%  Similarity=0.355  Sum_probs=52.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECCC----CC-
Q ss_conf             89879998368548999999998598699981896---------------------47889997898996453----15-
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDFR----EI-   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~~----~~-   60 (468)
                      .||||+|+|.|-+|+++|.+|..+||+|++||..+                     ..++.++.+|+++....    +. 
T Consensus       282 tGKKVAVIGsGPAGLaaA~~Lar~Gh~VtVFE~~~~~GGlL~yGIP~fRLpk~vv~rei~~i~~~GV~f~~n~~VGkDit  361 (604)
T PRK13984        282 KGKKVAIVGSGPAGLSAAYFLATMGYEVEVYESLSKPGGVMRYGIPSYRLPDEALDKDIAFIEALGVKIHTNTRVGKDIS  361 (604)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCEECCCCC
T ss_conf             89989998986899999999998698689974567789723315872228789999999999972989976857798478


Q ss_pred             ---CCCCCCEEEECCCC
Q ss_conf             ---72258889988886
Q gi|254781099|r   61 ---PWSIISFLVLSPGI   74 (468)
Q Consensus        61 ---~~~~~d~vv~Spgi   74 (468)
                         ..+.+|.|+++-|-
T Consensus       362 ~eeL~~~yDAVfLa~Ga  378 (604)
T PRK13984        362 LEELREKHDAVFVSTGF  378 (604)
T ss_pred             HHHHHHCCCEEEEECCC
T ss_conf             99997058999995388


No 40 
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional
Probab=98.09  E-value=3.1e-05  Score=55.27  Aligned_cols=69  Identities=26%  Similarity=0.387  Sum_probs=52.9

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECC----CCCC
Q ss_conf             89879998368548999999998598699981896---------------------4788999789899645----3157
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDF----REIP   61 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~----~~~~   61 (468)
                      .||||+|+|.|-+|+++|.+|..+||+|++++..+                     ..++.+..+|+++...    .+..
T Consensus       192 tGKkVAIIGaGPAGLsaAy~L~~~Gh~VTVfE~~~~~GGmlryGIP~yRLPk~vld~EI~~i~~~GV~~~~n~~vG~dit  271 (652)
T PRK12814        192 SGKKVAIIGAGPAGLTAAYYLLRKGHDVTIFDANEQAGGMMRYGIPRFRLPESVIDADIAPLRAMGAEFRFNTVFGRDIT  271 (652)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEECCCCC
T ss_conf             89979996837899999999997799069981588889867644863338999999999999971985886679477477


Q ss_pred             ----CCCCCEEEECCCCC
Q ss_conf             ----22588899888868
Q gi|254781099|r   62 ----WSIISFLVLSPGIA   75 (468)
Q Consensus        62 ----~~~~d~vv~Spgi~   75 (468)
                          ...+|.|+++-|-.
T Consensus       272 l~~L~~~yDAVflaiGa~  289 (652)
T PRK12814        272 LEELQKEFDAVLLAVGAQ  289 (652)
T ss_pred             HHHHHHHCCEEEEEECCC
T ss_conf             999986589999975578


No 41 
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. For example, leucine DH catalyzes the reversible oxidative deamination of L-leucine and several other straight or branched chain amino acids to the corresponding 2-oxoacid derivative. Amino acid DH -like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily inc
Probab=97.97  E-value=0.00026  Score=48.86  Aligned_cols=110  Identities=22%  Similarity=0.230  Sum_probs=74.9

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHH-HHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             132189879998368548999999998598699981896478899-9789899645315722588899888868567557
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQA-KDMGIEVIDFREIPWSIISFLVLSPGIALTGENA   81 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l-~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~   81 (468)
                      .++|+||+|.|-|+|.-|..+|++|.+.|++|+++|.++.....+ +..+.+..+..+.....+|.++.. ++....   
T Consensus        23 ~~~l~gk~VaIqG~GnVG~~~A~~l~~~Gakvvv~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~DIl~Pc-A~~~~i---   98 (200)
T cd01075          23 TDSLEGKTVAVQGLGKVGYKLAEHLLEEGAKLIVADINEEAVARAAELFGATVVAPEEIYSVDADVFAPC-ALGGVI---   98 (200)
T ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCEEECCHHHHCCCCCEEEEC-CCCCCC---
T ss_conf             9987899999989879999999999967997999826889999998568988937332322777688651-411546---


Q ss_pred             CHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             88899999769809983034223343015688689960345752157899999987310
Q gi|254781099|r   82 HWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus        82 ~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      +  -..+.                    .-++++| +-|.||-+|+-. ...+|.+.|.
T Consensus        99 ~--~~~a~--------------------~i~ak~I-~e~AN~p~t~~~-~~~~L~~rgI  133 (200)
T cd01075          99 N--DDTIP--------------------QLKAKAI-AGAANNQLADPR-HGQMLHERGI  133 (200)
T ss_pred             C--HHHHH--------------------HCCCCEE-EECCCCCCCCHH-HHHHHHHCCE
T ss_conf             8--99998--------------------7089699-735679999978-9999985992


No 42 
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional
Probab=97.94  E-value=8.9e-05  Score=52.09  Aligned_cols=68  Identities=28%  Similarity=0.360  Sum_probs=51.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECCCC----C-
Q ss_conf             89879998368548999999998598699981896---------------------478899978989964531----5-
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDFRE----I-   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~~~----~-   60 (468)
                      .||||+|+|-|-+|+++|.+|..+||+|+++|..+                     ..+..+..+|+++.....    . 
T Consensus       136 tgkkVAVIGaGPAGLsaA~~La~~G~~VtVfE~~~~~GGml~~GIP~yRLP~~vl~~ei~~i~~~GV~~~~n~~vg~dit  215 (560)
T PRK12771        136 TGKRVAVIGGGPAGLSAAYQLRRLGHAVTIFEAGPKLGGMMRYGIPGYRLPRDVLDAEIQRILDLGVEVKLGVRVGEDIT  215 (560)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEECCEECCCCC
T ss_conf             89989998977899999999997698589967678889888356875447589999999999964967983878446567


Q ss_pred             ---CCCCCCEEEECCCC
Q ss_conf             ---72258889988886
Q gi|254781099|r   61 ---PWSIISFLVLSPGI   74 (468)
Q Consensus        61 ---~~~~~d~vv~Spgi   74 (468)
                         ..+.+|.|+++.|-
T Consensus       216 ~~~L~~~yDAV~la~Ga  232 (560)
T PRK12771        216 LEQLEGDYDAVFVAIGA  232 (560)
T ss_pred             HHHHHCCCCEEEECCCC
T ss_conf             99971778889991687


No 43 
>PRK08306 dipicolinate synthase subunit A; Reviewed
Probab=97.89  E-value=6e-05  Score=53.27  Aligned_cols=61  Identities=20%  Similarity=0.109  Sum_probs=37.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             8987999836854899999999859869998189647889997898996453157225888998
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      .|++|+|+|=-.--.-+++.|.++|++|..+.-....   ....+.......+..+...|.+|.
T Consensus         1 ~g~~iaviGGD~Rq~~l~~~L~~~g~~V~~~gf~~~~---~~~~~~~~~~~~~~~~~~~d~iIl   61 (296)
T PRK08306          1 TGMHIAVIGGDARQLELIRKLVELGAKVSLVGFDQLD---HGFTGVAKCSSLEEALSDVDVIIL   61 (296)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCC---CCCCCEEEECCHHHHHHCCCEEEE
T ss_conf             9948999787589999999999779979998357655---566761773467888723999997


No 44 
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=97.86  E-value=0.00012  Score=51.22  Aligned_cols=68  Identities=32%  Similarity=0.428  Sum_probs=51.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECC----CCC-
Q ss_conf             89879998368548999999998598699981896---------------------4788999789899645----315-
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDF----REI-   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~----~~~-   60 (468)
                      ++|||+|+|.|-+|+++|.+|..+||+|++||..+                     ..++.++.+|+++...    .+. 
T Consensus       309 ~gkKVAVIGsGPAGLaaA~~Lar~G~~VTVfE~~~~~GGlL~yGIP~fRLPK~vv~rei~~l~~lGV~f~~n~~VGkDit  388 (639)
T PRK12809        309 RSEKVAVIGAGPAGLGCADILARAGVQVDVFDRHPEIGGMLTFGIPPFKLDKTVLSQRREIFTAMGIDFHLNCEIGRDIT  388 (639)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEECCEECCCCC
T ss_conf             89989998975899999999997599069993688889868535874527778999999999864988991967798688


Q ss_pred             ---CCCCCCEEEECCCC
Q ss_conf             ---72258889988886
Q gi|254781099|r   61 ---PWSIISFLVLSPGI   74 (468)
Q Consensus        61 ---~~~~~d~vv~Spgi   74 (468)
                         ....+|.|+++-|-
T Consensus       389 ~~eL~~~yDAVflg~Ga  405 (639)
T PRK12809        389 FSDLTSEYDAVFIGVGT  405 (639)
T ss_pred             HHHHHHHCCEEEEEECC
T ss_conf             99997317989997367


No 45 
>PRK12831 putative oxidoreductase; Provisional
Probab=97.82  E-value=0.00018  Score=49.90  Aligned_cols=35  Identities=29%  Similarity=0.504  Sum_probs=32.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .||||+|+|.|-+|+++|.+|..+||+|+++|..+
T Consensus       139 ~gkkVAVIGsGPAGLsaA~~La~~G~~VtVfE~~~  173 (464)
T PRK12831        139 KGKKVAVIGSGPAGLTCAGDLAKKGYDVTIFEALH  173 (464)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99989998976899999999997699179982788


No 46 
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=97.82  E-value=0.00017  Score=50.15  Aligned_cols=68  Identities=26%  Similarity=0.393  Sum_probs=50.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH---------------------HHHHHHHCCCEEECC----CCC-
Q ss_conf             898799983685489999999985986999818964---------------------788999789899645----315-
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC---------------------AVKQAKDMGIEVIDF----REI-   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~---------------------~~~~l~~~g~~~~~~----~~~-   60 (468)
                      .||+|+|+|.|-+|+++|.+|..+||+|++||..+.                     .++.++.+|+++...    .+. 
T Consensus       326 tGKkVAIIGsGPAGLsaA~~Lar~G~~VTVFE~~~~~GGlL~yGIP~fRLpk~vv~~ei~~l~~lGV~f~~n~~VGkDit  405 (654)
T PRK12769        326 SDKRVAIIGAGPAGLACADVLTRNGVAVTVYDRHPEIGGLLTFGIPAFKLDKSLLARRREIFSAMGIHFELNCEVGKDIS  405 (654)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEECCCEECCCCC
T ss_conf             89989998977899999999997697579952577788667524862227789999999999826988983717687658


Q ss_pred             ---CCCCCCEEEECCCC
Q ss_conf             ---72258889988886
Q gi|254781099|r   61 ---PWSIISFLVLSPGI   74 (468)
Q Consensus        61 ---~~~~~d~vv~Spgi   74 (468)
                         ..+.+|.|+++-|-
T Consensus       406 l~eL~~~yDAVfla~Ga  422 (654)
T PRK12769        406 LESLLEDYDAVFVGVGT  422 (654)
T ss_pred             HHHHHHCCCEEEEECCC
T ss_conf             99997369989995178


No 47 
>PRK07417 arogenate dehydrogenase; Reviewed
Probab=97.81  E-value=0.00011  Score=51.43  Aligned_cols=63  Identities=19%  Similarity=0.215  Sum_probs=51.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCE-EECCCCCCCCCCCEEEEC
Q ss_conf             879998368548999999998598699981896478899978989-964531572258889988
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE-VIDFREIPWSIISFLVLS   71 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~-~~~~~~~~~~~~d~vv~S   71 (468)
                      -||+|+|+|.-|-|+|..|.++|++|+|+|.++...+...+.|+. ..........++|+||++
T Consensus         2 mkI~IiGlGLIGgSla~al~~~~~~V~g~d~~~~~~~~A~~~g~id~~~~~~~~~~~aDliila   65 (280)
T PRK07417          2 MNIGIVGLGLIGGSLGLDLRSLGHTVYGVSRRESTCERAIERGLVDEASTDLSLLKDCDLVILA   65 (280)
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCEECCCHHHHCCCCEEEEC
T ss_conf             7899993185799999999968997999979999999999869975202787460579989987


No 48 
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase. The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Probab=97.81  E-value=0.00019  Score=49.75  Aligned_cols=113  Identities=19%  Similarity=0.194  Sum_probs=75.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHH
Q ss_conf             87999836854899999999859869998189647889997898996453157225888998888685675578889999
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLA   88 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a   88 (468)
                      ++|+|+|+|.=|.++|+-|.++|++|.+||.++...+.+...|.....-.....+..|.|+.+  +|.. +    .++  
T Consensus         2 ~~Ig~IGlG~MG~~ma~~L~~~g~~v~v~d~~~~~~~~~~~~g~~~~~s~~e~~~~~dvIi~~--l~~~-~----~v~--   72 (163)
T pfam03446         2 AKIGFIGLGVMGSPMALNLLKAGYTVTVYNRTPEKVEELVAEGAVAAASPAEAAASADVVITM--VPAG-A----AVD--   72 (163)
T ss_pred             CEEEEEEEHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEECCCHHHHHHCCCEEEEE--CCCH-H----HHH--
T ss_conf             889998367989999999997799699997978877999983995539999998619999992--5871-4----540--


Q ss_pred             HHCCCEEEEEHH-HHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             976980998303-42233430156886899603457521578999999873100
Q gi|254781099|r   89 NQFNVEIIGDIE-LFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        89 ~~~gi~v~s~~e-l~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
                           .|+.+.+ ++     ....+.++|--++|..-.++..+ +..+++.|..
T Consensus        73 -----~V~~~~~gl~-----~~~~~g~iiid~sT~~p~~~~~~-~~~~~~~g~~  115 (163)
T pfam03446        73 -----AVIFGEDGLL-----PGLKPGDIIIDGSTISPDDTRRL-AKELKEKGIR  115 (163)
T ss_pred             -----EEECCCCCHH-----HHCCCCCEEEECCCCCHHHHHHH-HHHHHHCCCC
T ss_conf             -----2202631332-----31358988986798999999999-9987530344


No 49 
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional
Probab=97.80  E-value=0.00011  Score=51.35  Aligned_cols=15  Identities=13%  Similarity=-0.031  Sum_probs=6.3

Q ss_pred             CHHHHHHHHCCCEEE
Q ss_conf             888999997698099
Q gi|254781099|r   82 HWCVKLANQFNVEII   96 (468)
Q Consensus        82 ~~~~~~a~~~gi~v~   96 (468)
                      .|..++.++.|..|+
T Consensus       114 ~piakalk~~Gn~v~  128 (760)
T PRK12778        114 LPIVQALKAAGNRVI  128 (760)
T ss_pred             HHHHHHHHHCCCEEE
T ss_conf             999999998699599


No 50 
>PRK12810 gltD glutamate synthase subunit beta; Reviewed
Probab=97.79  E-value=0.00022  Score=49.34  Aligned_cols=35  Identities=31%  Similarity=0.501  Sum_probs=32.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .||||+|+|.|-+|+++|.+|...||+|+++|..+
T Consensus       142 ~gkkVAVIGsGPAGLsaA~~Lar~G~~VtVfE~~~  176 (472)
T PRK12810        142 TGKKVAVVGSGPAGLAAADQLARAGHKVTVFERDD  176 (472)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             89989998977899999999986697589972577


No 51 
>PRK09853 putative selenate reductase subunit YgfK; Provisional
Probab=97.79  E-value=0.00013  Score=51.06  Aligned_cols=70  Identities=20%  Similarity=0.310  Sum_probs=53.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECC--CCC---
Q ss_conf             89879998368548999999998598699981896---------------------4788999789899645--315---
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDF--REI---   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~--~~~---   60 (468)
                      .+|+|+|+|.|-.|+++|.+|...||+|++++..+                     ..+..++.+|+++...  .+.   
T Consensus       549 tgKKVAVIGsGPAGLaAA~~Lar~Gh~VTVFEk~~~~GGmL~yGIP~fRLPk~vIdreI~~l~~~GV~f~tnvg~ditle  628 (1032)
T PRK09853        549 SRHPVAVIGAGPAGLAAGYFLARAGHPVTVFEREENAGGVVKNIIPEFRIPAELIQHDIDFVAAHGVKFEYGCSPDLTVE  628 (1032)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCCCHH
T ss_conf             89979998968899999999997799369981589788426735887678999999999999977969996999988899


Q ss_pred             --CCCCCCEEEECCCCCC
Q ss_conf             --7225888998888685
Q gi|254781099|r   61 --PWSIISFLVLSPGIAL   76 (468)
Q Consensus        61 --~~~~~d~vv~Spgi~~   76 (468)
                        .-+.+|.|+++-|-..
T Consensus       629 ~L~~eGyDAVfLa~GA~~  646 (1032)
T PRK09853        629 QLKNQGYHYVLLAIGADK  646 (1032)
T ss_pred             HHHHCCCCEEEEECCCCC
T ss_conf             996579999999458898


No 52 
>PRK11749 putative oxidoreductase; Provisional
Probab=97.73  E-value=0.00027  Score=48.79  Aligned_cols=36  Identities=31%  Similarity=0.482  Sum_probs=33.2

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             189879998368548999999998598699981896
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -.||||+|+|.|-+|+++|.+|..+||+|+++|..+
T Consensus       138 ~~gkkVAIIGaGPAGLsAA~~Lar~G~~VtVfE~~~  173 (460)
T PRK11749        138 KTGKKVAVIGAGPAGLTAAHRLARKGYDVTIFEARD  173 (460)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             789989998967899999999997698479970478


No 53 
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit. Members of this protein family are YgfK, predicted to be one subunit of a three-subunit, molybdopterin-containing selenate reductase. This enzyme is found, typically, in genomic regions associated with xanthine dehydrogenase homologs predicted to belong to the selenium-dependent molybdenum hydroxylases (SDMH). Therefore, the selenate reductase is suggested to play a role in furnishing selenide for SelD, the selenophosphate synthase.
Probab=97.72  E-value=0.00017  Score=50.18  Aligned_cols=68  Identities=25%  Similarity=0.357  Sum_probs=51.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECC--CCC---
Q ss_conf             89879998368548999999998598699981896---------------------4788999789899645--315---
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDF--REI---   60 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~--~~~---   60 (468)
                      .+|||+|+|.|-.|+++|.+|...||.|++++..+                     ..+..++.+|+++...  .+.   
T Consensus       536 ~gkKVAVIGsGPAGLaAA~~Lar~Gh~VTVFEk~~~~GGmL~yGIP~fRLPkevI~reI~~i~~~GV~f~tnvg~ditle  615 (1012)
T TIGR03315       536 SAHKVAVIGAGPAGLSAGYFLARAGHPVTVFEKKEKPGGVVKNIIPEFRISAESIQKDIELVKFHGVEFKYGCSPDLTVA  615 (1012)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCHH
T ss_conf             99889998977899999999997799569981589788547855887778999999999999968969997998888899


Q ss_pred             --CCCCCCEEEECCCC
Q ss_conf             --72258889988886
Q gi|254781099|r   61 --PWSIISFLVLSPGI   74 (468)
Q Consensus        61 --~~~~~d~vv~Spgi   74 (468)
                        ..+++|.|++.-|-
T Consensus       616 eL~~egYDAVfLa~GA  631 (1012)
T TIGR03315       616 ELKNQGYKYVILAIGA  631 (1012)
T ss_pred             HHHHCCCCEEEEECCC
T ss_conf             9965899999995689


No 54 
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215   This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by IPR014214 from INTERPRO. This protein is also known as SpoVFA..
Probab=97.71  E-value=6.3e-05  Score=53.12  Aligned_cols=45  Identities=20%  Similarity=0.149  Sum_probs=30.9

Q ss_pred             CCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCE---EEECCCCCCCCCC
Q ss_conf             2122333221011100210122211100001122100---0101344322478
Q gi|254781099|r  174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICIND  223 (468)
Q Consensus       174 ~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i---~~~~~~~iln~dd  223 (468)
                      |+.+..+.++.|+|-|+.+||+..   -+  +++.+|   ++..+.+++|.-.
T Consensus        86 ~~~~~~~~~~~~~~Gisn~yL~~l---~~--~a~~~Li~l~erDdvAIYNSIP  133 (288)
T TIGR02853        86 ELLEETKKHCTIYVGISNDYLEEL---AA--EAGVKLIELFERDDVAIYNSIP  133 (288)
T ss_pred             HHHHHCCCCEEEEECCCCHHHHHH---HH--HCCCCEEEECCCCCEEEECCCC
T ss_conf             899520794389973776589999---98--7196024100357533445875


No 55 
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=97.70  E-value=0.00099  Score=44.86  Aligned_cols=119  Identities=18%  Similarity=0.164  Sum_probs=70.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEE-------------------ECCCCCCCCCCCEEEE
Q ss_conf             799983685489999999985986999818964788999789899-------------------6453157225888998
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEV-------------------IDFREIPWSIISFLVL   70 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~-------------------~~~~~~~~~~~d~vv~   70 (468)
                      ||+|+|+|--|+++|..|.++|++|.|+|.++..++.+..-...+                   ..........+|.+++
T Consensus         2 kI~ViGlGyVGl~~a~~la~~G~~V~g~D~d~~~v~~ln~g~~p~~E~~l~~~l~~~~~~~~~~~~~~~~~i~~~d~i~I   81 (185)
T pfam03721         2 RIAVIGLGYVGLPTAVCLAEIGHDVVGVDINQSKIDKLNNGKIPIYEPGLEELLKANVSGRLRFTTDVAEAIKEADVIFI   81 (185)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCEEEECCHHHHHHHCCEEEE
T ss_conf             79998978748999999994899399997998999998626897467588999987340896998787998844989999


Q ss_pred             CCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             8886856755788899999769809983034223343015688689960345752157899999987310
Q gi|254781099|r   71 SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus        71 Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      +-+-|.+ +...|-           ++.++-+.........+..+|-+.-|.==-||..++..++++.+.
T Consensus        82 ~VpTP~~-~~~~~d-----------~s~l~~~~~~i~~~l~~~~liii~STVppGtt~~~~~~l~~~~~~  139 (185)
T pfam03721        82 AVPTPSK-KGGAPD-----------LTYVESAARTIGPVLKKGKVVVVKSTVPPGTTEEVVKPILEKRSG  139 (185)
T ss_pred             ECCCCCC-CCCCCC-----------CHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHCCC
T ss_conf             7368765-576766-----------359999999997446799899991899988689999999997266


No 56 
>PRK07502 cyclohexadienyl dehydrogenase; Validated
Probab=97.67  E-value=0.0002  Score=49.71  Aligned_cols=63  Identities=19%  Similarity=0.303  Sum_probs=51.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHHHHHHHCCCEE--ECCCCCCCCCCCEEEEC
Q ss_conf             879998368548999999998598--6999818964788999789899--64531572258889988
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEV--IDFREIPWSIISFLVLS   71 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~~l~~~g~~~--~~~~~~~~~~~d~vv~S   71 (468)
                      ++|+|+|+|.-|-|+|+.|+++|.  .|+|+|.++...+.+.+.|+.-  ..........+|+||++
T Consensus         7 ~~I~IiGlGLIGgSlA~alk~~~~~~~I~g~d~~~~~l~~A~~~g~id~~~~~~~e~~~~~DlIila   73 (307)
T PRK07502          7 DRVALIGLGLIGSSLARAIRRQGLAGEIVGAARSAETRARARELGLGDRVTTSAAEAVKGADLVILC   73 (307)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCHHCCCHHHHHCCCCEEEEE
T ss_conf             6689992787999999999854998579998499999999998699751127776640458979991


No 57 
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional
Probab=97.63  E-value=0.0015  Score=43.64  Aligned_cols=117  Identities=16%  Similarity=0.183  Sum_probs=69.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCC----------------CCCCCCCCEEEECC
Q ss_conf             87999836854899999999859869998189647889997898996453----------------15722588899888
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR----------------EIPWSIISFLVLSP   72 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~----------------~~~~~~~d~vv~Sp   72 (468)
                      |+|.|+|+|--|+++|..|.++|++|.|+|.++..++.+..-...+.+..                -...+.+|.++++-
T Consensus         4 kkI~ViGlGYVGL~~a~~lA~~G~~Vig~D~d~~kv~~l~~g~~p~~Ep~l~~ll~~~~~~~~l~~t~~~~~ad~iiI~V   83 (415)
T PRK11064          4 ETISVIGLGYIGLPTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPDLDMVVKAAVEGGYLRATTTPVPADAFLIAV   83 (415)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCCEEECCHHHCCEEEEEC
T ss_conf             87999886877899999999688948999899999999978689988989899999998659836525746789999988


Q ss_pred             CCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             86856755788899999769809983034223343015688689960345752157899999987
Q gi|254781099|r   73 GIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRK  137 (468)
Q Consensus        73 gi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~  137 (468)
                      +-|.+. +           +-|=+|.++=+.+.......+..+|-+--|.==.||..+...+++.
T Consensus        84 ~TP~~~-~-----------~~~Dls~i~~a~~~I~~~l~~~~lVIi~STVppGTt~~i~~~l~~~  136 (415)
T PRK11064         84 PTPFKG-D-----------HEPDLSYVEAAAKSIAPVLKKGDLVILESTSPVGATEQMAEWLAEA  136 (415)
T ss_pred             CCCCCC-C-----------CCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             999789-9-----------9720201888999999752688679963789997199999999985


No 58 
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed
Probab=97.63  E-value=0.0013  Score=44.03  Aligned_cols=50  Identities=12%  Similarity=0.093  Sum_probs=24.0

Q ss_pred             CCCCHHHHHHHHHCC----CCCCEEEEC--CCCCCCCHHHHHHHHCCCCEEEEECCCHHH
Q ss_conf             556755555532013----332001203--210122068989984278689998899899
Q gi|254781099|r  332 KATNLHSVIHAFLNE----KRRIYWIAG--GLSKSDDFSTLFPFISKIAKAYFIGNSAML  385 (468)
Q Consensus       332 ~atnp~a~~~Al~~~----~~~i~lI~G--G~~K~~d~~~L~~~~~~~~~~~liG~~~~~  385 (468)
                      |+|-......+|+..    .++.++|+|  |-.|..    .......-.+++++..+.+.
T Consensus       312 ~NTD~~G~~~~L~~~~~~~~~~~~~vlGaGGaarAi----~~~l~~~g~~i~I~nRt~~k  367 (477)
T PRK09310        312 YNTDGEGLFSLLKQKNISLNNQHVAIVGAGGAAKAI----ATTLARQGAELLIFNRTKAH  367 (477)
T ss_pred             EECCHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHH----HHHHHHCCCEEEEEECCHHH
T ss_conf             825789999999970999444622442475079999----99998679979999799899


No 59 
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=97.56  E-value=0.00069  Score=45.94  Aligned_cols=69  Identities=20%  Similarity=0.352  Sum_probs=51.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECCC----C--
Q ss_conf             89879998368548999999998598699981896---------------------47889997898996453----1--
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDFR----E--   59 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~~----~--   59 (468)
                      +++||+|+|.|-+|+++|.+|..+||+|+++|..+                     ..++.++.+|+++....    +  
T Consensus       431 ~~gKVAVIGsGPAGLs~A~~Lar~G~~VTVfEal~~~GGvL~YGIPeFRLPK~IV~~EI~~l~~lGVef~~n~~VGkdit  510 (993)
T PRK12775        431 KIGKVAIVGSGPAGLAAAADLTRYGVETTVYEALHVLGGVLQYGIPSFRLPRDIIDREIQRLKDIGVKFETNKVVGKTFT  510 (993)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHCCEEEECCCEECCCCC
T ss_conf             89808997837889999999997799648971688899726843777678889999999999878949983888656078


Q ss_pred             ---CC-CCCCCEEEECCCCC
Q ss_conf             ---57-22588899888868
Q gi|254781099|r   60 ---IP-WSIISFLVLSPGIA   75 (468)
Q Consensus        60 ---~~-~~~~d~vv~Spgi~   75 (468)
                         .. .+.+|.|++.-|-.
T Consensus       511 l~eL~~e~gyDAVFIg~GA~  530 (993)
T PRK12775        511 IPQLMNDRGFDAVFVAAGAG  530 (993)
T ss_pred             HHHHHHCCCCCEEEEECCCC
T ss_conf             99995345989899955878


No 60 
>PRK11559 garR tartronate semialdehyde reductase; Provisional
Probab=97.55  E-value=0.00025  Score=48.96  Aligned_cols=113  Identities=15%  Similarity=0.239  Sum_probs=73.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHH
Q ss_conf             87999836854899999999859869998189647889997898996453157225888998888685675578889999
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLA   88 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a   88 (468)
                      -||+|+|+|.=|.++|+-|.+.|++|++||..+...+.+.+.|.....-........|+|+.+  +|.+ +.    ++..
T Consensus         2 MkIgfIGlG~MG~~ma~~L~~~G~~v~v~dr~~~~~~~l~~~Ga~~~~s~~e~~~~~dvvi~~--l~~~-~~----v~~v   74 (295)
T PRK11559          2 MKVGFIGLGIMGKPMSKNLLKAGYSLVVYDRNPEAIADVIAAGAETASTAKAIAEQCDVIITM--LPNS-PH----VKEV   74 (295)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCCCHHHHHHCCCEEEEE--CCCC-CC----HHHH
T ss_conf             789998405769999999997899589992999999999985992039999998438878996--6898-10----7766


Q ss_pred             HHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9769809983034223343015688689960345752157899999987310
Q gi|254781099|r   89 NQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus        89 ~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      -      .++-.+.     ....+.++|--++|..=.++..+ +..+++.|.
T Consensus        75 ~------~g~~gi~-----~~~~~g~iiid~sT~~p~~~~~~-a~~~~~~g~  114 (295)
T PRK11559         75 A------LGENGII-----EGAKPGTVLIDMSSIAPLASREI-SEALKAKGI  114 (295)
T ss_pred             H------HCCCCCH-----HCCCCCCEEEECCCCCHHHHHHH-HHHHHHCCC
T ss_conf             3------0776601-----13899988998999999999999-999996598


No 61 
>PRK08507 prephenate dehydrogenase; Validated
Probab=97.54  E-value=0.0004  Score=47.61  Aligned_cols=62  Identities=26%  Similarity=0.276  Sum_probs=49.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEEC
Q ss_conf             79998368548999999998598--699981896478899978989964531572258889988
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLS   71 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~S   71 (468)
                      ||+|+|+|.-|-|+|+.|++.|.  +|+|+|.++...+...+.|+.-..........+|+||++
T Consensus         2 ~I~IiGlGLiGgSla~alk~~~~~~~V~g~d~~~~~~~~A~~~g~id~~~~~~~i~~aDlVila   65 (275)
T PRK08507          2 KIGIIGLGLMGGSLGLALKENKLISCVYGYDHNEEHEKDALDLGLVDEIVEFEEIKECDVIFLA   65 (275)
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCCCCCHHHCCCCCEEEEE
T ss_conf             8999900878999999999509986799995999999999986998610673123657989991


No 62 
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=97.53  E-value=0.0012  Score=44.41  Aligned_cols=117  Identities=19%  Similarity=0.163  Sum_probs=70.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC--------------------CCCCCCCCCCEEE
Q ss_conf             79998368548999999998598699981896478899978989964--------------------5315722588899
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID--------------------FREIPWSIISFLV   69 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~--------------------~~~~~~~~~d~vv   69 (468)
                      ||.|+|+|--|+++|..|.++|++|.|+|.++..+..+..-...+.+                    ..+.....+|.++
T Consensus         2 kI~ViGlGyVGl~~a~~lA~~G~~V~g~D~d~~~i~~l~~g~~p~~E~gl~~ll~~~~~~~~l~~ttd~~~~i~~~dii~   81 (411)
T TIGR03026         2 KIAVIGLGYVGLPLAALLADLGHEVTGVDIDQEKVDKLNKGKSPIYEPGLDELLAKALAAGRLRATTDYEDAIRDADVII   81 (411)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHCCCCCCCCCCHHHHHHHHHHCCCEEEECCHHHHHHHCCEEE
T ss_conf             79998978779999999994899489998999999999779899789898999999986399799878899872099999


Q ss_pred             ECCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             888868567557888999997698099830342233430156886899603457521578999999873
Q gi|254781099|r   70 LSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKN  138 (468)
Q Consensus        70 ~Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~  138 (468)
                      +.-+-|.+ ++..|           -+|.++=+.........+..+|-+--|.-=-||-.++..+|++.
T Consensus        82 I~V~TP~~-~~g~~-----------d~s~l~~a~~~i~~~l~~~~lvii~STV~pGTt~~i~~~ile~~  138 (411)
T TIGR03026        82 ICVPTPLK-EDGSP-----------DLSYVESAAETIAKHLRKGATVVLESTVPPGTTEEVVKPILERA  138 (411)
T ss_pred             EECCCCCC-CCCCC-----------HHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEEHHHHHHHHHHH
T ss_conf             97689866-68872-----------13899999999997668999899957868681048999988774


No 63 
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=97.52  E-value=0.0019  Score=42.88  Aligned_cols=110  Identities=22%  Similarity=0.242  Sum_probs=68.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCC---EEEECCCCCCCCCCCCHHHH
Q ss_conf             799983685489999999985986999818964788999789899645315722588---89988886856755788899
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIIS---FLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d---~vv~Spgi~~~~~~~~~~~~   86 (468)
                      +|+++|+|.=|.++|+-|.++|++|++||.++...+.+...|.....-.+......|   .|+..  +| +.+.    +.
T Consensus         2 kIGfIGLG~MG~~mA~nL~~~G~~V~v~dr~~~~~~~~~~~ga~~~~s~~e~~~~~d~prvI~l~--lp-~~~~----Vd   74 (301)
T PRK09599          2 QLGMIGLGRMGGNMARRLLRGGHEVVGYDRNPEAVEALAAEGATGAASLEELVAKLPAPRVVWLM--VP-AGEI----TD   74 (301)
T ss_pred             EEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEECCCHHHHHHHCCCCCEEEEE--CC-CCHH----HH
T ss_conf             79998345879999999996899079976999999999985994329999999707888779998--17-9703----89


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9997698099830342233430156886899603457521578999999873100
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
                      ..-+       +  +    . ....+.. |-|-+|+---+.+.-++..|++.|..
T Consensus        75 ~Vi~-------~--l----~-~~l~~g~-iiID~sts~~~~t~~~a~~l~~~gi~  114 (301)
T PRK09599         75 STID-------E--L----A-PLLEAGD-IVIDGGNSYYKDDIRRAELLAEKGIH  114 (301)
T ss_pred             HHHH-------H--H----H-HHCCCCC-EEEECCCCCHHHHHHHHHHHHHCCCC
T ss_conf             9999-------9--9----9-6278998-88708999838899999999985994


No 64 
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional
Probab=97.47  E-value=0.0012  Score=44.23  Aligned_cols=140  Identities=14%  Similarity=0.075  Sum_probs=66.3

Q ss_pred             HHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCC---CCEEEEECCCHHHHHHHHHC
Q ss_conf             332100343000002355675555553201333200120321012206898998427---86899988998998886316
Q gi|254781099|r  316 LQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISK---IAKAYFIGNSAMLFFHHFGG  392 (468)
Q Consensus       316 ~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~---~~~~~liG~~~~~i~~~~~~  392 (468)
                      -+...+.+-..+|=|  ||+|+-..+|=- .+-+.++|+=. |.. +-.+..+.+.+   ..+++.-..+.....+....
T Consensus       436 V~~~r~~G~~v~yGD--at~~~vL~~AGi-~~A~~vViai~-d~~-~~~~iv~~~r~~~P~l~I~aRar~~~~~~~L~~~  510 (602)
T PRK03659        436 VNLMRKYGYKVYYGD--ATQLELLRAAGA-EKAEAIVITCN-EPE-DTMKLVELCQQHFPHLHILARARGRVEAHELLQA  510 (602)
T ss_pred             HHHHHHCCCEEEEEC--CCCHHHHHHCCC-CCCCEEEEEEC-CHH-HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC
T ss_conf             999997899089758--999999986790-40588999829-899-9999999999878699699986978999999978


Q ss_pred             CCCEEEECCHHHHHHHH--------------HHHHHHCCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             89889987999999999--------------9999844898599945221663134798999999999998637985235
Q gi|254781099|r  393 KINSTLSKTLDQALKSV--------------VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV  458 (468)
Q Consensus       393 ~~~~~~~~~~~~a~~~i--------------~~~~~~~~~gDiVLlSPa~aS~d~f~~y~~RG~~F~~~v~~l~~~~~~~  458 (468)
                      ..+...-++++.+++..              .+.++..+..|-.+|---.+.++.=+.|-+|...=++--++++-.|+..
T Consensus       511 Ga~~vv~Et~essL~l~~~~L~~lG~~~~~a~~~~~~f~~~d~~~l~~~~~~~~d~~~~~~~~~~~~~el~~l~~~~~~~  590 (602)
T PRK03659        511 GVTQFSRETFSSALELGRKTLVSLGMHPHQAQRAQLHFRRLDMRMLRELIPQHNEDTVQISRAKEARRELEEIFQREMQQ  590 (602)
T ss_pred             CCCEEECCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99978662789999999999998099999999999999999999999987633887999999999999999999999998


Q ss_pred             CH
Q ss_conf             94
Q gi|254781099|r  459 DI  460 (468)
Q Consensus       459 ~~  460 (468)
                      ++
T Consensus       591 ~~  592 (602)
T PRK03659        591 ER  592 (602)
T ss_pred             HH
T ss_conf             63


No 65 
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed
Probab=97.46  E-value=0.0014  Score=43.90  Aligned_cols=110  Identities=22%  Similarity=0.264  Sum_probs=72.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCC---CCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             79998368548999999998598699981896478899978989964531572---258889988886856755788899
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW---SIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~---~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
                      +|+++|+|.=|.++|+=|.+.|++|++||.++...+.+...|.....-.+...   +.++.|+..  +|. .+.    +.
T Consensus         2 kIGfIGLG~MG~~mA~nL~~~G~~V~v~d~~~~~~~~~~~~g~~~~~s~~e~~~~l~~~~vI~~~--vp~-g~~----v~   74 (298)
T PRK12490          2 KLGLIGLGKMGGNMAERLREDGHEVVGYDVNQEAVDVAGKLGITARHSLEELVSKLEAPRAIWVM--VPA-GEV----TE   74 (298)
T ss_pred             EEEEECHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCEECCCHHHHHHHCCCCCEEEEE--CCC-CHH----HH
T ss_conf             79998346768999999997799489984998999999986995428999999737899889997--689-455----99


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9997698099830342233430156886899603457521578999999873100
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
                      ..-.       +  +.     ....+.. |-|-+|+---+++.-++..|++.|..
T Consensus        75 ~vi~-------~--l~-----~~L~~g~-iiID~sts~~~~t~~~~~~l~~~gi~  114 (298)
T PRK12490         75 SVLK-------D--LY-----PLLSPGD-IVIDGGNSRYKDDLRRAEELAERGIH  114 (298)
T ss_pred             HHHH-------H--HH-----HHCCCCC-EEECCCCCCHHHHHHHHHHHHHCCCC
T ss_conf             9999-------6--88-----5269998-88528878999999999999975990


No 66 
>TIGR01318 gltD_gamma_fam glutamate synthase, small subunit; InterPro: IPR006006    One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate.  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+.    This model describes both glutatate synthase small subunit and closely related paralogs of unknown function from a number of gamma and alpha subdivision Proteobacteria, including Escherichia coli. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.
Probab=97.46  E-value=0.00068  Score=45.99  Aligned_cols=69  Identities=30%  Similarity=0.411  Sum_probs=52.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH---------------------HHHHHHCCCEEECC----CC--
Q ss_conf             8987999836854899999999859869998189647---------------------88999789899645----31--
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA---------------------VKQAKDMGIEVIDF----RE--   59 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~---------------------~~~l~~~g~~~~~~----~~--   59 (468)
                      .+|||+|+|.|-.|++.|-.|.+.|.+|.+||+.|..                     .+-+..+||++--.    ++  
T Consensus       142 ~g~rVAviGAGPAGLaCAD~L~RaGV~v~VfDRhP~iGGLLtFGIPsFKLdK~V~~~Rr~if~~MGi~F~Ln~EvGrD~~  221 (480)
T TIGR01318       142 TGKRVAVIGAGPAGLACADILARAGVQVVVFDRHPEIGGLLTFGIPSFKLDKAVLSRRREIFTAMGIEFKLNTEVGRDIS  221 (480)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECCCEEECCCC
T ss_conf             78278997788602579998751785599974770307601368885110278999999999758927865816503255


Q ss_pred             --CCCCCCCEEEECCCCCCC
Q ss_conf             --572258889988886856
Q gi|254781099|r   60 --IPWSIISFLVLSPGIALT   77 (468)
Q Consensus        60 --~~~~~~d~vv~Spgi~~~   77 (468)
                        ..++.+|.|++  ||..+
T Consensus       222 l~~LLe~YDAVFl--GvGTY  239 (480)
T TIGR01318       222 LDDLLEDYDAVFL--GVGTY  239 (480)
T ss_pred             HHHHHHHCCEEEE--ECCCC
T ss_conf             5444311484896--11433


No 67 
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]
Probab=97.45  E-value=0.0013  Score=44.16  Aligned_cols=119  Identities=22%  Similarity=0.190  Sum_probs=74.3

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHHCC-CEEE--CCCCCCCCCCCEEEECCCCCCCCC
Q ss_conf             32189879998368548999999998598699981896-4788999789-8996--453157225888998888685675
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP-CAVKQAKDMG-IEVI--DFREIPWSIISFLVLSPGIALTGE   79 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~-~~~~~l~~~g-~~~~--~~~~~~~~~~d~vv~Spgi~~~~~   79 (468)
                      =+++||+|+|+|=|..|.-=|+.|.+.|+.|+++-... +.+..+...+ +...  .+....+..+++||.+    .+++
T Consensus         8 ~~l~~k~VlvvGgG~va~rKa~~ll~~ga~v~Vvs~~~~~el~~~~~~~~i~~~~~~~~~~~~~~~~lviaA----t~d~   83 (210)
T COG1648           8 LDLEGKKVLVVGGGSVALRKARLLLKAGADVTVVSPEFEPELKALIEEGKIKWIEREFDAEDLDDAFLVIAA----TDDE   83 (210)
T ss_pred             EECCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCHHHCCCCHHHHCCCEEEEEE----CCCH
T ss_conf             981997799989989999999999746997999878744999999983485310022363653682499991----6998


Q ss_pred             -CCCHHHHHHHHCCCEEE--EEHHHHHHHHHHCCCCCCE-EEEECCCCCCHH
Q ss_conf             -57888999997698099--8303422334301568868-996034575215
Q gi|254781099|r   80 -NAHWCVKLANQFNVEII--GDIELFVRERRFSSLQSPF-IAVTGTNGKSST  127 (468)
Q Consensus        80 -~~~~~~~~a~~~gi~v~--s~~el~~~~~~~~~~~~~v-I~VTGT~GKTTt  127 (468)
                       .+......|++.+++|-  .++++..-.........|+ |+| .|.||+-+
T Consensus        84 ~ln~~i~~~a~~~~i~vNv~D~p~~~~f~~Pa~~~r~~l~iaI-sT~G~sP~  134 (210)
T COG1648          84 ELNERIAKAARERRILVNVVDDPELCDFIFPAIVDRGPLQIAI-STGGKSPV  134 (210)
T ss_pred             HHHHHHHHHHHHHCCCEEECCCCCCCCEEECEEECCCCEEEEE-ECCCCCHH
T ss_conf             9999999999993993560488465856601054358879999-77997749


No 68 
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]
Probab=97.43  E-value=0.00045  Score=47.23  Aligned_cols=12  Identities=8%  Similarity=0.263  Sum_probs=5.5

Q ss_pred             HHHHHHCCCEEE
Q ss_conf             999997698099
Q gi|254781099|r   85 VKLANQFNVEII   96 (468)
Q Consensus        85 ~~~a~~~gi~v~   96 (468)
                      +++|+++||.|.
T Consensus        82 l~aa~~~gI~Vt   93 (324)
T COG1052          82 LEAAKERGITVT   93 (324)
T ss_pred             HHHHHHCCEEEE
T ss_conf             988987894999


No 69 
>PRK07574 formate dehydrogenase; Provisional
Probab=97.36  E-value=0.001  Score=44.77  Aligned_cols=92  Identities=18%  Similarity=0.289  Sum_probs=47.3

Q ss_pred             HHHHHHHHHCCCEEEEEECCCH---H-HHHHHHCCCEEE-CCCC-----CCCCC-CCE-EEECCCCCCCCCCCCHHHHHH
Q ss_conf             9999999985986999818964---7-889997898996-4531-----57225-888-998888685675578889999
Q gi|254781099|r   21 LSAACALKDSGVHVIAWDDHPC---A-VKQAKDMGIEVI-DFRE-----IPWSI-ISF-LVLSPGIALTGENAHWCVKLA   88 (468)
Q Consensus        21 ~s~A~~l~~~G~~V~~~D~~~~---~-~~~l~~~g~~~~-~~~~-----~~~~~-~d~-vv~Spgi~~~~~~~~~~~~~a   88 (468)
                      +.+-++|-++||+..+++++..   . .+.+....+.+. +|..     ..++. ..+ +|..-||..++-+    +.+|
T Consensus        58 lglr~~le~~gh~~v~t~dk~g~~~~~~~~l~da~ivis~pf~p~ylT~E~IekApnLKli~tAGVG~DnID----L~AA  133 (385)
T PRK07574         58 LGLRTFLEERGHELVVTSDKDGPDSVFERELPDADVVISQPFWPAYLTAERIAKAPNLKLAITAGIGSDHVD----LQAA  133 (385)
T ss_pred             HHHHHHHHHCCCEEEEECCCCCCCCHHHHHCCCCEEEECCCCCCCCCCHHHHHCCCCCEEEEEEEECCCHHH----HHHH
T ss_conf             105888985591699965888985067751577639974588732114999943886739999420472454----9989


Q ss_pred             HHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             976980998303422334301568868996034575215789999998
Q gi|254781099|r   89 NQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLR  136 (468)
Q Consensus        89 ~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~  136 (468)
                      +++||.|.                    -+||+|--+..-+-+..||.
T Consensus       134 ~erGI~V~--------------------nvpG~Ns~SVAEhtv~liLa  161 (385)
T PRK07574        134 SEHNITVA--------------------EVTGSNSISVAEHVVMMILA  161 (385)
T ss_pred             HHCCCEEE--------------------ECCCCCHHHHHHHHHHHHHH
T ss_conf             97899999--------------------59998719999999999999


No 70 
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional
Probab=97.35  E-value=0.0017  Score=43.16  Aligned_cols=96  Identities=17%  Similarity=0.158  Sum_probs=45.1

Q ss_pred             HHHHHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCC---CEEEEECCCHHHHHHHHH
Q ss_conf             43321003430000023556755555532013332001203210122068989984278---689998899899888631
Q gi|254781099|r  315 RLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKI---AKAYFIGNSAMLFFHHFG  391 (468)
Q Consensus       315 R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~---~~~~liG~~~~~i~~~~~  391 (468)
                      |.+...+.+-..+|=|  ||+++-..+| --.+-+.++|+=. |.. .-..+.+.+.+.   .+++.-..|.....+...
T Consensus       434 ~V~~~r~~G~~v~yGD--at~~~vL~~A-Gi~~Ar~vViaid-d~~-~~~~iv~~~r~~~P~l~IiaRard~~~~~~L~~  508 (615)
T PRK03562        434 HIETLRKFGMKVFYGD--ATRMDLLESA-GAAKAEVLINAID-DPQ-TNLQLTELVKEHFPHLQIIARARDVDHYIRLRQ  508 (615)
T ss_pred             HHHHHHHCCCEEEEEC--CCCHHHHHHC-CCCCCCEEEEEEC-CHH-HHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH
T ss_conf             9999996799089768--9999999867-9140688999949-899-999999999975899869998397788999997


Q ss_pred             CCCCEEEECCHHHHHHHHHHHHHH
Q ss_conf             689889987999999999999984
Q gi|254781099|r  392 GKINSTLSKTLDQALKSVVRDVEN  415 (468)
Q Consensus       392 ~~~~~~~~~~~~~a~~~i~~~~~~  415 (468)
                      ...+...-++++.+++...+..+.
T Consensus       509 ~Ga~~vv~Et~essL~l~~~~L~~  532 (615)
T PRK03562        509 AGVEKPERETFEGALKSGRLALES  532 (615)
T ss_pred             CCCCEEECCHHHHHHHHHHHHHHH
T ss_conf             899989666589999999999998


No 71 
>PRK06718 precorrin-2 dehydrogenase; Reviewed
Probab=97.30  E-value=0.0025  Score=42.06  Aligned_cols=129  Identities=18%  Similarity=0.124  Sum_probs=76.8

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHHHHHCC-CEEE--CCCCCCCCCCCEEEECCCCCCCCC
Q ss_conf             3218987999836854899999999859869998189-64788999789-8996--453157225888998888685675
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQAKDMG-IEVI--DFREIPWSIISFLVLSPGIALTGE   79 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g-~~~~--~~~~~~~~~~d~vv~Spgi~~~~~   79 (468)
                      =+++||+|+|+|-|.-+..=++.|.+.|+.|++.-.. .+.+..+...+ +...  .+....+.+.++||.+    .+++
T Consensus         6 l~l~gk~vLVVGGG~vA~rK~~~Ll~~gA~VtVvsp~~~~el~~l~~~~~i~~~~~~~~~~dl~~~~lViaA----T~d~   81 (202)
T PRK06718          6 IDLSNKRVVIVGGGKVAGRRAITLLKYGAHITVISPEITENLVKLVEEGKIRWKEKEFEPSDIVDAFLVIAA----TNDP   81 (202)
T ss_pred             EECCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCEEEECCCCHHHHCCCCEEEEC----CCCH
T ss_conf             982898699988989999999999868996999869999899999976994476167886675167044552----7989


Q ss_pred             CCCHHHHHHHHCCCEEE--EEHHHHHHHHHHCCCCCC-EEEEECCCCCCHH-HHHHHHHHHH
Q ss_conf             57888999997698099--830342233430156886-8996034575215-7899999987
Q gi|254781099|r   80 NAHWCVKLANQFNVEII--GDIELFVRERRFSSLQSP-FIAVTGTNGKSST-VALISHVLRK  137 (468)
Q Consensus        80 ~~~~~~~~a~~~gi~v~--s~~el~~~~~~~~~~~~~-vI~VTGT~GKTTt-~~ll~~iL~~  137 (468)
                      +.|..+.++.+.++.|-  .++++.--.........+ +||| .|+||+-+ +.+|..-+++
T Consensus        82 ~~N~~i~~~~~~~~lvNvvD~p~~~dFi~Paiv~rg~l~IaI-ST~G~SP~lAr~iR~~lE~  142 (202)
T PRK06718         82 RVNEAVAEALPENALFNVIGDAESGNVVFPSALHRGKLTISV-STDGASPKLAKKIRDELEA  142 (202)
T ss_pred             HHHHHHHHHHHHCCCEEECCCCCCCEEEEEEEEEECCEEEEE-ECCCCCHHHHHHHHHHHHH
T ss_conf             999999998654487575578654827874278529989999-8899783999999999998


No 72 
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric; InterPro: IPR006004    One pathway for the assimilation of ammonia and glutamate biosynthesis involves homotetrameric glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate .  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+. .
Probab=97.29  E-value=0.001  Score=44.75  Aligned_cols=92  Identities=26%  Similarity=0.415  Sum_probs=60.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEE-ECCCCCCCCCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             98799983685489999999985986999818964788999789899-64531572258889988886856755788899
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEV-IDFREIPWSIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~-~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
                      ++||+|+|.|-.|+++|.=|.++||+|++|..       |.+-|-.+ +...++-+..-  ||            .++++
T Consensus       142 ~~kVAViGaGPAGL~cA~elAk~Gh~VtvfEA-------LhKPGGV~~YGIPefRLpKe--i~------------~~E~k  200 (462)
T TIGR01316       142 KKKVAVIGAGPAGLACASELAKKGHEVTVFEA-------LHKPGGVLAYGIPEFRLPKE--IV------------ETEVK  200 (462)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHCCCEEEEEEE-------CCCCCCEEEECCCCCCCCHH--HH------------HHHHH
T ss_conf             87799984682146889999747986999971-------48998567536888548757--88------------98888


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHC-CC
Q ss_conf             99976980998303422334301568868996034575215789999998731000-00
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDV-QL  144 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~~-~~  144 (468)
                      +.++.|+.+..+.               +|      |||-|   |.+++++.|+++ |+
T Consensus       201 ~LkklGv~fr~~~---------------lv------Gkt~T---L~eL~~~YGfDAVFI  235 (462)
T TIGR01316       201 KLKKLGVKFRTDY---------------LV------GKTVT---LEELLEKYGFDAVFI  235 (462)
T ss_pred             HHHHCCEEEEECC---------------EE------CCCHH---HHHHHHHCCCCEEEE
T ss_conf             7632663799443---------------75------05112---888887519707999


No 73 
>PRK13243 glyoxylate reductase; Reviewed
Probab=97.27  E-value=0.0015  Score=43.53  Aligned_cols=82  Identities=11%  Similarity=0.178  Sum_probs=41.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEC-CCHHHHHHHH--CCCE--EECCC-CCC---CC-CCCE-EEECCCCCCC
Q ss_conf             8799983685489999999985986999818-9647889997--8989--96453-157---22-5888-9988886856
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDD-HPCAVKQAKD--MGIE--VIDFR-EIP---WS-IISF-LVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~-~~~~~~~l~~--~g~~--~~~~~-~~~---~~-~~d~-vv~Spgi~~~   77 (468)
                      +||+|.+ ... -+....|.+. ++|..+++ .+...+.+..  .+..  +.... ...   ++ ...+ +|...|+..+
T Consensus         3 ~Kvlvt~-~i~-~~~~~~L~~~-~~v~~~~~~~~~~~~~l~~~i~~~d~li~~~~~~i~~~~l~~ap~LK~I~~~gvG~D   79 (333)
T PRK13243          3 PRVFITR-EIP-ENGIEMLEEH-FEVEVWEDEREIPREVLLEKVKDVDALVTMLSERIDAEVFEAAPRLRIVANYAVGYD   79 (333)
T ss_pred             CEEEEEC-CCC-HHHHHHHHHC-CCEEEECCCCCCCHHHHHHHHCCCCEEEECCCCCCCHHHHHCCCCCEEEEECCCCCC
T ss_conf             7899969-889-9999999717-959992699999999999986798299985888588999946999809988574643


Q ss_pred             CCCCCHHHHHHHHCCCEEEE
Q ss_conf             75578889999976980998
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s   97 (468)
                      +-+    +.+++++||+|..
T Consensus        80 ~ID----~~~a~~~gI~V~n   95 (333)
T PRK13243         80 NID----VEEATKRGIYVTN   95 (333)
T ss_pred             CCC----HHHHHHCCCEEEE
T ss_conf             305----9999969978996


No 74 
>KOG0029 consensus
Probab=97.27  E-value=0.0015  Score=43.58  Aligned_cols=78  Identities=24%  Similarity=0.319  Sum_probs=52.3

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCC--EEEECCCCCCCCCCCCH
Q ss_conf             1898799983685489999999985986999818964788999789899645315722588--89988886856755788
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIIS--FLVLSPGIALTGENAHW   83 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d--~vv~Spgi~~~~~~~~~   83 (468)
                      -+.++|.|+|.|.+|+|+|+.|++.|++|.+.+.+.       ..|..+..+........|  .=++++      -..+|
T Consensus        13 ~~~~~VIVIGAGiaGLsAArqL~~~G~~V~VLEARd-------RvGGRI~t~~~~~~~~vd~Gas~~~g------~~~np   79 (501)
T KOG0029          13 GKKKKVIVIGAGLAGLSAARQLQDFGFDVLVLEARD-------RVGGRIYTFKSEGGDHVDLGASVLTG------VYNNP   79 (501)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC-------CCCCEEEEEECCCCCEEECCCCEECC------CCCCH
T ss_conf             788838998985789999999997598259997147-------76764778744898667147746517------78757


Q ss_pred             HHHHHHHCCCEEE
Q ss_conf             8999997698099
Q gi|254781099|r   84 CVKLANQFNVEII   96 (468)
Q Consensus        84 ~~~~a~~~gi~v~   96 (468)
                      +..-+++.|++..
T Consensus        80 l~~l~~qlgl~~~   92 (501)
T KOG0029          80 LALLSKQLGLELY   92 (501)
T ss_pred             HHHHHHHHCCCCC
T ss_conf             9999987496531


No 75 
>KOG0068 consensus
Probab=97.26  E-value=0.0019  Score=42.96  Aligned_cols=81  Identities=20%  Similarity=0.208  Sum_probs=36.5

Q ss_pred             EEEEEC-CCHHHHHHHHHHHHCCCEEEEEECCCHH-H-HHHHHCCCE-EECCCCCC---CC--CCCE-EEECCCCCCCCC
Q ss_conf             799983-6854899999999859869998189647-8-899978989-96453157---22--5888-998888685675
Q gi|254781099|r   10 SIAVFG-LGRSGLSAACALKDSGVHVIAWDDHPCA-V-KQAKDMGIE-VIDFREIP---WS--IISF-LVLSPGIALTGE   79 (468)
Q Consensus        10 ~v~i~G-~G~sG~s~A~~l~~~G~~V~~~D~~~~~-~-~~l~~~g~~-~~~~~~~~---~~--~~d~-vv~Spgi~~~~~   79 (468)
                      +|++.- ++   .+....|.+.|++|..+-..+.. + ..++....- +.......   ++  .-.+ +|---|+..++-
T Consensus         8 ~il~~e~~~---~~~~~~l~~~g~~v~~~~~~~~eel~~~i~~~~aviVrs~tkvtadvl~aa~~~lkvVgrag~G~dNV   84 (406)
T KOG0068           8 KILVAESLD---QACIEILKDNGYQVEFKKNLSLEELIEKIKDCDALIVRSKTKVTADVLEAAAGGLKVVGRAGIGVDNV   84 (406)
T ss_pred             EEEEECCCC---HHHHHHHHHCCCEEEEECCCCHHHHHHHHCCCCEEEEEECCEECHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             299843336---68899998517157886258989999986049889998577012999986038748998513575654


Q ss_pred             CCCHHHHHHHHCCCEEEE
Q ss_conf             578889999976980998
Q gi|254781099|r   80 NAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        80 ~~~~~~~~a~~~gi~v~s   97 (468)
                      +    +.+|-++||.|+.
T Consensus        85 D----L~AAte~gi~Vvn   98 (406)
T KOG0068          85 D----LKAATENGILVVN   98 (406)
T ss_pred             C----HHHHHHCCEEEEE
T ss_conf             7----2557757838995


No 76 
>TIGR00507 aroE shikimate 5-dehydrogenase; InterPro: IPR011342   The shikimate pathway links the metabolism of carbohydrates to the biosynthesis of aromatic compounds and is essential for the biosynthesis of aromatic amino acids and other aromatic compounds in bacteria, eukaryotic microorganisms and plants . It is a seven-step pathway which converts phosphoenolpyruvate and erythrose 4-phosphate to chorismate, the common precursor for the synthesis of folic acid, ubiquinone, vitamins E and K, and aromatic amino acids. Since this pathway is absent in metazoans, which must therefore obtain the essential amino acids phenylalanine and tryptophan from their diet, the enzymes in this pathway are important targets for the development of novel herbicides and antimicrobial compounds.   This entry represents shikimate 5-dehydrogenases from prokaryotes and functionally equivalent C-terminal domains from larger, multifunctional proteins, the majority of which have an N-terminal quinate dehydrogenase domain. These multifunctional proteins occur in plants, chlamydiae, planctomycetes and a limited number of marine proteobacteria. Shikimate 5-dehydrogenase catalyses the fourth step of the shikimate pathway, which is the NADP-dependent reduction of 3-dehydroshikimate to shikimate .   Structural studies suggests that some shikimate dehydrogenases are monmers while others form homodimers , . Each shikimate dehydrogenase monomer forms a compact two-domain alpha/beta sandwich with a deep interdomain cleft. The N-terminal substrate-binding domain forms a three layer alpha-beta-alpha sandwich, while the C-terminal NADP-binding domain forms a nearly typical Rossman fold. The active site is thought to be located within the interdomain cleft, with substrate binding causing a conformational change which closes the active site cleft, forming a productive active site.; GO: 0004764 shikimate 5-dehydrogenase activity, 0050661 NADP binding.
Probab=97.25  E-value=0.003  Score=41.51  Aligned_cols=77  Identities=18%  Similarity=0.304  Sum_probs=58.1

Q ss_pred             CHHHC-CCEEEEECCCHHHHHHHHHHHHC-CCEEEEEECCCHH----HHHHHH-----CCCEE-ECCCCCCCCC--CCEE
Q ss_conf             13218-98799983685489999999985-9869998189647----889997-----89899-6453157225--8889
Q gi|254781099|r    3 LSSFR-NHSIAVFGLGRSGLSAACALKDS-GVHVIAWDDHPCA----VKQAKD-----MGIEV-IDFREIPWSI--ISFL   68 (468)
Q Consensus         3 ~~~~~-~k~v~i~G~G~sG~s~A~~l~~~-G~~V~~~D~~~~~----~~~l~~-----~g~~~-~~~~~~~~~~--~d~v   68 (468)
                      |+.++ +|+|+|+|.|++++|+|.-|.+. +.+|.+.=+..+.    .+....     .|-.. .+..+.+...  +|+|
T Consensus       115 l~~l~~~~~~li~GAGGAa~a~a~~L~~~t~~~~~i~NRT~~ka~~La~~~~~kln~~~G~~~~~~~~~~~l~~G~~DlI  194 (286)
T TIGR00507       115 LSKLKPNQRVLIIGAGGAAKAVALELLKATDCNVIIANRTVEKAEELAERFQRKLNKKYGEIQAFSLDEVPLHKGKVDLI  194 (286)
T ss_pred             HHCCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCEEEE
T ss_conf             40368997799994286789999999860099789982877899999999898853424853652113355557856799


Q ss_pred             EE--CCCCCCCCC
Q ss_conf             98--888685675
Q gi|254781099|r   69 VL--SPGIALTGE   79 (468)
Q Consensus        69 v~--Spgi~~~~~   79 (468)
                      |=  |+|+.+..+
T Consensus       195 INATs~G~~~~~~  207 (286)
T TIGR00507       195 INATSAGMSGNID  207 (286)
T ss_pred             EECCCCCCCCCCC
T ss_conf             8546778888988


No 77 
>KOG0409 consensus
Probab=97.25  E-value=0.00059  Score=46.42  Aligned_cols=63  Identities=19%  Similarity=0.252  Sum_probs=56.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             987999836854899999999859869998189647889997898996453157225888998
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      .++|+++|+|.=|.+++.-|...||+|++||...+..+.+...|..+........+..|.||.
T Consensus        35 ~~~iGFIGLG~MG~~M~~nLik~G~kVtV~dr~~~k~~~f~~~Ga~v~~sPaeVae~sDvvit   97 (327)
T KOG0409          35 KTRIGFIGLGNMGSAMVSNLIKAGYKVTVYDRTKDKCKEFQEAGARVANSPAEVAEDSDVVIT   97 (327)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCHHHHCCHHHHHHHCCEEEE
T ss_conf             551357743411189999999759879999586788789997050140797999863688999


No 78 
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase. Shikimate dehydrogenase (DH) is an amino acid DH family member. Shikimate pathway links metabolism of carbohydrates to de novo biosynthesis of aromatic amino acids, quinones and folate. It is essential in plants, bacteria, and fungi but absent in mammals, thus making enzymes involved in this pathway ideal targets for broad spectrum antibiotics and herbicides. Shikimate DH catalyzes the reduction of 3-hydroshikimate to shikimate using the cofactor NADH. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann
Probab=97.24  E-value=0.0065  Score=39.22  Aligned_cols=43  Identities=16%  Similarity=0.319  Sum_probs=36.1

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHH
Q ss_conf             2189879998368548999999998598-699981896478899
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQA   47 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l   47 (468)
                      ++++|+|+|+|.|++++|++..|.+.|. ++.+++++.....++
T Consensus        16 ~~~~k~vlIlGaGGaarai~~aL~~~g~~~I~i~nR~~~r~~~l   59 (155)
T cd01065          16 ELKGKKVLILGAGGAARAVAYALAELGAAKIVIVNRTLEKAKAL   59 (155)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             85799999986758999999999971998228860899999999


No 79 
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed
Probab=97.23  E-value=0.0035  Score=41.10  Aligned_cols=52  Identities=19%  Similarity=0.158  Sum_probs=40.8

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             13218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |.+|+||.++|-|- ++-|.++|+.|.++|++|..+|.++...    ++++..+..+
T Consensus         1 M~~L~gK~alITGgs~GIG~aia~~la~~G~~V~~~~r~~~~~~~~~~~l~~~g~~~   57 (253)
T PRK12826          1 MRDLMGRVALVTGAARGIGRAIAVRFAADGADVIVVDICGQAAAATAELVAAAGGKA   57 (253)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCE
T ss_conf             998899889994897789999999999879989999898899999999998509958


No 80 
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional
Probab=97.23  E-value=0.0014  Score=43.90  Aligned_cols=69  Identities=23%  Similarity=0.260  Sum_probs=52.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC---------------------HHHHHHHHCCCEEECC--------
Q ss_conf             89879998368548999999998598699981896---------------------4788999789899645--------
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP---------------------CAVKQAKDMGIEVIDF--------   57 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~---------------------~~~~~l~~~g~~~~~~--------   57 (468)
                      .+++|+|+|.|-+|+++|-+|...||+|++++..+                     ..++.++.+|+++...        
T Consensus       305 ~~~kVAVIGsGPAGLs~A~~Lar~Gy~VTVFEalh~~GGvL~YGIPeFRLPK~IV~~EI~~l~~lGV~f~~n~~VGk~~t  384 (944)
T PRK12779        305 VKPPIAVVGSGPSGLINAYLLAVEGFPVTIFEAFHDLGGVLRYGIPEFRLPNQLIDDVVEKIKLLGGRFVKNFVVGKTAT  384 (944)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCEEEEECCEECCCCC
T ss_conf             79867998857689999999997799339994478788558955876668789999999999967839997856477688


Q ss_pred             -CCCCCCCCCEEEECCCCC
Q ss_conf             -315722588899888868
Q gi|254781099|r   58 -REIPWSIISFLVLSPGIA   75 (468)
Q Consensus        58 -~~~~~~~~d~vv~Spgi~   75 (468)
                       .+...+.+|.|++..|-.
T Consensus       385 l~eL~~eGydAVfIg~GAg  403 (944)
T PRK12779        385 LEDLKAEGFWKIFVGTGAG  403 (944)
T ss_pred             HHHHHHCCCCEEEEEECCC
T ss_conf             9999768999899974788


No 81 
>PRK06500 short chain dehydrogenase; Provisional
Probab=97.21  E-value=0.0036  Score=40.99  Aligned_cols=47  Identities=17%  Similarity=0.266  Sum_probs=39.4

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             13218987999836-854899999999859869998189647889997
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |.+|+||++.|-|. ++-|+++|+.|.++|++|..+|.++..+++..+
T Consensus         1 M~rl~gK~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~   48 (249)
T PRK06500          1 MSRLQGKTALITGGTSGIGLETARQFAAEGARVAITGRDAATLEAARA   48 (249)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             989899889993768789999999999879999999699899999999


No 82 
>PRK07060 short chain dehydrogenase; Provisional
Probab=97.19  E-value=0.0037  Score=40.90  Aligned_cols=50  Identities=24%  Similarity=0.329  Sum_probs=40.9

Q ss_pred             CCC-HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC
Q ss_conf             981-3218987999836-8548999999998598699981896478899978
Q gi|254781099|r    1 MKL-SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM   50 (468)
Q Consensus         1 m~~-~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~   50 (468)
                      |+| -+|+||++.|-|- ++-|+++|+.|.+.|++|..+|.+....+.+...
T Consensus         1 m~m~~~l~gK~~lVTG~~~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~~   52 (245)
T PRK07060          1 MNMAFDFSGKSVLVTGASSGIGRACAVALAARGARVVAAARNQADLDRLAGE   52 (245)
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH
T ss_conf             9997379999899947776899999999998799999997998999999986


No 83 
>PRK07097 gluconate 5-dehydrogenase; Provisional
Probab=97.19  E-value=0.0052  Score=39.87  Aligned_cols=137  Identities=13%  Similarity=0.127  Sum_probs=73.9

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEECC----CC------------
Q ss_conf             9813218987999836-8548999999998598699981896478----8999789899645----31------------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVIDF----RE------------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~~~----~~------------   59 (468)
                      ++|-+|+||.++|-|- ++-|+++|+.|.++|++|..+|.+...+    +.++..+.....+    .+            
T Consensus         3 ~~~f~l~gK~alVTG~s~GIG~aiA~~la~~Ga~Vii~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~   82 (265)
T PRK07097          3 ENMFSLKGKIALITGASYGIGFAIAKAYAEAGATIVFNDIKQELVDKGLAAYRELGIEAHGYVCDVTDEDGIQAMVAQIE   82 (265)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHH
T ss_conf             40419899989995857689999999999869999999599899999999999549917999932899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCHHHHHHH-HCCCEEEEEHHHH---HHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHH
Q ss_conf             572258889988886856755788899999-7698099830342---233430156886899603457521578999999
Q gi|254781099|r   60 IPWSIISFLVLSPGIALTGENAHWCVKLAN-QFNVEIIGDIELF---VRERRFSSLQSPFIAVTGTNGKSSTVALISHVL  135 (468)
Q Consensus        60 ~~~~~~d~vv~Spgi~~~~~~~~~~~~~a~-~~gi~v~s~~el~---~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL  135 (468)
                      ..+...|.+|-..|+....+-...-.+.-. -..+.+.+-+.+.   ...+.. ....+||-|+...|+.....+..+--
T Consensus        83 ~~~g~iDiLVnNAG~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~-~~~G~IVnisS~~~~~~~~~~~~Y~a  161 (265)
T PRK07097         83 KEVGVIDILVNNAGIIRRIPMLEMSAEDFRQVIDIDLNAPFIVSKAVLPSMIK-KGHGKIINICSMMSELGRETVSAYAA  161 (265)
T ss_pred             HHCCCCCEEEECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HCCCEEEEEECHHHCCCCCCCHHHHH
T ss_conf             98299989998998999988265999999999998607289999999998998-08975999905211567888668999


Q ss_pred             HHH
Q ss_conf             873
Q gi|254781099|r  136 RKN  138 (468)
Q Consensus       136 ~~~  138 (468)
                      .++
T Consensus       162 sKa  164 (265)
T PRK07097        162 AKG  164 (265)
T ss_pred             HHH
T ss_conf             999


No 84 
>pfam01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This family contains both shikimate and quinate dehydrogenases. Shikimate 5-dehydrogenase catalyses the conversion of shikimate to 5-dehydroshikimate. This reaction is part of the shikimate pathway which is involved in the biosynthesis of aromatic amino acids. Quinate 5-dehydrogenase catalyses the conversion of quinate to 5-dehydroquinate. This reaction is part of the quinate pathway where quinic acid is exploited as a source of carbon in prokaryotes and microbial eukaryotes. Both the shikimate and quinate pathways share two common pathway metabolites 3-dehydroquinate and dehydroshikimate.
Probab=97.19  E-value=0.0021  Score=42.66  Aligned_cols=74  Identities=14%  Similarity=0.257  Sum_probs=52.8

Q ss_pred             CCHHHCCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHHH-HCC---CEEECCCCCC--CCCCCEEEECCCC
Q ss_conf             8132189879998368548999999998598-6999818964788999-789---8996453157--2258889988886
Q gi|254781099|r    2 KLSSFRNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQAK-DMG---IEVIDFREIP--WSIISFLVLSPGI   74 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l~-~~g---~~~~~~~~~~--~~~~d~vv~Spgi   74 (468)
                      .++++.+|+|+|+|.|..|..++++|.+.|+ +|+.+-+.....+.+. ..+   +...++.+..  ...+|+||.+.+-
T Consensus         6 ~~~~l~~~~vlVIGaG~~~~~~~~~L~~~g~~~i~v~nRt~~ka~~la~~~~~~~~~~~~~~~l~~~l~~~DivI~aT~s   85 (134)
T pfam01488         6 IFGDLKGKKVLLIGAGEMARLAAKHLLSKGAKKITIANRTLEKAKELAEEFGGEEVEALPLDELEELLAEADIVISATSA   85 (134)
T ss_pred             HHCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCEEEEECHHHHHHHHHCCEEEEECCC
T ss_conf             63881489899999609999999999975998899954757899999998499725898513544136319999992599


Q ss_pred             C
Q ss_conf             8
Q gi|254781099|r   75 A   75 (468)
Q Consensus        75 ~   75 (468)
                      +
T Consensus        86 ~   86 (134)
T pfam01488        86 P   86 (134)
T ss_pred             C
T ss_conf             9


No 85 
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=97.19  E-value=0.0035  Score=41.09  Aligned_cols=77  Identities=23%  Similarity=0.288  Sum_probs=51.0

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH-H----HHHHHCCCEEE----CCCC------------C
Q ss_conf             13218987999836-854899999999859869998189647-8----89997898996----4531------------5
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA-V----KQAKDMGIEVI----DFRE------------I   60 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~-~----~~l~~~g~~~~----~~~~------------~   60 (468)
                      |.+|+||.+.|-|. ++-|.++|+.|.+.|++|...|.+... .    +.+...+.++.    +..+            .
T Consensus         2 m~~LkgK~~lITGas~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~   81 (250)
T PRK12825          2 MGSLSGRVALVTGAARGIGRAIALRLAAAGADVIVHPPSDEAAAEETVAAVEALGRRAQAVQADVTDAAALEAAVEELVE   81 (250)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             86609788999389558999999999987998999979887899999999985399489999418999999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCC
Q ss_conf             7225888998888685675
Q gi|254781099|r   61 PWSIISFLVLSPGIALTGE   79 (468)
Q Consensus        61 ~~~~~d~vv~Spgi~~~~~   79 (468)
                      .+...|.+|...|+....+
T Consensus        82 ~~g~iDilInnAg~~~~~~  100 (250)
T PRK12825         82 RFGAIDILVNNAGITGDGR  100 (250)
T ss_pred             HCCCCCEEEECCCCCCCCC
T ss_conf             7699989998998899989


No 86 
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit; InterPro: IPR006005    One pathway for the assimilation of ammonia and glutamate biosynthesis involves glutamate synthase (1.4.1.13 from EC) which transfers the amide group of glutamine to 2-oxoglutarate to yield two molecules of glutamate.  2 L-glutamate + NADP^+ = L-glutamine + 2-oxoglutarate + NADPH + H^+.    This describes a family in several archaeal and deeply branched bacterial lineages of a homotetrameric form of the NADPH-dependent or NADH-dependent glutamate synthase (1.4.1.13 from EC and 1.4.1.14 from EC respectively) small subunit. There is no corresponding large subunit. ; GO: 0016639 oxidoreductase activity acting on the CH-NH2 group of donors NAD or NADP as acceptor, 0006537 glutamate biosynthetic process.
Probab=97.17  E-value=0.00065  Score=46.12  Aligned_cols=72  Identities=22%  Similarity=0.289  Sum_probs=53.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC-----------------H-----HHHHHHHCCCEEECCC------
Q ss_conf             89879998368548999999998598699981896-----------------4-----7889997898996453------
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP-----------------C-----AVKQAKDMGIEVIDFR------   58 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~-----------------~-----~~~~l~~~g~~~~~~~------   58 (468)
                      -||+|+|+|-|-.|+|+|..|++.||.|++|.+..                 .     .+++|..+|+.+...-      
T Consensus       150 TGkkVAVVGSGPAGLAaA~qLnrAGH~VTVfER~DR~GGLL~YGIPnmKLdK~e~v~RRi~~l~aEG~~FvtnteiGdWd  229 (517)
T TIGR01317       150 TGKKVAVVGSGPAGLAAADQLNRAGHTVTVFEREDRVGGLLRYGIPNMKLDKEEIVDRRIDLLEAEGVDFVTNTEIGDWD  229 (517)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             78668997567579999999853588389974367888630248887433738899999999874784201783004653


Q ss_pred             C---------------CCCCCCCEEEECCCCCCCCCC
Q ss_conf             1---------------572258889988886856755
Q gi|254781099|r   59 E---------------IPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus        59 ~---------------~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      +               ...+++|.||+.  .....+.
T Consensus       230 enskitnlsk~di~~~~L~~~fDAVVLa--~Ga~~pR  264 (517)
T TIGR01317       230 ENSKITNLSKKDISADELKEDFDAVVLA--TGATKPR  264 (517)
T ss_pred             CCCCEECCCCCCCCHHHHHHHCCEEEEE--CCCCCCC
T ss_conf             4442000223426879987146938983--3788601


No 87 
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=97.17  E-value=0.016  Score=36.52  Aligned_cols=41  Identities=34%  Similarity=0.475  Sum_probs=35.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             87999836854899999999859869998189647889997
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      .+|+|+|+|--|+++|-.+..+|++|.|+|.++..++.+..
T Consensus        10 ~~I~ViGLGYVGLPlA~~fA~~G~~ViG~DIn~~~Vd~ln~   50 (436)
T COG0677          10 ATIGVIGLGYVGLPLAAAFASAGFKVIGVDINQKKVDKLNR   50 (436)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCEEEEECCHHHHHHHHC
T ss_conf             28999824644578899998769955757578899888757


No 88 
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]
Probab=97.16  E-value=0.0042  Score=40.51  Aligned_cols=83  Identities=23%  Similarity=0.265  Sum_probs=55.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH--CCCEEECC--------CCCCCCCCCEEEECCCCCCCC
Q ss_conf             87999836854899999999859869998189647889997--89899645--------315722588899888868567
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD--MGIEVIDF--------REIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~--~g~~~~~~--------~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      +++.|+|.|.-|.++|+.|.+.|++|...|+++....+...  .....+..        .+...+.+|.+|..-  .  +
T Consensus         1 m~iiIiG~G~vG~~va~~L~~~g~~Vv~Id~d~~~~~~~~~~~~~~~~v~gd~t~~~~L~~agi~~aD~vva~t--~--~   76 (225)
T COG0569           1 MKIIIIGAGRVGRSVARELSEEGHNVVLIDRDEERVEEFLADELDTHVVIGDATDEDVLEEAGIDDADAVVAAT--G--N   76 (225)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEEEEEECCCCHHHHHHCCCCCCCEEEEEE--C--C
T ss_conf             98999898578899999998789908999768899998632000449999268898999867986389999980--8--8


Q ss_pred             CCCCHHH-HHH-HHCCCEE
Q ss_conf             5578889-999-9769809
Q gi|254781099|r   79 ENAHWCV-KLA-NQFNVEI   95 (468)
Q Consensus        79 ~~~~~~~-~~a-~~~gi~v   95 (468)
                      .+.|..+ ..| ++.|+|-
T Consensus        77 d~~N~i~~~la~~~~gv~~   95 (225)
T COG0569          77 DEVNSVLALLALKEFGVPR   95 (225)
T ss_pred             CHHHHHHHHHHHHHCCCCE
T ss_conf             6799999999998739984


No 89 
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed
Probab=97.16  E-value=0.0068  Score=39.11  Aligned_cols=10  Identities=30%  Similarity=0.135  Sum_probs=4.5

Q ss_pred             CEEEEECCCH
Q ss_conf             8799983685
Q gi|254781099|r    9 HSIAVFGLGR   18 (468)
Q Consensus         9 k~v~i~G~G~   18 (468)
                      |.++++|-..
T Consensus         6 k~~gliG~pi   15 (275)
T PRK00258          6 DLYAVIGNPI   15 (275)
T ss_pred             CEEEEECCCC
T ss_conf             2899988882


No 90 
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain. This domain is inserted into the catalytic domain, the large dehydrogenase and D-lactate dehydrogenase families in SCOP. N-terminal portion of which is represented by family pfam00389.
Probab=97.13  E-value=0.0034  Score=41.12  Aligned_cols=110  Identities=22%  Similarity=0.330  Sum_probs=65.7

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             32189879998368548999999998598699981896478899978989964531572258889988886856755788
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHW   83 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~   83 (468)
                      .+++||+|+|+|+|..|..+|+.+...|.+|.++|..+...  ....+....+. +.....+|.|++.  +|.+ ++.+-
T Consensus        32 ~~L~gk~vgIiG~G~IG~~va~~l~~fg~~V~~~d~~~~~~--~~~~~~~~~~l-~~ll~~sDii~~~--~plt-~~T~~  105 (176)
T pfam02826        32 RELSGKTVGIIGLGRIGRAVARRLKAFGMKVIAYDRYPKAE--AEALGARYVSL-DELLAESDVVSLH--LPLT-PETRH  105 (176)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEECCCCCCH--HHHCCEEECCH-HHHHHHCCEEEEC--CCCC-CCCCC
T ss_conf             55799999998969999999999998398125437987610--23157166689-9998629988754--7674-20246


Q ss_pred             HHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             899999769809983034223343015688689960345752157899999987
Q gi|254781099|r   84 CVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRK  137 (468)
Q Consensus        84 ~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~  137 (468)
                                 +++.- .+..     . +...+=|-=+-|+.--..=|...|++
T Consensus       106 -----------li~~~-~l~~-----m-k~~a~lIN~sRG~ivde~aL~~aL~~  141 (176)
T pfam02826       106 -----------LINAE-RLAL-----M-KPGAILINTARGGLVDEDALIAALKS  141 (176)
T ss_pred             -----------CCCHH-HHHH-----H-CCCCEEEEECCCCCCCHHHHHHHHHH
T ss_conf             -----------34699-9985-----1-89988998067551289999999980


No 91 
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]
Probab=97.09  E-value=0.0056  Score=39.67  Aligned_cols=108  Identities=16%  Similarity=0.119  Sum_probs=68.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC-CEEEEEECCCHHHHHHHHCC---CEEECC--CCC-----CCCCCCEEEECCCCCCC
Q ss_conf             87999836854899999999859-86999818964788999789---899645--315-----72258889988886856
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG-VHVIAWDDHPCAVKQAKDMG---IEVIDF--REI-----PWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G-~~V~~~D~~~~~~~~l~~~g---~~~~~~--~~~-----~~~~~d~vv~Spgi~~~   77 (468)
                      ++|+|+|.|.-|.++|..|.+.| .+|++.|+.+....+.....   ++....  .+.     .+.+.|+||--  +|+.
T Consensus         2 ~~ilviGaG~Vg~~va~~la~~~d~~V~iAdRs~~~~~~i~~~~~~~v~~~~vD~~d~~al~~li~~~d~VIn~--~p~~   79 (389)
T COG1748           2 MKILVIGAGGVGSVVAHKLAQNGDGEVTIADRSKEKCARIAELIGGKVEALQVDAADVDALVALIKDFDLVINA--APPF   79 (389)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHCCCEEEEE--CCCH
T ss_conf             72899898666799999998578962999848888999987533466316994256758899987257789992--8705


Q ss_pred             CCCCCHHHHHHHHCCCEEE--EEHHHHHHHHHHCCCCCCEEEEEC
Q ss_conf             7557888999997698099--830342233430156886899603
Q gi|254781099|r   78 GENAHWCVKLANQFNVEII--GDIELFVRERRFSSLQSPFIAVTG  120 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~--s~~el~~~~~~~~~~~~~vI~VTG  120 (468)
                      ..  ...++++-+.|++++  |..+-.++.......++.+.+|+|
T Consensus        80 ~~--~~i~ka~i~~gv~yvDts~~~~~~~~~~~~a~~Agit~v~~  122 (389)
T COG1748          80 VD--LTILKACIKTGVDYVDTSYYEEPPWKLDEEAKKAGITAVLG  122 (389)
T ss_pred             HH--HHHHHHHHHHCCCEEECCCCCCHHHHHHHHHHHCCCEEECC
T ss_conf             42--99999999859988975467750656548988749079716


No 92 
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia asimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids t
Probab=97.09  E-value=0.026  Score=35.01  Aligned_cols=112  Identities=17%  Similarity=0.163  Sum_probs=63.4

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEE-EEECC-----C-----HHHHHHH---HC-C------------CEEEC
Q ss_conf             32189879998368548999999998598699-98189-----6-----4788999---78-9------------89964
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVI-AWDDH-----P-----CAVKQAK---DM-G------------IEVID   56 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~-~~D~~-----~-----~~~~~l~---~~-g------------~~~~~   56 (468)
                      .++++++|.|-|+|.-|..+|++|.+.|++|. ++|..     |     ..+..+.   .. +            .+.++
T Consensus        34 ~~l~g~~vaIQGfGnVG~~aA~~l~e~GakvVaVsD~~G~i~~~~Gld~~~l~~l~~~k~~~~~~~~~~~~~~~~~~~~~  113 (254)
T cd05313          34 ETLKGKRVAISGSGNVAQYAAEKLLELGAKVVTLSDSKGYVYDPDGFTGEKLAELKEIKEVRRGRVSEYAKKYGTAKYFE  113 (254)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHHHCCCCCHHHHHCCCCCEECC
T ss_conf             69589999998977999999999997799799998578508879999889999999999746871024441389856638


Q ss_pred             CCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             53157225888998888685675578889999976980998303422334301568868996034575215789999998
Q gi|254781099|r   57 FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLR  136 (468)
Q Consensus        57 ~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~  136 (468)
                      ..+.....+|.+|+.     ..+. ..--..|.              +.   ...++|+| |-|.||=||.-.  ..+|.
T Consensus       114 ~~~~~~~~cDIliPa-----A~en-~I~~~nA~--------------~i---~a~~ck~I-vEgANgP~T~eA--d~iL~  167 (254)
T cd05313         114 GKKPWEVPCDIAFPC-----ATQN-EVDAEDAK--------------LL---VKNGCKYV-AEGANMPCTAEA--IEVFR  167 (254)
T ss_pred             CCCHHHCCCCEEEEC-----CCCC-CCCHHHHH--------------HH---HHCCCEEE-EECCCCCCCHHH--HHHHH
T ss_conf             975133047699743-----5466-78999999--------------99---96798299-865889998789--99999


Q ss_pred             HHHHH
Q ss_conf             73100
Q gi|254781099|r  137 KNGYD  141 (468)
Q Consensus       137 ~~g~~  141 (468)
                      +.|..
T Consensus       168 ~kGI~  172 (254)
T cd05313         168 QAGVL  172 (254)
T ss_pred             HCCCE
T ss_conf             88988


No 93 
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=97.08  E-value=0.0055  Score=39.73  Aligned_cols=66  Identities=27%  Similarity=0.470  Sum_probs=51.1

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEEC
Q ss_conf             32189879998368548999999998598699981896478899978989964531572258889988
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLS   71 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~S   71 (468)
                      .++.||+++|+|+|..|..+|+.++..|.+|.+||-.-+ .......|++..+. +..+..+|+|.+-
T Consensus       134 ~eL~gktlGIiG~G~IG~~vA~~~~~fgm~Vi~yDP~~~-~~~~~~~gv~~~~l-~ell~~sD~IslH  199 (524)
T PRK13581        134 VELYGKTLGVIGLGRIGSEVAKRAKAFGMKVIAYDPYIS-PERAAQLGVELVEL-DELLARADFITLH  199 (524)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCC-HHHHHHCCCEEEEH-HHHHHHCCEEEEC
T ss_conf             213698899977675789999999854974788777644-66798719668608-9973108899993


No 94 
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]
Probab=97.08  E-value=0.005  Score=39.99  Aligned_cols=13  Identities=15%  Similarity=0.250  Sum_probs=8.1

Q ss_pred             HHHHHHHCCCCCC
Q ss_conf             2111000011221
Q gi|254781099|r  196 RHHTLENYVNIKK  208 (468)
Q Consensus       196 ~~~s~e~y~~aK~  208 (468)
                      ..|++.+|.....
T Consensus       118 ~~GGyaeyv~v~~  130 (339)
T COG1064         118 TDGGYAEYVVVPA  130 (339)
T ss_pred             ECCCCEEEEEECH
T ss_conf             0584211799765


No 95 
>PRK06545 prephenate dehydrogenase; Validated
Probab=97.06  E-value=0.0031  Score=41.47  Aligned_cols=63  Identities=25%  Similarity=0.326  Sum_probs=47.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEE--EEEECCCHHHHHHHHCCCEEE--CCCCCCCCCCCEEEEC
Q ss_conf             87999836854899999999859869--998189647889997898996--4531572258889988
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHV--IAWDDHPCAVKQAKDMGIEVI--DFREIPWSIISFLVLS   71 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V--~~~D~~~~~~~~l~~~g~~~~--~~~~~~~~~~d~vv~S   71 (468)
                      |+|.|+|+|.-|-|+|+.|+++|..+  .++|.++..+....+.|+.-.  .--+.....+|+||++
T Consensus         1 k~V~IiGlGLIGgSlalalk~~g~~~~i~~~d~~~~~l~~A~~~g~id~~~~~~~~~~~~~DlVvla   67 (357)
T PRK06545          1 KTVLIVGLGLIGGSLALAIKAAGPDVFIIGYDPSGAQLARALGFGVIDELAEDLARAAAEADLIVLA   67 (357)
T ss_pred             CEEEEEEECHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHCCCCCEECCCHHHHCCCCCEEEEC
T ss_conf             9799997787899999999854997699996699999999986899773048876715679999994


No 96 
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NAD(P)+. This subfamily includes glutamate, leucine, phenylalanine, and valine DHs. Glutamate DH is a multi-domain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms.  Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent.  As in other NAD+-dependent DHs, monomers in this family have 2 domains separated by a deep cleft. Here the c-terminal domain contains a modified NAD-binding Rossmann fold with 7 rather than the usual 6 beta strands and one strand anti-parral
Probab=97.05  E-value=0.018  Score=36.21  Aligned_cols=108  Identities=20%  Similarity=0.255  Sum_probs=63.7

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEE-EEEECC----------CHHHHHHHHCCCEE-------ECCCCCCCCCC
Q ss_conf             3218987999836854899999999859869-998189----------64788999789899-------64531572258
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHV-IAWDDH----------PCAVKQAKDMGIEV-------IDFREIPWSII   65 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V-~~~D~~----------~~~~~~l~~~g~~~-------~~~~~~~~~~~   65 (468)
                      .+++|++|.|-|+|.-|..+|++|.+.|.+| .++|.+          +..+......+...       ++..+.....+
T Consensus        19 ~~l~g~~vaVqGfGnVG~~~a~~l~~~GakvvavsD~~G~i~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (217)
T cd05211          19 DSLEGLTVAVQGLGNVGWGLAKKLAEEGGKVLAVSDPDGYIYDPGITTEELINYAVALGGSARVKVQDYFPGEAILGLDV   98 (217)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             68579999998988999999999998599899998578717789998699999999818965366653059865003677


Q ss_pred             CEEEECCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             889988886856755788899999769809983034223343015688689960345752157899999987310
Q gi|254781099|r   66 SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus        66 d~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      |++++. ++.....     -..|.+                    -++++| +-|.||=||--.  ..+|.+.|.
T Consensus        99 DIliPa-Al~~~I~-----~~~a~~--------------------i~ak~I-~EgAN~P~t~ea--~~iL~~rgI  144 (217)
T cd05211          99 DIFAPC-ALGNVID-----LENAKK--------------------LKAKVV-AEGANNPTTDEA--LRILHERGI  144 (217)
T ss_pred             CEEEEC-CCCCCCC-----HHHHHH--------------------HCCEEE-ECCCCCCCCHHH--HHHHHHCCC
T ss_conf             689642-4458879-----899987--------------------177289-506789989789--999997899


No 97 
>PRK12742 oxidoreductase; Provisional
Probab=97.03  E-value=0.015  Score=36.71  Aligned_cols=40  Identities=18%  Similarity=0.214  Sum_probs=33.3

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             13218987999836-85489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |..|+||+++|-|- ++-|.++|+.|.+.|++|.....+..
T Consensus         1 M~~l~gK~alITGas~GIG~aia~~la~~Ga~V~i~~~~~~   41 (237)
T PRK12742          1 MGAFTGKSVLVLGGSRGIGAAIVRRFVTDGANVVFTYAGSK   41 (237)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCH
T ss_conf             99989998999278879999999999987999999779998


No 98 
>PRK06125 short chain dehydrogenase; Provisional
Probab=97.03  E-value=0.013  Score=37.10  Aligned_cols=45  Identities=22%  Similarity=0.302  Sum_probs=36.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |.| +|+||+++|-|- ++-|.++|+.|.+.|++|..+|.+...+.+
T Consensus         1 M~~-~l~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~   46 (259)
T PRK06125          1 MDL-HLAGKRVLITGASKGIGAAAAEAFAAEGCHLVLAARDADALAA   46 (259)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             998-8699989996877689999999999879989999798899999


No 99 
>pfam02254 TrkA_N TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.
Probab=96.99  E-value=0.0055  Score=39.73  Aligned_cols=60  Identities=28%  Similarity=0.406  Sum_probs=48.4

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCC--------CCCCCCCCEEEEC
Q ss_conf             999836854899999999859869998189647889997898996453--------1572258889988
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR--------EIPWSIISFLVLS   71 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~--------~~~~~~~d~vv~S   71 (468)
                      |.|+|+|..|..+|+.|.++| +|.+.|.++.....+...+..++...        +...+.++.+|..
T Consensus         1 viI~G~g~~G~~la~~L~~~~-~v~vId~d~~~~~~~~~~~~~vi~GD~~~~~~L~~a~i~~a~~vi~~   68 (115)
T pfam02254         1 IIIIGYGRVGRSLAEELREGG-PVVVIDKDPERVEELREEGVPVVVGDATDEEVLEEAGIEDADAVVAA   68 (115)
T ss_pred             CEEECCCHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHCCCEEEEEECCCHHHHHHHCCCCCCEEEEE
T ss_conf             999878889999999998089-99999998799877886698699995688667876192028799996


No 100
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism]
Probab=96.99  E-value=0.0017  Score=43.18  Aligned_cols=66  Identities=26%  Similarity=0.335  Sum_probs=39.1

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEEC
Q ss_conf             2189879998368548999999998598699981896478899978989964531572258889988
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLS   71 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~S   71 (468)
                      ++.||+|+|+|+|.-|..+|+.+...|.+|.+||...+.. .....+......-+..+...|+|+..
T Consensus       139 el~gkTvGIiG~G~IG~~va~~l~afgm~v~~~d~~~~~~-~~~~~~~~~~~~Ld~lL~~aDiv~lh  204 (324)
T COG0111         139 ELAGKTVGIIGLGRIGRAVAKRLKAFGMKVIGYDPYSPRE-RAGVDGVVGVDSLDELLAEADILTLH  204 (324)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCCC-CCCCCCCEECCCHHHHHHHCCEEEEC
T ss_conf             0169889998987899999999986798699988988600-01235631102699998769999983


No 101
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional
Probab=96.99  E-value=0.0065  Score=39.24  Aligned_cols=77  Identities=19%  Similarity=0.246  Sum_probs=52.9

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH----HHHHHHCCCEEECCCC----------------CC
Q ss_conf             13218987999836-854899999999859869998189647----8899978989964531----------------57
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVIDFRE----------------IP   61 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~----~~~l~~~g~~~~~~~~----------------~~   61 (468)
                      |++|+||.++|-|- .+-|.++|+.|.++|++|..+|.+...    ..++...|.+...+..                ..
T Consensus         2 m~~l~gKvalVTGgs~GIG~a~A~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dvt~~~~v~~~v~~~~~~   81 (262)
T PRK13394          2 MSNLNGKTAVVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVADEINKAGGKAIGVAMDVTNEDAVNAGIDKVAER   81 (262)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             97889998999585778999999999987999999979889999999999962993999981589999999999999998


Q ss_pred             CCCCCEEEECCCCCCCCC
Q ss_conf             225888998888685675
Q gi|254781099|r   62 WSIISFLVLSPGIALTGE   79 (468)
Q Consensus        62 ~~~~d~vv~Spgi~~~~~   79 (468)
                      +..+|.+|-..|+....|
T Consensus        82 ~G~iDiLVnnAG~~~~~~   99 (262)
T PRK13394         82 FGSVDILVSNAGIQIVNP   99 (262)
T ss_pred             HCCCCEEEECCCCCCCCC
T ss_conf             199999998998899999


No 102
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism]
Probab=96.99  E-value=0.0029  Score=41.68  Aligned_cols=114  Identities=16%  Similarity=0.181  Sum_probs=72.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH-HHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHH
Q ss_conf             87999836854899999999859869998189647-88999789899645315722588899888868567557888999
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-VKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKL   87 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~-~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~   87 (468)
                      .+|+++|+|.=|.++|.-|.+.|+.|.+||..+.. ...+...|.....-........|+||..  ++ +.+    .+..
T Consensus         1 ~kIafIGLG~MG~pmA~~L~~aG~~v~v~~r~~~ka~~~~~~~Ga~~a~s~~eaa~~aDvVitm--v~-~~~----~V~~   73 (286)
T COG2084           1 MKIAFIGLGIMGSPMAANLLKAGHEVTVYNRTPEKAAELLAAAGATVAASPAEAAAEADVVITM--LP-DDA----AVRA   73 (286)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCEECCCHHHHHHHCCEEEEE--CC-CHH----HHHH
T ss_conf             9079985735259999999977987899808856656899972980038899999619989996--17-989----9999


Q ss_pred             HHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             997698099830342233430156886899603457521578999999873100
Q gi|254781099|r   88 ANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        88 a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
                      ..- |     +-.++     ....+.+++--..|..-+++.. ++..+++.|..
T Consensus        74 V~~-g-----~~g~~-----~~~~~G~i~IDmSTisp~~a~~-~a~~~~~~G~~  115 (286)
T COG2084          74 VLF-G-----ENGLL-----EGLKPGAIVIDMSTISPETARE-LAAALAAKGLE  115 (286)
T ss_pred             HHH-C-----CCCHH-----HCCCCCCEEEECCCCCHHHHHH-HHHHHHHCCCC
T ss_conf             981-8-----53353-----3378997899878999899999-99999966986


No 103
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1. Amino acid dehydrogenase (DH) is a widely distributed family of enzymes that catalyzes the oxidative deamination of an amino acid to its keto acid and ammonia with concomitant reduction of NADP+. Glutamate DH is a multidomain enzyme that catalyzes the reaction from glutamate to 2-oxyoglutarate and ammonia in the presence of NAD or NADP. It is present in all organisms. Enzymes involved in ammonia assimilation are typically NADP+-dependent, while those involved in glutamate catabolism are generally NAD+-dependent. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids 
Probab=96.98  E-value=0.031  Score=34.51  Aligned_cols=108  Identities=23%  Similarity=0.300  Sum_probs=63.3

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEE-EEECC-----C-----HHHHHHHHCCCEE--------ECCCCCCCCC
Q ss_conf             32189879998368548999999998598699-98189-----6-----4788999789899--------6453157225
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVI-AWDDH-----P-----CAVKQAKDMGIEV--------IDFREIPWSI   64 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~-~~D~~-----~-----~~~~~l~~~g~~~--------~~~~~~~~~~   64 (468)
                      .++++|+|.|-|+|.-|..+|++|.+.|++|. ++|.+     |     ..+.......-.+        ++..+.....
T Consensus        27 ~~l~g~~v~IqG~GnVG~~~a~~L~~~Gakvv~vsD~~G~i~~~~Gld~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (227)
T cd01076          27 IGLAGARVAIQGFGNVGSHAARFLHEAGAKVVAVSDSDGTIYNPDGLDVPALLAYKKEHGSVLGFPGAERITNEELLELD  106 (227)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCHHCCC
T ss_conf             89789999998988999999999998799599998478738888889999999999965980267887538962310478


Q ss_pred             CCEEEECCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             8889988886856755788899999769809983034223343015688689960345752157899999987310
Q gi|254781099|r   65 ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus        65 ~d~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      +|+.++. +++....     -..+.+                    -++|+| +-|.||=+|..+  ..+|++.|.
T Consensus       107 ~DI~iP~-A~~~~I~-----~~~a~~--------------------l~ak~I-~EgAN~p~t~~A--~~~L~~rgI  153 (227)
T cd01076         107 CDILIPA-ALENQIT-----ADNADR--------------------IKAKII-VEAANGPTTPEA--DEILHERGV  153 (227)
T ss_pred             CCEEEEC-CCCCCCC-----HHHHHH--------------------CCCEEE-EECCCCCCCHHH--HHHHHHCCC
T ss_conf             8789877-7669779-----999854--------------------476199-845789989889--999998869


No 104
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism]
Probab=96.98  E-value=0.0019  Score=42.91  Aligned_cols=68  Identities=21%  Similarity=0.271  Sum_probs=48.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC--CCHHHHHHHHCCCEEE---CCCCCCCCCCCEEEECCCCCCC
Q ss_conf             98799983685489999999985986999818--9647889997898996---4531572258889988886856
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDD--HPCAVKQAKDMGIEVI---DFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~--~~~~~~~l~~~g~~~~---~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      .++|+|+|+|.-|.++|+.|...|+.|.+++.  .....+....+|+..-   ..........|+||+|  +|..
T Consensus         3 ~~~v~IvG~GliG~s~a~~l~~~g~~v~i~g~d~~~~~~~~a~~lgv~d~~~~~~~~~~~~~aDlViva--vPi~   75 (279)
T COG0287           3 SMKVGIVGLGLMGGSLARALKEAGLVVRIIGRDRSAATLKAALELGVIDELTVAGLAEAAAEADLVIVA--VPIE   75 (279)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHCCCCHHHCCCHHHHHCCCCCEEEEE--CCHH
T ss_conf             648999877467799999999769847997247746778776635853010011555413569989995--7788


No 105
>PRK05868 hypothetical protein; Validated
Probab=96.97  E-value=0.0028  Score=41.77  Aligned_cols=34  Identities=29%  Similarity=0.372  Sum_probs=31.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             8799983685489999999985986999818964
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |+|+|+|.|.+|+++|..|++.|++|+++++.|.
T Consensus         2 ~kVlIvGaGiAGlalA~~L~r~G~~VtV~Er~p~   35 (372)
T PRK05868          2 KTVLVSGASVAGTAAAYWLGRHGYSVTMVERHPG   35 (372)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             9999989888999999999858998899957999


No 106
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase.
Probab=96.94  E-value=0.014  Score=36.84  Aligned_cols=109  Identities=24%  Similarity=0.241  Sum_probs=63.9

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEE-EC-----CC-----HHHHHH-HHCCCEEE----------CCCCC
Q ss_conf             13218987999836854899999999859869998-18-----96-----478899-97898996----------45315
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAW-DD-----HP-----CAVKQA-KDMGIEVI----------DFREI   60 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~-D~-----~~-----~~~~~l-~~~g~~~~----------~~~~~   60 (468)
                      ++++++++|.|-|+|.-|..+|++|.+.|++|.+. |.     +|     +.+..+ +..+..+.          +..+.
T Consensus        27 ~~~l~g~~v~IqGfGnVG~~~a~~l~~~GakvvavsD~~G~i~~~~Gldi~~l~~~~~~~~~~~~~~~~~~~~~i~~~~~  106 (237)
T pfam00208        27 GDSLEGKTVAVQGFGNVGSYAAEKLLELGAKVVAVSDSSGYIYDPNGIDIEELLELKEEGGGRVVEYAGSGAEYISGEEL  106 (237)
T ss_pred             CCCCCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCEEECCCCCCHHHHHHHHHHHCCEEECCCCCCCEECCCCCC
T ss_conf             99878999999898899999999999879969999828767999999999999999997198431246657534487100


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             72258889988886856755788899999769809983034223343015688689960345752157899999987310
Q gi|254781099|r   61 PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus        61 ~~~~~d~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      ....+|+.++. +++....     -..+.+                    -++|+| +-|.||=||--+-  .+|.+.|.
T Consensus       107 ~~~~~DIliPa-A~~~~I~-----~~na~~--------------------i~ak~I-~EgAN~p~t~eA~--~~L~~rgI  157 (237)
T pfam00208       107 WEIDCDILVPC-ATQNEIN-----EENAKL--------------------IKAKAV-VEGANMPTTPEAD--EILEERGI  157 (237)
T ss_pred             CCCCCCEEEEC-CCCCCCC-----HHHHHH--------------------CCCCEE-EECCCCCCCHHHH--HHHHHCCC
T ss_conf             04766688644-5568899-----899986--------------------275489-7537898897899--99998899


No 107
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]
Probab=96.93  E-value=0.023  Score=35.47  Aligned_cols=41  Identities=15%  Similarity=0.301  Sum_probs=25.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHH
Q ss_conf             89879998368548999999998598-699981896478899
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQA   47 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l   47 (468)
                      ++++++|+|.|+++++++..|.+.|. +++++.+..+...+|
T Consensus       125 ~~~~vlilGAGGAarAv~~aL~~~g~~~i~V~NRt~~ra~~L  166 (283)
T COG0169         125 TGKRVLILGAGGAARAVAFALAEAGAKRITVVNRTRERAEEL  166 (283)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHH
T ss_conf             788899989768999999999986998799995888999999


No 108
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus. NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate. This family represents the N-terminal NAD-binding domain.
Probab=96.93  E-value=0.0047  Score=40.21  Aligned_cols=43  Identities=26%  Similarity=0.381  Sum_probs=37.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCC
Q ss_conf             8799983685489999999985986999818964788999789
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMG   51 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g   51 (468)
                      |||+|+|.|-=|.++|..|.+.|++|..|+.++...+.+....
T Consensus         1 kKI~IiGaG~wGtAla~~la~n~~~V~l~~r~~~~~~~i~~~~   43 (159)
T pfam01210         1 KKIAVLGAGSWGTALAKVLARNGHEVRLWGRDEELIEEINTTR   43 (159)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHCC
T ss_conf             9899999699999999999987998999990436667788669


No 109
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional
Probab=96.92  E-value=0.0043  Score=40.45  Aligned_cols=50  Identities=32%  Similarity=0.484  Sum_probs=44.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECC
Q ss_conf             98799983685489999999985986999818964788999789899645
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF   57 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~   57 (468)
                      --||+|+|.|..|+.++...+..|+.|.++|.++...++.+++|.++...
T Consensus       165 PAkVlViGaGVAGlqAi~tA~~LGA~V~a~DvR~~~~EqveSlGa~fv~v  214 (510)
T PRK09424        165 PAKVLVIGAGVAGLAAIGAAGSLGAIVRAFDTRPEVKEQVESMGAEFLEL  214 (510)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCEEEE
T ss_conf             85289974647779999999627978999658788999999706742552


No 110
>PRK07814 short chain dehydrogenase; Provisional
Probab=96.91  E-value=0.0082  Score=38.53  Aligned_cols=78  Identities=14%  Similarity=0.177  Sum_probs=51.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEECC----CC------------
Q ss_conf             9813218987999836-8548999999998598699981896478----8999789899645----31------------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVIDF----RE------------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~~~----~~------------   59 (468)
                      |++-+|+||.++|-|- ++-|.++|+.|.++|++|...|.+...+    ++++..|.+....    .+            
T Consensus         3 ~~~~~L~gKvalITGgs~GIG~aia~~la~~Ga~V~i~~~~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~   82 (263)
T PRK07814          3 LDRFRLDGQVAVVTGAGRGLGAAIALAFAEAGADVLIAARTESQLDEVAEQIRAAGRRAHVVAADLAHPEATAGLAGQAV   82 (263)
T ss_pred             CHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHH
T ss_conf             02008999989995896689999999999879989999698999999999998529928999815899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCC
Q ss_conf             5722588899888868567
Q gi|254781099|r   60 IPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        60 ~~~~~~d~vv~Spgi~~~~   78 (468)
                      ..+...|.+|-+-|+....
T Consensus        83 ~~~G~iDiLVnNAg~~~~~  101 (263)
T PRK07814         83 EAFGRLDIVVNNVGGTMPN  101 (263)
T ss_pred             HHHCCCCEEEECCCCCCCC
T ss_conf             9829988999898667888


No 111
>PRK07208 hypothetical protein; Provisional
Probab=96.90  E-value=0.0019  Score=42.93  Aligned_cols=35  Identities=31%  Similarity=0.559  Sum_probs=32.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ++|+|+|+|.|.+|+++|..|.++|++|.+.+..+
T Consensus         2 ~~kkv~IiGAG~~GL~aA~~L~~~g~~v~vlEk~~   36 (474)
T PRK07208          2 EKKSVVIIGAGPAGLTAAYELVKRGYPVTILEADP   36 (474)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             98759998976899999999986899759997899


No 112
>PRK07062 short chain dehydrogenase; Provisional
Probab=96.90  E-value=0.012  Score=37.27  Aligned_cols=78  Identities=17%  Similarity=0.230  Sum_probs=48.5

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHC--CCEEE----CCCC----------
Q ss_conf             9813218987999836-85489999999985986999818964788----99978--98996----4531----------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDM--GIEVI----DFRE----------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~--g~~~~----~~~~----------   59 (468)
                      |---+|+||.++|-|- ++-|+++|+.|.+.|++|..+|.++..+.    ++...  +.++.    +..+          
T Consensus         1 mm~~~L~gK~alITG~s~GIG~a~a~~la~~Ga~Vvi~~r~~~~l~~~~~~l~~~~~~~~~~~~~~Dvt~~~~v~~~v~~   80 (265)
T PRK07062          1 MMQIQLEGRVAVVTGGSSGIGLATVELLLEAGASVAICGRDEERLASAEARLREKFPGARLLAARCDVLDEADVAAFAAA   80 (265)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             99778899989995757799999999999879999999798899999999998736996599997579999999999999


Q ss_pred             --CCCCCCCEEEECCCCCCCC
Q ss_conf             --5722588899888868567
Q gi|254781099|r   60 --IPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        60 --~~~~~~d~vv~Spgi~~~~   78 (468)
                        ..+..+|.+|-..|+....
T Consensus        81 ~~~~~G~iDiLVnNAg~~~~~  101 (265)
T PRK07062         81 VEARFGGVDMLVNNAGQGRVS  101 (265)
T ss_pred             HHHHHCCCCEEEECCCCCCCC
T ss_conf             999839988899778888988


No 113
>PRK07236 hypothetical protein; Provisional
Probab=96.89  E-value=0.0016  Score=43.46  Aligned_cols=40  Identities=25%  Similarity=0.357  Sum_probs=35.4

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             1321898799983685489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |+...+.||.|+|.|.+|+++|.+|.++|++|+++++.+.
T Consensus         1 ~~~~~~~kV~IVGaGiaGL~~A~~L~~~G~~v~v~Er~~~   40 (386)
T PRK07236          1 MTHMSKPRAVVVGGSLGGLFAANLLRRAGWDVDVFERSPT   40 (386)
T ss_pred             CCCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             9989999689999368999999999858999899868998


No 114
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=96.89  E-value=0.009  Score=38.25  Aligned_cols=54  Identities=17%  Similarity=0.227  Sum_probs=42.1

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC--HHHHHHHHCCCEE
Q ss_conf             9813218987999836-8548999999998598699981896--4788999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~--~~~~~l~~~g~~~   54 (468)
                      |+|-+|+||.+.|-|- ++-|+++|+.|.+.|++|.+.|...  .....++..|.+.
T Consensus         1 m~~f~L~gKvalVTGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~g~~~   57 (251)
T PRK12481          1 MQLFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPETQAQVEALGRKF   57 (251)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCE
T ss_conf             976289999899948676899999999998699999978987199999999759947


No 115
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=96.86  E-value=0.0098  Score=37.99  Aligned_cols=50  Identities=24%  Similarity=0.319  Sum_probs=38.6

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH----HHHCCCEE
Q ss_conf             218987999836-854899999999859869998189647889----99789899
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ----AKDMGIEV   54 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~----l~~~g~~~   54 (468)
                      +|+||.+.|-|- ++-|.++|+.|.++|++|..+|.++..+++    +...+.++
T Consensus         2 ~L~~Kv~lITGgs~GIG~a~a~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~   56 (246)
T PRK05653          2 SLQGKTALVTGASRGIGRAIALRLAADGARVVIYDSNEEAAEALAEELRAAGGEA   56 (246)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             9899889993897589999999999879999999799999999999999659948


No 116
>PRK12480 D-lactate dehydrogenase; Provisional
Probab=96.84  E-value=0.0044  Score=40.41  Aligned_cols=32  Identities=19%  Similarity=0.087  Sum_probs=20.7

Q ss_pred             CEEEEECCCHHHHHH-HHHHHHCCCEEEEEECC
Q ss_conf             879998368548999-99999859869998189
Q gi|254781099|r    9 HSIAVFGLGRSGLSA-ACALKDSGVHVIAWDDH   40 (468)
Q Consensus         9 k~v~i~G~G~sG~s~-A~~l~~~G~~V~~~D~~   40 (468)
                      .||.+++.-.-=... .++..+.+++|...+..
T Consensus         2 ~Ki~~~~~~~~e~~~~~~~~~~~~~e~~~~~~~   34 (330)
T PRK12480          2 TKIMFFGTRDYEKEMALNWGKKNNVEVTTSKEL   34 (330)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCEEEEEECCC
T ss_conf             669998376866999999887749069995698


No 117
>CHL00194 ycf39 Ycf39; Provisional
Probab=96.82  E-value=0.018  Score=36.17  Aligned_cols=62  Identities=19%  Similarity=0.134  Sum_probs=47.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECC--CCC-----CCCCCCEEEEC
Q ss_conf             7999836-85489999999985986999818964788999789899645--315-----72258889988
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF--REI-----PWSIISFLVLS   71 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~--~~~-----~~~~~d~vv~S   71 (468)
                      +|+|.|. |-.|..+++.|.++|++|.+.-++|.....++..|+++...  .+.     ..++.|.||..
T Consensus         2 ~ILV~GATG~lGr~vVr~Ll~~G~~Vr~lvRnp~ka~~l~~~Gve~v~gDl~dpesl~~Al~GvdaVi~~   71 (319)
T CHL00194          2 SLLVIGATGTLGRQIVRRALDEGYQVKCLVRNLRKAAFLKEWGAELVYGDLSLPETIPPALEGITAIIDA   71 (319)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCEEEEECCCCHHHHHHHHCCCCEEEEE
T ss_conf             7999899858999999999968890899957867632342159679994278877899996599679994


No 118
>PRK12939 short chain dehydrogenase; Provisional
Probab=96.80  E-value=0.012  Score=37.36  Aligned_cols=78  Identities=22%  Similarity=0.173  Sum_probs=52.1

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEECC----CC------------
Q ss_conf             9813218987999836-8548999999998598699981896478----8999789899645----31------------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVIDF----RE------------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~~~----~~------------   59 (468)
                      |. .+|+||.+.|-|- ++-|.++|+.|.+.|++|..+|.+....    +.++..|.++...    .+            
T Consensus         1 M~-~~L~~KvalVTGgs~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~~~~~~~~~~   79 (250)
T PRK12939          1 MA-SSLAGKRALVTGAARGLGAAFAEALAEAGATVAFNDGLAAEARELAAALEAAGGRAHAIAADLADPASVQRFFDAAA   79 (250)
T ss_pred             CC-CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHH
T ss_conf             99-99999879995836689999999999879999999698899999999999559909999924899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCCC
Q ss_conf             57225888998888685675
Q gi|254781099|r   60 IPWSIISFLVLSPGIALTGE   79 (468)
Q Consensus        60 ~~~~~~d~vv~Spgi~~~~~   79 (468)
                      ..+...|.+|-.-|+....+
T Consensus        80 ~~~g~iDiLVNNAG~~~~~~   99 (250)
T PRK12939         80 AALGGLDGLVNNAGITNSKS   99 (250)
T ss_pred             HHCCCCCEEEECCCCCCCCC
T ss_conf             97499979998877899999


No 119
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain.
Probab=96.79  E-value=0.0036  Score=41.03  Aligned_cols=68  Identities=26%  Similarity=0.371  Sum_probs=56.2

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCC
Q ss_conf             898799983685489999999985986999818964788999789899645315722588899888868
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIA   75 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~   75 (468)
                      -||++.|+|+|.-|.++|+.|+.+|.+|.++|..|-...+....|..+....+. ....|++|-+-|-.
T Consensus        22 aGk~vvV~GYG~~GkGvA~~~rg~Ga~V~V~EvDPi~aleA~mdGf~V~~~~ea-~~~aDi~VTaTG~~   89 (162)
T pfam00670        22 AGKVAVVCGYGDVGKGCAASLKGQGARVIVTEIDPICALQAAMEGFQVVTLEEV-VKKADIFVTTTGNK   89 (162)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHCCCCEEEEEECCCHHHHHHHHCCCCCCCHHHH-HHCCCEEEECCCCC
T ss_conf             487899967876677799986229998999947930699998649954788898-60499999924897


No 120
>PRK06847 hypothetical protein; Provisional
Probab=96.79  E-value=0.0023  Score=42.38  Aligned_cols=36  Identities=31%  Similarity=0.418  Sum_probs=32.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             898799983685489999999985986999818964
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      .=|+|.|+|.|.+|+++|..|.++|++|.++|..+.
T Consensus         3 ~~kkV~IVGaG~aGL~lA~~L~~~Gi~v~V~E~~~~   38 (375)
T PRK06847          3 AVKKVLIVGGGIGGMSAAIALRKAGISVDLVEIDPE   38 (375)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             998799999668999999999967999999908999


No 121
>PRK09072 short chain dehydrogenase; Provisional
Probab=96.77  E-value=0.0087  Score=38.33  Aligned_cols=45  Identities=16%  Similarity=0.245  Sum_probs=38.1

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             218987999836-854899999999859869998189647889997
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      +++||.|+|-|. ++-|.++|+.|.++|++|..++.++..++++..
T Consensus         2 ~l~~K~vlITGassGIG~a~A~~la~~G~~vil~~R~~~~L~~~~~   47 (262)
T PRK09072          2 DLKDKRVLLTGASGGIGEALAEALCAAGARLLLVGRNAEKLEALAA   47 (262)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             9899889994862399999999999879989999898999999999


No 122
>PRK07576 short chain dehydrogenase; Provisional
Probab=96.76  E-value=0.021  Score=35.76  Aligned_cols=52  Identities=21%  Similarity=0.215  Sum_probs=39.4

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCE
Q ss_conf             813218987999836-8548999999998598699981896478----899978989
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIE   53 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~   53 (468)
                      .|-+|+||.++|-|- ++-|+++|+.|.++|++|..+|++...+    +++...+..
T Consensus         2 ~m~~L~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~~~~   58 (260)
T PRK07576          2 TMFRLAGKNVFVVGGTSGINLGIAQAFARAGANVAVASRSQEKVDAAVAQLQQAGPE   58 (260)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC
T ss_conf             764238998999589619999999999987999999979889999999999953994


No 123
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=96.75  E-value=0.0057  Score=39.61  Aligned_cols=44  Identities=25%  Similarity=0.360  Sum_probs=36.6

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             9813218987999836-8548999999998598699981896478
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |.--+|+||.++|-|- ++-|.++|+.|.++|++|.+.|.+...+
T Consensus         1 m~~~~l~gK~alITG~s~GIG~aia~~la~~Ga~V~~~~r~~~~l   45 (253)
T PRK08220          1 MNSMDFSGKTVWVTGAAQGIGYAVALAFVEAGAKVIGFDQAFEQL   45 (253)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             998899999899958856899999999998799999997887787


No 124
>PRK04965 nitric oxide reductase; Provisional
Probab=96.74  E-value=0.021  Score=35.72  Aligned_cols=31  Identities=10%  Similarity=0.191  Sum_probs=24.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--EEEEEEC
Q ss_conf             879998368548999999998598--6999818
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV--HVIAWDD   39 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~   39 (468)
                      ++|.|+|-|+.|+++|+.|.+.+.  +++....
T Consensus         3 ~~IVIIG~G~AG~~aa~~lR~~d~~~~Itvi~~   35 (378)
T PRK04965          3 NGIVIIGSGFAARQLVKNIRKQDAHIPITLITA   35 (378)
T ss_pred             CCEEEECCCHHHHHHHHHHHCCCCCCCEEEEEC
T ss_conf             999999882999999999971194986999989


No 125
>pfam00743 FMO-like Flavin-binding monooxygenase-like. This family includes FMO proteins and cyclohexanone monooxygenase.
Probab=96.73  E-value=0.0027  Score=41.85  Aligned_cols=34  Identities=26%  Similarity=0.438  Sum_probs=31.4

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9879998368548999999998598699981896
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .|+|+|+|.|.||+++|+.|.+.|.++++++++.
T Consensus         1 ~KrVAIIGAG~SGL~a~K~lle~G~~~~~FE~~~   34 (532)
T pfam00743         1 AKKVAVIGAGVSGLSSIKCCLEEGLEPTCFERSD   34 (532)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9879998972999999999987799829997799


No 126
>PRK05867 short chain dehydrogenase; Provisional
Probab=96.73  E-value=0.006  Score=39.45  Aligned_cols=54  Identities=20%  Similarity=0.218  Sum_probs=42.7

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCEE
Q ss_conf             9813218987999836-85489999999985986999818964788----999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~~   54 (468)
                      |.|-+|+||.++|-|- ++-|.++|+.|.+.|++|..+|.+...++    ++...|.+.
T Consensus         2 ~~~f~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~~ei~~~g~~~   60 (253)
T PRK05867          2 LDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEKLADEIGTSGGKV   60 (253)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             75638899989997956599999999999869999999798899999999998459919


No 127
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated
Probab=96.72  E-value=0.014  Score=37.02  Aligned_cols=54  Identities=17%  Similarity=0.240  Sum_probs=40.4

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC--HHHHHHHHCCCEE
Q ss_conf             9813218987999836-8548999999998598699981896--4788999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~--~~~~~l~~~g~~~   54 (468)
                      |..-+|+||.++|-|- ++-|+++|+.|.+.|++|.+.|...  ....++...+-.+
T Consensus         3 ~~~~~L~gK~alITGas~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~~   59 (253)
T PRK08993          3 LDAFSLEGKVAVVTGCDTGLGQGMALGLAEAGCDIVGINIVEPTETIEQVTALGRRF   59 (253)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHCCCCE
T ss_conf             766399999899938876899999999998799999955877499999999659957


No 128
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase; InterPro: IPR006398   These sequences represent 2-hydroxy-3-oxopropionate reductase (1.1.1.60 from EC), also called tartronate semialdehyde reductase. It follows glyoxylate carboligase and precedes glycerate kinase in D-glycerate pathway of glyoxylate degradation. The eventual product, 3-phosphoglycerate, is an intermediate of glycolysis and is readily metabolized. Tartronic semialdehyde, the substrate of this enzyme, may also come from other pathways, such as D-glucarate catabolism , .; GO: 0008679 2-hydroxy-3-oxopropionate reductase activity, 0046487 glyoxylate metabolic process.
Probab=96.71  E-value=0.0018  Score=43.05  Aligned_cols=68  Identities=13%  Similarity=0.142  Sum_probs=57.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             79998368548999999998598699981896478899978989964531572258889988886856755
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      ||+++|+|.=|.++++=|.+.||+++++|.+++.++.+...|.....--..-.+.+|.||.   .-|+.|+
T Consensus         1 KvgfIGLGIMG~PMs~NL~kAGyql~v~t~~~e~~d~l~aaGa~~a~ta~~~~e~~Dvi~~---MvP~sPq   68 (291)
T TIGR01505         1 KVGFIGLGIMGKPMSKNLLKAGYQLVVATLEQEVLDELLAAGAESAETAKEVVEDADVIVT---MVPDSPQ   68 (291)
T ss_pred             CEEEEECCCCCCHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCHHHHHHHHHHHHCCEEEE---ECCCCCC
T ss_conf             9045635877865789997549468883077048999986173228999999974897998---4387697


No 129
>PRK08936 glucose-1-dehydrogenase; Provisional
Probab=96.70  E-value=0.024  Score=35.36  Aligned_cols=76  Identities=14%  Similarity=0.183  Sum_probs=50.3

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC-CH----HHHHHHHCCCEEEC----CCC------------CC
Q ss_conf             3218987999836-854899999999859869998189-64----78899978989964----531------------57
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDH-PC----AVKQAKDMGIEVID----FRE------------IP   61 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~-~~----~~~~l~~~g~~~~~----~~~------------~~   61 (468)
                      .||+||.++|-|- ++-|+++|+.|.++|++|...+.. +.    ..+.++..|.+...    ..+            ..
T Consensus         3 ~~L~gKvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~   82 (261)
T PRK08936          3 SDLEGKVVVITGGSTGLGRAMAVRFGKEKAKVVINYRSDESEANDVAEEIKKVGGEAIAVKGDVTVESDVVNLIQSAVKE   82 (261)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             88999989996847789999999999879999997289878999999999965993899982799999999999999998


Q ss_pred             CCCCCEEEECCCCCCCCC
Q ss_conf             225888998888685675
Q gi|254781099|r   62 WSIISFLVLSPGIALTGE   79 (468)
Q Consensus        62 ~~~~d~vv~Spgi~~~~~   79 (468)
                      +..+|.+|-..|+....+
T Consensus        83 ~G~iDiLVNNAg~~~~~~  100 (261)
T PRK08936         83 FGTLDVMINNAGIENAVP  100 (261)
T ss_pred             HCCCCEEEECCCCCCCCC
T ss_conf             299889998997899988


No 130
>PRK07523 gluconate 5-dehydrogenase; Provisional
Probab=96.69  E-value=0.0066  Score=39.18  Aligned_cols=47  Identities=19%  Similarity=0.232  Sum_probs=39.8

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             9813218987999836-8548999999998598699981896478899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      |+|-+|+||.++|-|- ++-|.++|+.|.+.|++|...|.++..+...
T Consensus         2 m~~f~L~gK~alVTG~s~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~   49 (251)
T PRK07523          2 FNLFDLTGRRALITGSSQGIGYALAKGLAQAGAEVILNGRDAAKLAAA   49 (251)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             886268999899958366999999999998799999996998999999


No 131
>PRK06182 short chain dehydrogenase; Validated
Probab=96.69  E-value=0.013  Score=37.11  Aligned_cols=50  Identities=18%  Similarity=0.220  Sum_probs=40.9

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEE
Q ss_conf             18987999836-854899999999859869998189647889997898996
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVI   55 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~   55 (468)
                      +++|.++|-|. ++-|.++|+.|.++|++|.+++++...++.+...++..+
T Consensus         1 mk~Kv~lITGassGIG~a~a~~la~~G~~V~~~~r~~~~l~~l~~~~~~~~   51 (273)
T PRK06182          1 MKKKVALVTGASSGIGKATARKLIAEGFTVYGAARRVDKMEDLASLGIHPL   51 (273)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEE
T ss_conf             946989990632099999999999879989999798999999996799799


No 132
>PRK05993 short chain dehydrogenase; Provisional
Probab=96.67  E-value=0.015  Score=36.68  Aligned_cols=51  Identities=27%  Similarity=0.353  Sum_probs=41.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEE
Q ss_conf             9813218987999836-854899999999859869998189647889997898996
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVI   55 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~   55 (468)
                      |.|.    |.|+|-|. .+-|.++|+.|.++|++|.++++++..+..+...++..+
T Consensus         1 M~m~----K~vlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~~   52 (277)
T PRK05993          1 MDMK----RSILITGCSSGIGAYCAHALQKRGWRVFATCRKPEDIAALEAEGLEAF   52 (277)
T ss_pred             CCCC----CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCEEE
T ss_conf             9998----689992568699999999999879999999799999999984898199


No 133
>PRK12746 short chain dehydrogenase; Provisional
Probab=96.67  E-value=0.025  Score=35.20  Aligned_cols=52  Identities=17%  Similarity=0.250  Sum_probs=38.6

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEE-EECCCHHH----HHHHHCCCEE
Q ss_conf             13218987999836-85489999999985986999-81896478----8999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIA-WDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~-~D~~~~~~----~~l~~~g~~~   54 (468)
                      |.+|+||.+.|-|- ++-|+++|+.|.++|++|.. ++.+....    ++++..+.+.
T Consensus         1 M~~l~gKvalITGga~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~   58 (254)
T PRK12746          1 MKNLDGKVALVTGASRGIGRAIAMRLANDGALVAIHYGRNKAAADETIREIESNGGKA   58 (254)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCE
T ss_conf             9699998899948476899999999998799999965999899999999998559928


No 134
>PRK08655 prephenate dehydrogenase; Provisional
Probab=96.66  E-value=0.0058  Score=39.54  Aligned_cols=67  Identities=28%  Similarity=0.360  Sum_probs=50.0

Q ss_pred             EEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCCHHHH-HHHHCCCEEECCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             79998-3685489999999985986999818964788-999789899645315722588899888868567
Q gi|254781099|r   10 SIAVF-GLGRSGLSAACALKDSGVHVIAWDDHPCAVK-QAKDMGIEVIDFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        10 ~v~i~-G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~-~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      +|.|+ |.|.=|.-.|++|...||+|.++++++...+ -...+|.....-.......+|+||+|  +|.+.
T Consensus         2 kI~IIGG~G~MG~~Fa~~f~~sGyeV~I~gRd~~k~~~va~~LGv~~~~~~~e~~~~advVIvs--VPI~~   70 (441)
T PRK08655          2 KISIIGGTGGLGKWFARFLKDKGYEVIVWGRDPKKGKEVAKELGVEYASDNIDAAKDGDIVIVS--VPINV   70 (441)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHCCCCCCCHHHHHHCCCEEEEE--CCHHH
T ss_conf             7999947981779999999867988999815731356788873862224478897249999998--48899


No 135
>PRK06719 precorrin-2 dehydrogenase; Validated
Probab=96.66  E-value=0.011  Score=37.73  Aligned_cols=117  Identities=16%  Similarity=0.175  Sum_probs=68.5

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCC-CEE--ECCCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             321898799983685489999999985986999818964788999789-899--64531572258889988886856755
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMG-IEV--IDFREIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g-~~~--~~~~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      =+++||+|+|+|=|.-+.-=++.|.+.|+.|++.....  ..+++.++ +.+  -.+.+..++++++|+..    .++++
T Consensus         9 l~l~~k~vLVvGGG~VA~rK~~~Ll~~ga~VtVvsp~~--~~el~~l~~i~~~~r~~~~~dl~~~~lViaA----Tdd~~   82 (157)
T PRK06719          9 FNLHNKVVVIIGGGKIAYRKASGLKDTGAFVTVVSPEI--CEEMKELPYITWKQKTFSNDDIKDAHLIYAA----TNQHA   82 (157)
T ss_pred             EECCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCC--CHHHHHCCCEEEECCCCCHHHHCCCEEEEEC----CCCHH
T ss_conf             97599879998898999999999987879699999986--8999845570887046784683784399986----89989


Q ss_pred             CCHHHHHHHHCCC--EEEEEHHHHHHHHH-HCCCCCCEEEEECCCCCCHH
Q ss_conf             7888999997698--09983034223343-01568868996034575215
Q gi|254781099|r   81 AHWCVKLANQFNV--EIIGDIELFVRERR-FSSLQSPFIAVTGTNGKSST  127 (468)
Q Consensus        81 ~~~~~~~a~~~gi--~v~s~~el~~~~~~-~~~~~~~vI~VTGT~GKTTt  127 (468)
                      .|..+.++.+...  .+.++.+..--... ......=+|+| .|+|++-+
T Consensus        83 lN~~i~~~a~~~~lvN~~d~~~~~dF~~Paiv~rg~l~IaI-ST~G~SP~  131 (157)
T PRK06719         83 VNMMVKQAAHDFQWVNVVSDGTESSFHTPGVIRNDEYVVTI-STSGKDPS  131 (157)
T ss_pred             HHHHHHHHHHHCCCEEEECCCCCCCEEEEEEEEECCEEEEE-ECCCCCCH
T ss_conf             99999999977895898289888976870389858979999-88998929


No 136
>PRK08628 short chain dehydrogenase; Provisional
Probab=96.64  E-value=0.024  Score=35.32  Aligned_cols=52  Identities=13%  Similarity=0.261  Sum_probs=38.1

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH---HHHHHHCCCE
Q ss_conf             9813218987999836-854899999999859869998189647---8899978989
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA---VKQAKDMGIE   53 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~---~~~l~~~g~~   53 (468)
                      |.| +|+||.+.|-|- ++-|.++|+.|.+.|+.|..+|.++..   .+.++..+..
T Consensus         1 M~~-~l~gKvalVTG~s~GIG~a~a~~la~~Ga~v~i~~~~~~~~~~~~~~~~~~~~   56 (258)
T PRK08628          1 MDL-NLKDKVVIVTGGASGIGAAISLRLAEEGAIPVVFGRSAPDDEFAEELRALQPR   56 (258)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCC
T ss_conf             999-97999899927777899999999998799899980880239999999953997


No 137
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NADP binding domain of the Methylene-Tetrahydrofolate Dehydrogenase/cyclohydrolase (m-THF DH/cyclohydrolase) bifunctional enzyme.   Tetrahydrofolate is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional DH/cyclodrolase form. In bacteria, monofucntional DH, as well a
Probab=96.64  E-value=0.021  Score=35.69  Aligned_cols=120  Identities=16%  Similarity=0.217  Sum_probs=75.6

Q ss_pred             HHCCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCCHHHHH-HHHCCCEEEC-CCCC----CCCCCCEEEECCCCCCC
Q ss_conf             2189879998368-54899999999859869998189647889-9978989964-5315----72258889988886856
Q gi|254781099|r    5 SFRNHSIAVFGLG-RSGLSAACALKDSGVHVIAWDDHPCAVKQ-AKDMGIEVID-FREI----PWSIISFLVLSPGIALT   77 (468)
Q Consensus         5 ~~~~k~v~i~G~G-~sG~s~A~~l~~~G~~V~~~D~~~~~~~~-l~~~g~~~~~-~~~~----~~~~~d~vv~Spgi~~~   77 (468)
                      +++||++.|+|-+ .-|+++|.+|.++|+.|+.++.++..++. .+...+.+.. ....    .+-....+|+-=||...
T Consensus        41 ~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVt~chs~T~~l~~~~~~ADIvIsA~G~~~li~~~~vk~gavvIDvGin~~  120 (168)
T cd01080          41 DLAGKKVVVVGRSNIVGKPLAALLLNRNATVTVCHSKTKNLKEHTKQADIVIVAVGKPGLVKGDMVKPGAVVIDVGINRV  120 (168)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCEEEEECCCCCCCCHHHCCCCCEEEECCCCCC
T ss_conf             87785699987873008999999984899799976898897997410453554158766378999589988996665423


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             7557888999997698099830342233430156886899603457521578999999873
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKN  138 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~  138 (468)
                      ..          ..+-.+.+|+++-. ......+-   -=|-|-.|.-|+..|+.+.++.+
T Consensus       121 ~~----------~~~~kl~GDvd~~~-v~~~a~~i---TPVPGGVGpmTva~L~~N~v~aa  167 (168)
T cd01080         121 PD----------KSGGKLVGDVDFES-AKEKASAI---TPVPGGVGPMTVAMLMKNTVEAA  167 (168)
T ss_pred             CC----------CCCCEEECCCCHHH-HHHHCEEE---CCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             34----------88984637788899-98646386---89999608999999999999982


No 138
>PRK06436 glycerate dehydrogenase; Provisional
Probab=96.63  E-value=0.0072  Score=38.91  Aligned_cols=34  Identities=26%  Similarity=0.457  Sum_probs=17.0

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             1898799983685489999999985986999818
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~   39 (468)
                      +.||+++|+|+|.-|..+|+.+...|.+|.++|.
T Consensus       120 L~gktvGIiG~G~IG~~vA~~~~afg~~V~~~~r  153 (303)
T PRK06436        120 LYNKSLGILGYGGIGRRVALLAKAFGMNIYAYTR  153 (303)
T ss_pred             ECCCEEEEECCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             1188899989765699999999977988999898


No 139
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed
Probab=96.62  E-value=0.0092  Score=38.18  Aligned_cols=19  Identities=11%  Similarity=0.211  Sum_probs=13.6

Q ss_pred             HHHHHHHHCCCCCCCCCHH
Q ss_conf             9999998637985235944
Q gi|254781099|r  443 SFMSQVSEIPGIEMLVDIE  461 (468)
Q Consensus       443 ~F~~~v~~l~~~~~~~~~~  461 (468)
                      .+-+++++|||++......
T Consensus       406 ~~~~~l~~lF~l~~~~~~~  424 (429)
T PRK00045        406 EYLEALRELFGLDEESVDA  424 (429)
T ss_pred             HHHHHHHHHHCCCCCCCCC
T ss_conf             9999999983989776221


No 140
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.62  E-value=0.026  Score=35.01  Aligned_cols=36  Identities=17%  Similarity=0.286  Sum_probs=31.8

Q ss_pred             CHHHCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEE
Q ss_conf             132189879998368---548999999998598699981
Q gi|254781099|r    3 LSSFRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWD   38 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D   38 (468)
                      |..|+||.++|-|.+   +-|.++|+.|.+.|++|...+
T Consensus         1 M~~L~gKvalVTGas~~~GIG~aiA~~la~~Ga~Vvi~~   39 (257)
T PRK12859          1 MNQLKNKVAVVTGVSRLDGIGAAICKELAEAGYDIFFTY   39 (257)
T ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEE
T ss_conf             998898889992889998629999999998799899983


No 141
>PRK06124 gluconate 5-dehydrogenase; Provisional
Probab=96.60  E-value=0.016  Score=36.56  Aligned_cols=54  Identities=24%  Similarity=0.281  Sum_probs=40.4

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             9813218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |+.-+|+||.++|-|- ++-|.++|+.|.+.|++|..+|+++..+    ++++..+...
T Consensus         7 ~~~~~L~gK~alITGgs~GIG~~ia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~   65 (259)
T PRK06124          7 LQRFSLAGQVALVTGSARGLGLEIARALAEAGAHVLVNGRNAARVEAAVAALRAAGGAA   65 (259)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             36409999989992867489999999999879999999698899999999999659958


No 142
>PRK08410 2-hydroxyacid dehydrogenase; Provisional
Probab=96.60  E-value=0.013  Score=37.22  Aligned_cols=67  Identities=10%  Similarity=0.122  Sum_probs=34.4

Q ss_pred             HHHHCCCEEEEEECCCH-H-HHHHHHCCCEEECC---CCCCCCC-CCE-EEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             99985986999818964-7-88999789899645---3157225-888-998888685675578889999976980998
Q gi|254781099|r   26 ALKDSGVHVIAWDDHPC-A-VKQAKDMGIEVIDF---REIPWSI-ISF-LVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        26 ~l~~~G~~V~~~D~~~~-~-~~~l~~~g~~~~~~---~~~~~~~-~d~-vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
                      .|.+. .+|..+|...+ . .+.+....+-+...   .+..++. ..+ +|...|...++-    -+.+++++||+|..
T Consensus        18 ~l~~~-~e~~~~~~~~~ee~~~~i~dadili~~~~~i~~e~l~~a~~LK~I~~~g~G~D~I----D~~aa~~~gI~V~n   91 (311)
T PRK08410         18 VFNEF-GDFQIYDTTSPEEVIERIKDANIIITNKVVIDKEVLSALPNLKLICITATGTNNV----DLEYAKKRGIAVKN   91 (311)
T ss_pred             HHHCC-CCEEEECCCCHHHHHHHHCCCCEEEECCCCCCHHHHHCCCCCEEEEECCCCCCHH----HHHHHHHCCCEEEE
T ss_conf             77057-7589978989899999838994999748854999993699984999888156142----19999979968992


No 143
>PRK12550 shikimate 5-dehydrogenase; Reviewed
Probab=96.60  E-value=0.042  Score=33.63  Aligned_cols=28  Identities=11%  Similarity=0.189  Sum_probs=11.2

Q ss_pred             CCCE-EEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             8868-9960345752157899999987310
Q gi|254781099|r  112 QSPF-IAVTGTNGKSSTVALISHVLRKNGY  140 (468)
Q Consensus       112 ~~~v-I~VTGT~GKTTt~~ll~~iL~~~g~  140 (468)
                      ++++ ++|.+.-++.++ .|=...+++.|.
T Consensus         8 ~~~~~~~~~~~p~~~~~-~mHN~af~~lgl   36 (272)
T PRK12550          8 DTQLCISLAARPSNFGT-RFHNYLYEALGL   36 (272)
T ss_pred             CCEEEEEECCCCCCCCH-HHHHHHHHHCCC
T ss_conf             98699994469886778-999999998799


No 144
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=96.59  E-value=0.023  Score=35.43  Aligned_cols=75  Identities=20%  Similarity=0.210  Sum_probs=48.3

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH-----HHHHHHCCCEEECC----CC------------CCC
Q ss_conf             218987999836-854899999999859869998189647-----88999789899645----31------------572
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA-----VKQAKDMGIEVIDF----RE------------IPW   62 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~-----~~~l~~~g~~~~~~----~~------------~~~   62 (468)
                      +|+||.++|-|- ++-|.++|+.|.+.|++|...|.+...     .+.+...+..+..+    .+            ..+
T Consensus         2 ~L~gK~~lITGgs~GIG~aia~~la~~G~~Vii~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlt~~~~v~~~~~~~~~~~   81 (248)
T PRK05557          2 SLEGKVALVTGASRGIGRAIAERLAAQGANVVLNYASSEAGAEALVAEIGALGGKALAVQGDVADAESIERAVDEAKAEF   81 (248)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             67998899948976899999999998799899996985658999999999639958999903899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCC
Q ss_conf             25888998888685675
Q gi|254781099|r   63 SIISFLVLSPGIALTGE   79 (468)
Q Consensus        63 ~~~d~vv~Spgi~~~~~   79 (468)
                      ...|.+|-..|+....+
T Consensus        82 g~iD~linnAg~~~~~~   98 (248)
T PRK05557         82 GGVDILVNNAGITRDNL   98 (248)
T ss_pred             CCCCEEEECCCCCCCCC
T ss_conf             99719998997799999


No 145
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional
Probab=96.58  E-value=0.0093  Score=38.14  Aligned_cols=82  Identities=12%  Similarity=0.087  Sum_probs=41.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCE-EEEEECC--CHHH-HHHHHCCCEEE-CCCCC---CCC-CCCE-EEECCCCCCCCC
Q ss_conf             799983685489999999985986-9998189--6478-89997898996-45315---722-5888-998888685675
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVH-VIAWDDH--PCAV-KQAKDMGIEVI-DFREI---PWS-IISF-LVLSPGIALTGE   79 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~-V~~~D~~--~~~~-~~l~~~g~~~~-~~~~~---~~~-~~d~-vv~Spgi~~~~~   79 (468)
                      ||++.- .. --+...+|.+.|+. |......  +..+ +.+.....-++ +....   .++ ...+ +|-.-|+..++-
T Consensus        12 kiL~~d-~i-~~~~~~~L~~~G~~~v~~~~~~l~~eeL~~~i~~~d~liiRS~t~vt~~vi~~a~~Lk~I~r~GvG~dnI   89 (409)
T PRK11790         12 KFLLLE-GI-HQSAVEVLRAAGYTNIEYHKGALDEEELKEAIKDAHFIGIRSRTQLTEEVLEAAEKLVAIGCFCIGTNQV   89 (409)
T ss_pred             EEEEEC-CC-CHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHCCCCEEEECCCCCCCHHHHHCCCCCEEEEECCCCCCCC
T ss_conf             799807-88-9899999997799778826899999999998567989999179873999994399971999832157740


Q ss_pred             CCCHHHHHHHHCCCEEEE
Q ss_conf             578889999976980998
Q gi|254781099|r   80 NAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        80 ~~~~~~~~a~~~gi~v~s   97 (468)
                      +    +.+|+++||+|..
T Consensus        90 D----l~aa~~~GI~V~N  103 (409)
T PRK11790         90 D----LDAAAKRGIPVFN  103 (409)
T ss_pred             C----HHHHHHCCCEEEE
T ss_conf             8----9999869948996


No 146
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase. NAD(P) binding domains of methylene-tetrahydrofolate dehydrogenase (m-THF DH) and  m-THF DH/cyclohydrolase bifunctional enzymes (m-THF DH/cyclohydrolase). M-THF is a versatile carrier of activated one-carbon units. The major one-carbon folate donors are N-5 methyltetrahydrofolate, N5,N10-m-THF, and N10-formayltetrahydrofolate. The oxidation of metabolic intermediate m-THF to m-THF requires the enzyme m-THF DH. In addition, most DHs also have an associated cyclohydrolase activity which catalyzes its hydrolysis to N10-formyltetrahydrofolate. m-THF DH is typically found as part of a multifunctional protein in eukaryotes. NADP-dependent m-THF DH in mammals, birds and yeast are components of a trifunctional enzyme with DH, cyclohydrolase, and synthetase activities. Certain eukaryotic cells also contain homodimeric bifunctional
Probab=96.57  E-value=0.038  Score=33.96  Aligned_cols=108  Identities=19%  Similarity=0.307  Sum_probs=63.3

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH-HHHCCCEEEC-CCCC----CCCCCCEEEECCCCCCC
Q ss_conf             218987999836-854899999999859869998189647889-9978989964-5315----72258889988886856
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ-AKDMGIEVID-FREI----PWSIISFLVLSPGIALT   77 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~-l~~~g~~~~~-~~~~----~~~~~d~vv~Spgi~~~   77 (468)
                      +++||+|.|+|- ..-|+++|.+|.++|+.|+.++.+...+++ .....+-+.. ....    .+-..+.+|+-=|+...
T Consensus        25 ~l~Gk~vvVvGrS~~VG~Pla~lL~~~~atVt~~hs~t~~l~~~~~~ADIvI~a~G~p~~i~~~~vk~GavvIDvGi~~~  104 (140)
T cd05212          25 RLDGKKVLVVGRSGIVGAPLQCLLQRDGATVYSCDWKTIQLQSKVHDADVVVVGSPKPEKVPTEWIKPGATVINCSPTKL  104 (140)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHCCEEEECCCCCCCCCHHHCCCCCEEEEECCCCC
T ss_conf             99999999999981249999999997889899946999598998523499998168767278977679988998037756


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHH
Q ss_conf             7557888999997698099830342233430156886899603457521578999999873
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKN  138 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~  138 (468)
                      ..+                   +..    ....+   +--|-|-.|.-|+..++.+.++.+
T Consensus       105 ~~~-------------------~v~----~~a~~---iTPVPGGVGP~Tva~L~~N~v~a~  139 (140)
T cd05212         105 SGD-------------------DVK----ESASL---YVPMTGGVGKLTVAMRMQNMVRSV  139 (140)
T ss_pred             CCH-------------------HHH----CEEEE---ECCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             772-------------------144----16528---778999546999999999999970


No 147
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional
Probab=96.57  E-value=0.035  Score=34.14  Aligned_cols=32  Identities=22%  Similarity=0.472  Sum_probs=26.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC--EEEEEE
Q ss_conf             89879998368548999999998598--699981
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGV--HVIAWD   38 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D   38 (468)
                      +.++|.|+|-|..|.++|..|.+.|+  +++...
T Consensus         2 ~~~~iVIIG~G~AG~~aA~~lR~~g~~g~Itli~   35 (400)
T PRK09754          2 KEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFS   35 (400)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             9672999977599999999998069499799998


No 148
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=96.56  E-value=0.03  Score=34.61  Aligned_cols=75  Identities=27%  Similarity=0.344  Sum_probs=47.9

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCCHH----HHHHHHCCCEEE----CCCC------------CCC
Q ss_conf             218987999836-854899999999859869998-189647----889997898996----4531------------572
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAW-DDHPCA----VKQAKDMGIEVI----DFRE------------IPW   62 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~-D~~~~~----~~~l~~~g~~~~----~~~~------------~~~   62 (468)
                      +|+||.|+|-|- ++-|.++|+.|.+.|++|... +.+...    ...+...+....    +..+            ..+
T Consensus         2 ~L~gK~vlITGgs~GIG~aia~~la~~G~~V~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~Dl~~~~~~~~~~~~~~~~~   81 (247)
T PRK05565          2 KLMGKVAIVTGASGGIGRAIAELLAKEGAKVVIAYDKNEEAANELLEEIKEVGGDAIAVKADVSSEDDVENLVEQIVEKF   81 (247)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             98998899937845899999999998799899981799899999999999639908999835899999999999999980


Q ss_pred             CCCCEEEECCCCCCCCC
Q ss_conf             25888998888685675
Q gi|254781099|r   63 SIISFLVLSPGIALTGE   79 (468)
Q Consensus        63 ~~~d~vv~Spgi~~~~~   79 (468)
                      ...|.+|.+.|+....+
T Consensus        82 g~iD~lVnnAg~~~~~~   98 (247)
T PRK05565         82 GKIDILVNNAGISKFGL   98 (247)
T ss_pred             CCCCEEEECCCCCCCCC
T ss_conf             99849998998789999


No 149
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated
Probab=96.53  E-value=0.034  Score=34.28  Aligned_cols=52  Identities=15%  Similarity=0.222  Sum_probs=39.1

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEE
Q ss_conf             3218987999836-8548999999998598699981896478----89997898996
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVI   55 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~   55 (468)
                      -+|+||.+.|-|- ++-|.++|+.|.++|++|..+|.+....    +.++..+.+..
T Consensus         7 ~~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~~   63 (255)
T PRK06113          7 LRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAF   63 (255)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEE
T ss_conf             679999899958877899999999998799999996988999999999996599089


No 150
>KOG0685 consensus
Probab=96.52  E-value=0.05  Score=33.09  Aligned_cols=106  Identities=21%  Similarity=0.295  Sum_probs=59.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHHHHCCCEE--ECCCCCCCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             89879998368548999999998598-6999818964788999789899--64531572258889988886856755788
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQAKDMGIEV--IDFREIPWSIISFLVLSPGIALTGENAHW   83 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l~~~g~~~--~~~~~~~~~~~d~vv~Spgi~~~~~~~~~   83 (468)
                      .+++|.|+|.|++|+++|+-|.++|+ .|.+....       ...|..+  +++.+.-++--..-|       +....||
T Consensus        20 ~~~kIvIIGAG~AGLaAA~rLle~gf~~~~IlEa~-------dRIGGRI~ti~~~d~~ielGAqwi-------hG~~gNp   85 (498)
T KOG0685          20 GNAKIVIIGAGIAGLAAATRLLENGFIDVLILEAS-------DRIGGRIHTIPFADGVIELGAQWI-------HGEEGNP   85 (498)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEEEC-------CCCCCEEEEEECCCCEEEECCEEE-------CCCCCCH
T ss_conf             79649998985677999999998289648999704-------666755766872787376246663-------3778873


Q ss_pred             HHHHHHHCC-CEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             899999769-80998303422334301568868996034575215789999998
Q gi|254781099|r   84 CVKLANQFN-VEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLR  136 (468)
Q Consensus        84 ~~~~a~~~g-i~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~  136 (468)
                      ..+.|++.| .+++.....          -..-...|-++|+-..-.++..+..
T Consensus        86 VY~la~~~g~~~~~~~tg~----------~~~~~~~~~~~g~~V~~~~~~~~~~  129 (498)
T KOG0685          86 VYELAKEYGDLKLLEVTGP----------AYVDNFHTRSNGEVVPEELLDELNE  129 (498)
T ss_pred             HHHHHHHHCCCCEECCCCC----------CCCCEEEEEECCCCCCHHHHHHHHH
T ss_conf             9999987285320115774----------1133047875686276999999999


No 151
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase. Glutamyl-tRNA reductase catalyzes the conversion of glutamyl-tRNA to glutamate-1-semialdehyde, initiating the synthesis of tetrapyrrole. Whereas tRNAs are generally associated with peptide bond formation in protein translation, here the tRNA activates glutamate in the initiation of tetrapyrrole biosynthesis in archaea, plants and many bacteria. In the first step, activated glutamate is reduced to glutamate-1-semi-aldehyde via the NADPH dependent glutamyl-tRNA reductase. Glutamyl-tRNA reductase forms a V-shaped dimer. Each monomer has 3 domains: an N-terminal catalytic domain, a classic nucleotide binding domain, and a C-terminal dimerization domain. Although the representative structure 1GPJ lacks a bound NADPH, a theoretical binding pocket has been described. (PMID 11172694). Amino acid dehydrogenase (DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, 
Probab=96.52  E-value=0.011  Score=37.64  Aligned_cols=75  Identities=13%  Similarity=0.224  Sum_probs=37.2

Q ss_pred             HCCCCCCEEEECCCCCCCCHHHHH-HHH-C-CCCEEEEECCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCC
Q ss_conf             013332001203210122068989-984-2-7868999889989988863168988998799999999999998448985
Q gi|254781099|r  344 LNEKRRIYWIAGGLSKSDDFSTLF-PFI-S-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS  420 (468)
Q Consensus       344 ~~~~~~i~lI~GG~~K~~d~~~L~-~~~-~-~~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gD  420 (468)
                      .++.++.+||+|.    +++..+. +.+ . ....+++...+.+. ++.+....+.. ...+++..+.+.       .-|
T Consensus       174 ~~l~~~~vLviGa----Gem~~l~~~~L~~~g~~~i~v~nRt~~r-a~~la~~~g~~-~~~~~~l~~~l~-------~~D  240 (311)
T cd05213         174 GNLKGKKVLVIGA----GEMGELAAKHLAAKGVAEITIANRTYER-AEELAKELGGN-AVPLDELLELLN-------EAD  240 (311)
T ss_pred             CCCCCCEEEEECC----CHHHHHHHHHHHHCCCCEEEEECCCHHH-HHHHHHHCCCE-EECHHHHHHHHH-------HCC
T ss_conf             8721167999868----7999999999996599825997686789-99999974989-972999999997-------689


Q ss_pred             EEEECCCCCCC
Q ss_conf             99945221663
Q gi|254781099|r  421 IVLFSPGCASF  431 (468)
Q Consensus       421 iVLlSPa~aS~  431 (468)
                      +|.-|-+++-+
T Consensus       241 vvisaT~s~~~  251 (311)
T cd05213         241 VVISATGAPHY  251 (311)
T ss_pred             EEEEECCCCCC
T ss_conf             99992799962


No 152
>PRK07825 short chain dehydrogenase; Provisional
Probab=96.51  E-value=0.015  Score=36.78  Aligned_cols=46  Identities=28%  Similarity=0.294  Sum_probs=37.5

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             3218987999836-854899999999859869998189647889997
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      ++|+||.|.|-|. ++-|.++|+.|.++|++|..+|.+...++.+..
T Consensus         1 ddl~gKvvlITGassGIG~a~A~~la~~Ga~V~i~~r~~~~l~~~~~   47 (273)
T PRK07825          1 DNLRGKVIAITGGARGIGLATARALAALGAKVAIGDLDEALAKESAA   47 (273)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             99999889992623399999999999879989999799999999998


No 153
>PRK05872 short chain dehydrogenase; Provisional
Probab=96.50  E-value=0.0098  Score=38.00  Aligned_cols=49  Identities=18%  Similarity=0.167  Sum_probs=41.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889997
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      +.|.+|+||.+.|-|. ++-|.++|+.|.++|++|..+|.++..++++..
T Consensus         2 p~M~~L~gKvalITGassGIG~aiA~~la~~Ga~Vvl~dr~~~~l~~~~~   51 (296)
T PRK05872          2 PPMTSLDGKVVFVTGAARGVGAELARRLHARGAKVALVDLEEAELAALAA   51 (296)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             79988599879992710589999999999879989999899999999999


No 154
>PRK06398 aldose dehydrogenase; Validated
Probab=96.50  E-value=0.0064  Score=39.26  Aligned_cols=40  Identities=20%  Similarity=0.326  Sum_probs=34.7

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             13218987999836-85489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |.+|+||.+.|-|- ++-|+++|+.|.+.|++|..+|.+..
T Consensus         1 M~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~   41 (256)
T PRK06398          1 MRDLRDKVVIVTGGSSGIGLAIVSRFVDEGSKVVSISRSEP   41 (256)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             98999898999687878999999999986999999948751


No 155
>PRK12829 short chain dehydrogenase; Provisional
Probab=96.45  E-value=0.0095  Score=38.08  Aligned_cols=46  Identities=22%  Similarity=0.236  Sum_probs=38.3

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             13218987999836-85489999999985986999818964788999
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      |.+|+||.++|-|- ++-|+++|+.|.+.|++|..+|.++....+..
T Consensus         6 m~~L~GKvalVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~~~~~~   52 (264)
T PRK12829          6 LKPLDGLRVLVTGGASGIGRAIAEAFAEAGARVHVCDVSEAALAATA   52 (264)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             76899997999473768999999999987998999979989999999


No 156
>PRK11883 protoporphyrinogen oxidase; Reviewed
Probab=96.45  E-value=0.0057  Score=39.61  Aligned_cols=33  Identities=30%  Similarity=0.494  Sum_probs=30.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECCC
Q ss_conf             87999836854899999999859--8699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG--VHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G--~~V~~~D~~~   41 (468)
                      |+|.|+|.|.+|+++|.+|.++|  ++|++++.++
T Consensus         1 K~V~VIGaGiaGLsaA~~L~~~G~~~~VtvlEa~~   35 (452)
T PRK11883          1 KRVAIIGGGISGLTAAYRLHKKGPDADITLLEASD   35 (452)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCC
T ss_conf             95999998789999999999649799789998899


No 157
>PRK08213 gluconate 5-dehydrogenase; Provisional
Probab=96.44  E-value=0.009  Score=38.26  Aligned_cols=54  Identities=22%  Similarity=0.316  Sum_probs=41.5

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             9813218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |+|-+|+||.+.|-|- ++-|+++|+.|.+.|++|..+|.+....    +.++..|.+.
T Consensus         5 ~~lf~L~gKvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~~   63 (259)
T PRK08213          5 LELFDLTGKTALVTGGSRGLGLQIAEALGEAGARVVLSARKAEELEEAAAHLEALGIDA   63 (259)
T ss_pred             HHHHCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             78739999989994877689999999999869999999798899999999999549958


No 158
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated
Probab=96.44  E-value=0.012  Score=37.35  Aligned_cols=26  Identities=8%  Similarity=-0.013  Sum_probs=13.5

Q ss_pred             EEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             998888685675578889999976980998
Q gi|254781099|r   68 LVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        68 vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
                      +|-|-++..++-+    +.+++++||++..
T Consensus        61 fIgtat~G~DhID----~~~l~~~gI~v~n   86 (379)
T PRK00257         61 FVGTCTIGTDHLD----LDYFAEAGITWSN   86 (379)
T ss_pred             EEEECCCCCCCCC----HHHHHHCCCEEEE
T ss_conf             9997456353146----9999869978996


No 159
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=96.43  E-value=0.0088  Score=38.30  Aligned_cols=41  Identities=20%  Similarity=0.264  Sum_probs=34.7

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             1321898799983685489999999985986999818964788
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      |.++  |+|+|+|.|.-|.++|..+...|++|..+|.++..++
T Consensus         1 M~~i--k~VaViGAG~MG~giA~~~a~~G~~V~l~D~~~e~~~   41 (292)
T PRK07530          1 MMAI--KKVGVIGAGQMGNGIAHVCALAGYDVLLNDVSADRLE   41 (292)
T ss_pred             CCCC--CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             9998--8899989669999999999967996899979889999


No 160
>PRK06198 short chain dehydrogenase; Provisional
Probab=96.43  E-value=0.029  Score=34.71  Aligned_cols=135  Identities=10%  Similarity=0.100  Sum_probs=69.9

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCE-EEEEECCCHH----HHHHHHCCCEEEC----CCC------------C
Q ss_conf             13218987999836-85489999999985986-9998189647----8899978989964----531------------5
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVH-VIAWDDHPCA----VKQAKDMGIEVID----FRE------------I   60 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~-V~~~D~~~~~----~~~l~~~g~~~~~----~~~------------~   60 (468)
                      |..|+||.++|-|- ++-|+++|+.|.++|++ |..++.+...    ...++..|.+...    ..+            .
T Consensus         1 M~~L~gK~alVTGas~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~   80 (268)
T PRK06198          1 MGRLDGKIALVTGGTQGLGAAIARLFAERGAAGLVICGRSAEKGEAKAAELEALGAKAVFVQADLAKVEDCRAVVAAADE   80 (268)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99889988999585778999999999987993899962988899999999995499679998268999999999999999


Q ss_pred             CCCCCCEEEECCCCCCCCCCCCH---HHHHHHHCCCEEEEEHH---HHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHH
Q ss_conf             72258889988886856755788---89999976980998303---4223343015688689960345752157899999
Q gi|254781099|r   61 PWSIISFLVLSPGIALTGENAHW---CVKLANQFNVEIIGDIE---LFVRERRFSSLQSPFIAVTGTNGKSSTVALISHV  134 (468)
Q Consensus        61 ~~~~~d~vv~Spgi~~~~~~~~~---~~~~a~~~gi~v~s~~e---l~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~i  134 (468)
                      .+...|.+|-..|+....+-...   .+.+.-  .+.+.+-+-   .+...+........||-|+...|+.....+...-
T Consensus        81 ~fG~iDiLVNnAG~~~~~~~~~~~~e~w~~~~--~vNl~~~~~~~~~~~~~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~  158 (268)
T PRK06198         81 AFGRLDALVNAAGLTDRGTILDTSPELFDRMF--AVNVRAPFFLMQEAIKLMRRRRAEGTIVNIGSMSAHGGQPFIAAYC  158 (268)
T ss_pred             HHCCCCEEEECCCCCCCCCHHHCCHHHHHHHH--HHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCCCHHHH
T ss_conf             83999899989978999982659999999999--9872699999999999999759992799991545456899856899


Q ss_pred             HHHHH
Q ss_conf             98731
Q gi|254781099|r  135 LRKNG  139 (468)
Q Consensus       135 L~~~g  139 (468)
                      -.+++
T Consensus       159 asKaa  163 (268)
T PRK06198        159 ASKGA  163 (268)
T ss_pred             HHHHH
T ss_conf             99999


No 161
>pfam02882 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain.
Probab=96.42  E-value=0.046  Score=33.32  Aligned_cols=118  Identities=17%  Similarity=0.251  Sum_probs=71.8

Q ss_pred             HHCCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCCHHHHHH-HHCCCEEEC-CCCC----CCCCCCEEEECCCCCCC
Q ss_conf             2189879998368-548999999998598699981896478899-978989964-5315----72258889988886856
Q gi|254781099|r    5 SFRNHSIAVFGLG-RSGLSAACALKDSGVHVIAWDDHPCAVKQA-KDMGIEVID-FREI----PWSIISFLVLSPGIALT   77 (468)
Q Consensus         5 ~~~~k~v~i~G~G-~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l-~~~g~~~~~-~~~~----~~~~~d~vv~Spgi~~~   77 (468)
                      +++||++.|+|-+ .-|++++.+|.++|+.|+.+..+++.+++. +...+-+.. ....    .+-....+|+-=||...
T Consensus        33 ~l~Gk~vvViGrS~iVG~Pla~lL~~~~atVtichs~T~nl~~~~~~ADIvI~A~G~p~~i~~~~ik~gavvIDvGi~~~  112 (159)
T pfam02882        33 DLAGKNVVVIGRSNIVGKPLALLLLNANATVTVCHSKTKDLAEITREADIVVVAVGKPGLIKADWVKPGAVVIDVGINRV  112 (159)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHCCCEEEEECCCCCCCCHHHCCCCCEEEEECCCCC
T ss_conf             85786699988873148999999987799899981899997896300344423158855056988589988998022065


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             75578889999976980998303422334301568868996034575215789999998731
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNG  139 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g  139 (468)
                                   .+-++.+|+++-. .......-+   =|-|-.|--|+..++.+.++.+-
T Consensus       113 -------------~~gkl~GDvd~~~-v~~~a~~iT---PVPGGVGPmTva~L~~N~v~a~~  157 (159)
T pfam02882       113 -------------ENGKLVGDVDFEN-VKEKASAIT---PVPGGVGPMTVAMLLQNTVEAAK  157 (159)
T ss_pred             -------------CCCCEECCCCHHH-HHHHCEEEC---CCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             -------------8996757877789-996472868---99995069999999999999997


No 162
>PRK10637 cysG siroheme synthase; Provisional
Probab=96.41  E-value=0.052  Score=32.97  Aligned_cols=119  Identities=15%  Similarity=0.124  Sum_probs=75.0

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHHHHHCC-CEEE--CCCCCCCCCCCEEEECCCCCCCCC
Q ss_conf             3218987999836854899999999859869998189-64788999789-8996--453157225888998888685675
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQAKDMG-IEVI--DFREIPWSIISFLVLSPGIALTGE   79 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g-~~~~--~~~~~~~~~~d~vv~Spgi~~~~~   79 (468)
                      =++++|+|+|+|-|.....=++.|.+.|..|++.-.. .+.+..+...+ +...  .+.+..+++..+||..    .+++
T Consensus         8 l~L~gk~vLVVGGG~vA~rK~~~Ll~agA~VtViap~~~~~l~~l~~~g~i~~~~r~f~~~dL~g~~LViaA----Tdd~   83 (457)
T PRK10637          8 CQLRDRDCLIVGGGDVAERKARLLLDAGARLTVNALAFIPQFTAWADAGMLTLVEGPFDESLLDTCWLAIAA----TDDD   83 (457)
T ss_pred             EECCCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCEEEEECCCCHHHHCCCEEEEEE----CCCH
T ss_conf             873898699989989999999999878987999899899899999866982899678996883895199990----6999


Q ss_pred             CCCH-HHHHHHHCCCEE--EEEHHHHHHHHHHCCCCCC-EEEEECCCCCCHH
Q ss_conf             5788-899999769809--9830342233430156886-8996034575215
Q gi|254781099|r   80 NAHW-CVKLANQFNVEI--IGDIELFVRERRFSSLQSP-FIAVTGTNGKSST  127 (468)
Q Consensus        80 ~~~~-~~~~a~~~gi~v--~s~~el~~~~~~~~~~~~~-vI~VTGT~GKTTt  127 (468)
                      +.|. ....+++.+++|  ..++++.--.........+ +||| .|+|++-+
T Consensus        84 ~vn~~i~~~a~~~~ilVNvvD~p~lcdF~~PAiv~Rg~l~IAI-STgG~sP~  134 (457)
T PRK10637         84 AVNQRVSEAAEARRIFCNVVDAPKAASFIMPSIIDRSPLMVAV-SSGGTSPV  134 (457)
T ss_pred             HHHHHHHHHHHHCCCEEEECCCCCCCCCCCCCEEECCCEEEEE-ECCCCCHH
T ss_conf             9999999999982986884588244874443157317638986-15898708


No 163
>PRK00066 ldh L-lactate dehydrogenase; Reviewed
Probab=96.41  E-value=0.052  Score=32.99  Aligned_cols=73  Identities=15%  Similarity=0.180  Sum_probs=49.0

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHHC----C-CEEECCCCCCCCCCCEEEECCCC
Q ss_conf             189879998368548999999998598--699981896478----899978----9-89964531572258889988886
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKDM----G-IEVIDFREIPWSIISFLVLSPGI   74 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~~----g-~~~~~~~~~~~~~~d~vv~Spgi   74 (468)
                      -|.+||.|+|.|.-|.++|..|..+|.  ++..+|.++...    ..+...    + ..+....-....+.|+||++-|+
T Consensus         4 ~k~~KI~IIGaG~VG~~~a~~l~~~~l~~el~LiD~~~~~a~g~a~Dl~h~~~~~~~~~i~~gdy~~~~daDvVVitAG~   83 (315)
T PRK00066          4 KKHNKVVLVGDGAVGSSYAYALVNQGIADELVIIDINKEKAEGDAMDLSHAVPFTSPTKIYAGDYSDCKDADLVVITAGA   83 (315)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHHHCCCCEEEECCCC
T ss_conf             78984999997988999999998669988899980898710789998885412368847973999996799999989999


Q ss_pred             CCCC
Q ss_conf             8567
Q gi|254781099|r   75 ALTG   78 (468)
Q Consensus        75 ~~~~   78 (468)
                      |...
T Consensus        84 ~~k~   87 (315)
T PRK00066         84 PQKP   87 (315)
T ss_pred             CCCC
T ss_conf             8999


No 164
>pfam01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain. This family now also contains the lysine 2-oxoglutarate reductases.
Probab=96.40  E-value=0.012  Score=37.50  Aligned_cols=65  Identities=22%  Similarity=0.249  Sum_probs=49.6

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCC--------CCCCCCCCEEEEC
Q ss_conf             8987999836854899999999859869998189647889997898996453--------1572258889988
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR--------EIPWSIISFLVLS   71 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~--------~~~~~~~d~vv~S   71 (468)
                      +-.+|.|+|.|..|+.+++.+...|++|.++|.++..+++++..+-....-.        ...+..+|+||-+
T Consensus        19 ~pa~vvViG~Gv~G~~A~~~A~~lGa~V~v~D~~~~~l~~~~~~~~~~v~~~~~~~~~~l~~~i~~aDvvIga   91 (150)
T pfam01262        19 PPAKVVVIGGGVVGLGAAATAKGLGAPVTILDVRPERLEQLDSLFAEFVETDIFSNCEYLAEAIAEADLVIGT   91 (150)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCCCHHHCCHHHHHHHHHHCCEEEEE
T ss_conf             6777999898789999999998679989997299999999998647620016653799999997438799972


No 165
>PRK12744 short chain dehydrogenase; Provisional
Probab=96.40  E-value=0.061  Score=32.51  Aligned_cols=77  Identities=18%  Similarity=0.233  Sum_probs=48.2

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH--------HHHHHHHCCCEEECCC----C--------
Q ss_conf             9813218987999836-85489999999985986999818964--------7889997898996453----1--------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC--------AVKQAKDMGIEVIDFR----E--------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~--------~~~~l~~~g~~~~~~~----~--------   59 (468)
                      |.-.+|+||.++|-|- ++-|.++|+.|.+.|++|...|.+..        ....++..|.+.....    +        
T Consensus         1 m~~~~L~gKvalVTGgs~GIG~aiA~~la~~Ga~vv~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~v~~~~   80 (257)
T PRK12744          1 MADHSLKGKVVLIAGGAKNLGGLIARDLAAQGAKAVAIHYNSAATKADAEETVAAVKAAGAKAVAFQADLTTAAAVEKLF   80 (257)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
T ss_conf             99999899989992887589999999999879989999378743689999999999973992899976889999999999


Q ss_pred             ----CCCCCCCEEEECCCCCCC
Q ss_conf             ----572258889988886856
Q gi|254781099|r   60 ----IPWSIISFLVLSPGIALT   77 (468)
Q Consensus        60 ----~~~~~~d~vv~Spgi~~~   77 (468)
                          ..+..+|.+|-..|+...
T Consensus        81 ~~~~~~~G~iDilVnnAG~~~~  102 (257)
T PRK12744         81 DDAKAAFGRPDIAINTVGKVLK  102 (257)
T ss_pred             HHHHHHCCCCCEEEECCCCCCC
T ss_conf             9999980998899976644567


No 166
>PRK08163 salicylate hydroxylase; Provisional
Probab=96.40  E-value=0.0073  Score=38.89  Aligned_cols=35  Identities=29%  Similarity=0.421  Sum_probs=32.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      +..+|+|+|.|.+|+++|..|.++|++|.++++.+
T Consensus         3 ~~~~V~IVGaGiaGL~lA~~L~r~Gi~v~V~Er~~   37 (396)
T PRK08163          3 HVTPVLIVGGGIGGLAAALALARQGIKVKLLEQAA   37 (396)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99849998978899999999997899999991799


No 167
>PRK13940 glutamyl-tRNA reductase; Provisional
Probab=96.35  E-value=0.02  Score=35.82  Aligned_cols=16  Identities=13%  Similarity=0.306  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHCCCCCC
Q ss_conf             99999999986379852
Q gi|254781099|r  440 RGFSFMSQVSEIPGIEM  456 (468)
Q Consensus       440 RG~~F~~~v~~l~~~~~  456 (468)
                      +++... ++++|||++.
T Consensus       397 ~~d~~~-a~~~LF~L~~  412 (414)
T PRK13940        397 RSDCLV-CMKRMFGLNV  412 (414)
T ss_pred             CHHHHH-HHHHHHCCCC
T ss_conf             788999-9999858877


No 168
>PRK07233 hypothetical protein; Provisional
Probab=96.34  E-value=0.0056  Score=39.67  Aligned_cols=32  Identities=34%  Similarity=0.520  Sum_probs=29.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ||.|+|.|.+|+++|..|.++|++|++.+.++
T Consensus         1 rVvVIGaG~aGLsaA~~L~~~G~~V~VlEa~~   32 (430)
T PRK07233          1 KIAIIGGGIMGLAAAYRLAKAGHEVTVFEADD   32 (430)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             98999977899999999983999889995899


No 169
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=96.33  E-value=0.021  Score=35.77  Aligned_cols=81  Identities=16%  Similarity=0.232  Sum_probs=57.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH-CCCEEECC--------CCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             7999836854899999999859869998189647889997-89899645--------31572258889988886856755
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD-MGIEVIDF--------REIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~-~g~~~~~~--------~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      ||.|+|.|.-|..+|+.|.+.||+|++.|.++..+.++.. ..+..+.+        .+...+.+|++|-.    .+..+
T Consensus         2 ~IiI~GaG~vG~~La~~Ls~e~~dV~vID~d~~~~~~~~~~lDv~~i~Gd~~~~~~L~~Agi~~ad~~IAv----T~~De   77 (455)
T PRK09496          2 KIIILGAGQVGGTLAERLVGENNDVTVIDTDEERLRRLQDRLDVRTVVGNGSHPDVLREAGAEDADMLIAV----TDSDE   77 (455)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHCCEEEEEECCCCHHHHHHCCCCCCCEEEEE----CCCHH
T ss_conf             79999988899999999986899799998999999998862586899966899999996599869999995----79718


Q ss_pred             CCHHH-HHHHHC-CCE
Q ss_conf             78889-999976-980
Q gi|254781099|r   81 AHWCV-KLANQF-NVE   94 (468)
Q Consensus        81 ~~~~~-~~a~~~-gi~   94 (468)
                      .|... ..|++. |.+
T Consensus        78 ~Nli~~~lAk~l~g~~   93 (455)
T PRK09496         78 TNMVACQIAKSLFGTP   93 (455)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999866998


No 170
>PRK01747 mnmC 5-methylaminomethyl-2-thiouridine methyltransferase; Reviewed
Probab=96.32  E-value=0.0073  Score=38.89  Aligned_cols=31  Identities=29%  Similarity=0.424  Sum_probs=14.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             8799983685489999999985986999818
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~   39 (468)
                      ++|.|+|.|..|.++|..|.++|++|+++|+
T Consensus       257 ~~VaVIGAGIAGas~A~~LA~rG~~VtVlDr  287 (660)
T PRK01747        257 RDAAIIGGGIAGAALALALARRGWQVTLYEA  287 (660)
T ss_pred             CCEEEECCHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             7189989389999999999978996899947


No 171
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=96.30  E-value=0.013  Score=37.22  Aligned_cols=40  Identities=28%  Similarity=0.488  Sum_probs=33.3

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             132189879998368548999999998598699981896478
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+++  |+|+|+|.|.-|.+.|..+...|++|..+|.++...
T Consensus         4 m~~I--k~VaVIGaG~MG~giAa~~a~~G~~V~l~D~~~~a~   43 (321)
T PRK07066          4 ITDI--KTFAAIGSGVIGSGWVARALAHGLDVVAWDPAPGAE   43 (321)
T ss_pred             CCCC--CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             2578--879998887888999999994798599996988899


No 172
>PRK06194 hypothetical protein; Provisional
Probab=96.30  E-value=0.014  Score=36.85  Aligned_cols=52  Identities=19%  Similarity=0.222  Sum_probs=41.1

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCEE
Q ss_conf             13218987999836-85489999999985986999818964788----999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~~   54 (468)
                      |.+|+||.+.|-|. ++-|+++|+.|.++|++|..+|.+...++    .+...|..+
T Consensus         1 M~~l~gKvavITGassGIG~a~A~~la~~Ga~Vvl~d~~~~~l~~~~~~l~~~g~~v   57 (301)
T PRK06194          1 MKDFAGKVAVITGAASGFGREFARIGARLGMKLVLADVQQDALDRAVAELRAQGAEV   57 (301)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             989899989992737799999999999879989999798899999999998459849


No 173
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated
Probab=96.30  E-value=0.018  Score=36.23  Aligned_cols=27  Identities=4%  Similarity=0.134  Sum_probs=12.1

Q ss_pred             CCCCCCHHHHHHHHHCCCCCCEEECCC
Q ss_conf             322478678999874012343011036
Q gi|254781099|r  218 IICINDHQCEKIAYDMNFIGHSISRIS  244 (468)
Q Consensus       218 iln~dd~~~~~~~~~~~~~~~~~~~~~  244 (468)
                      |...-....+.+.......+.++....
T Consensus       185 VTGASG~LG~aL~k~l~~~GAKVIalT  211 (410)
T PRK07424        185 VTGASGTLGQALLKELHQQGAKVIALT  211 (410)
T ss_pred             EECCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             954773778999999997799899993


No 174
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed
Probab=96.28  E-value=0.031  Score=34.54  Aligned_cols=47  Identities=17%  Similarity=0.118  Sum_probs=37.9

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             13218987999836-854899999999859869998189647889997
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |-+|+||.++|-|- ++-|+++|+.|.++|+.|...|.+...++.+..
T Consensus         1 ~~~l~gK~alITG~s~GIG~aia~~~a~~Ga~V~i~~~~~~~~~~~~~   48 (245)
T PRK12936          1 MFDLTGRKALVTGASGGIGEEIARLLHAQGAIVGLHGTRVEKLEALAA   48 (245)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             938899989992747689999999999869999998299999999999


No 175
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional
Probab=96.27  E-value=0.045  Score=33.43  Aligned_cols=48  Identities=27%  Similarity=0.293  Sum_probs=36.9

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCE
Q ss_conf             18987999836-85489999999985986999818964788----99978989
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIE   53 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~   53 (468)
                      |+||.+.|-|- ++-|.++|+.|.++|++|..+|.+.....    .++..+.+
T Consensus         2 L~gK~alITGas~GIG~aia~~la~~Ga~V~~~~~~~~~~~~~~~~~~~~g~~   54 (258)
T PRK12429          2 LKGKTALVTGAASGIGLEIALALAKEGAKVVIADLNDEAAAKAAEAIKKAGGK   54 (258)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC
T ss_conf             89598999488758999999999987999999979889999999999844991


No 176
>PRK05876 short chain dehydrogenase; Provisional
Probab=96.27  E-value=0.015  Score=36.67  Aligned_cols=52  Identities=17%  Similarity=0.315  Sum_probs=40.7

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             13218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |.+|+||.+.|-|- .+-|+++|+.|.++|++|...|.+.+.+    +.+...+...
T Consensus         1 M~~~~gKvavITGaasGIG~a~A~~la~~Ga~Vvi~d~~~~~l~~~~~~l~~~g~~~   57 (275)
T PRK05876          1 MDGFPGRGAVITGGASGIGLATGTEFARRGARVVLGDVDKPGLRQAVNHLRAEGFDV   57 (275)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             959899879992826699999999999879989999798899999999998269847


No 177
>PRK07041 short chain dehydrogenase; Provisional
Probab=96.26  E-value=0.018  Score=36.19  Aligned_cols=46  Identities=26%  Similarity=0.322  Sum_probs=37.1

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             9813218987999836-8548999999998598699981896478899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      |+| +|+||++.|-|- ++-|.++|+.|.+.|++|..+|.++..+...
T Consensus         1 M~~-~l~gK~~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~   47 (240)
T PRK07041          1 MQM-SLNDQKVLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAA   47 (240)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             998-85999899957788899999999998799999995988999999


No 178
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional
Probab=96.26  E-value=0.0075  Score=38.79  Aligned_cols=33  Identities=39%  Similarity=0.640  Sum_probs=30.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ++|.|+|.|..|+|+|..|.++|++|++.|+..
T Consensus         2 ~~V~VIGaGivGlstA~~La~~G~~VtviDr~~   34 (410)
T PRK12409          2 SHIAVIGAGITGVTTAYALAQRGYQVTVFDRHR   34 (410)
T ss_pred             CCEEEECCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             959998983999999999997899189996989


No 179
>PRK06841 short chain dehydrogenase; Provisional
Probab=96.26  E-value=0.042  Score=33.61  Aligned_cols=45  Identities=18%  Similarity=0.112  Sum_probs=36.4

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             3218987999836-85489999999985986999818964788999
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      -+|+||.++|-|- ++-|+++|+.|.+.|++|.++|.++...+...
T Consensus        11 ~~l~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~d~~~~~~~~~~   56 (255)
T PRK06841         11 FDLSGKVAVVTGGASGIGHAIAELFAAKGARVALLDRSEDVAEVAA   56 (255)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             5899999999796778999999999987999999969878999999


No 180
>PRK06753 hypothetical protein; Provisional
Probab=96.25  E-value=0.0073  Score=38.87  Aligned_cols=32  Identities=34%  Similarity=0.609  Sum_probs=30.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ||.|+|.|.+|+++|.+|.++|++|.++|+.+
T Consensus         2 kV~IVGaGiaGL~~A~~L~~~G~~v~V~Er~~   33 (373)
T PRK06753          2 KIAIIGAGIGGLTAAALLQEQGHTVKVFEKNE   33 (373)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             89999945899999999997799999988899


No 181
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]
Probab=96.24  E-value=0.074  Score=31.92  Aligned_cols=16  Identities=6%  Similarity=0.214  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHCCCCC
Q ss_conf             9999999998637985
Q gi|254781099|r  440 RGFSFMSQVSEIPGIE  455 (468)
Q Consensus       440 RG~~F~~~v~~l~~~~  455 (468)
                      +++.|-++++.||+.+
T Consensus       397 ~~~~~~~~~~~lf~~~  412 (414)
T COG0373         397 GSEELLRALRELFNLD  412 (414)
T ss_pred             CCHHHHHHHHHHHCCC
T ss_conf             6688999999984455


No 182
>PRK13512 coenzyme A disulfide reductase; Provisional
Probab=96.23  E-value=0.062  Score=32.44  Aligned_cols=33  Identities=18%  Similarity=0.339  Sum_probs=27.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECCC
Q ss_conf             87999836854899999999859--8699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG--VHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G--~~V~~~D~~~   41 (468)
                      +||.|+|-|..|+++|.-|++.+  .+|+.+++.+
T Consensus         2 ~kiVIIG~g~AG~~aA~~lrk~~~~~eItvi~~e~   36 (438)
T PRK13512          2 PKIVVVGAVAGGATCASQIRRLDKESDIIIFEKDR   36 (438)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             80999898499999999999439199999996899


No 183
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase. Members of this protein family are CoA-disulfide reductase (EC 1.8.1.14), as characterized in Staphylococcus aureus, Pyrococcus horikoshii, and Borrelia burgdorferi, and inferred in several other species on the basis of high levels of CoA and an absence of glutathione as a protective thiol.
Probab=96.23  E-value=0.038  Score=33.94  Aligned_cols=24  Identities=21%  Similarity=0.174  Sum_probs=13.2

Q ss_pred             CCCCCCCCCCCCCCCCEEEEECCC
Q ss_conf             124432211016888379992177
Q gi|254781099|r  147 NIGLPILNLEYFSPNRFYVIECSS  170 (468)
Q Consensus       147 NiG~p~~~~~~~~~~~~~V~E~SS  170 (468)
                      -||.-+.........++-|+|.+.
T Consensus       147 ~IGlE~A~~l~~~G~~Vtvve~~~  170 (427)
T TIGR03385       147 YIGLEMVEALRERGKNVTLIHRSD  170 (427)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             999999999997699899998468


No 184
>PRK09880 L-idonate 5-dehydrogenase; Provisional
Probab=96.22  E-value=0.035  Score=34.14  Aligned_cols=84  Identities=17%  Similarity=0.145  Sum_probs=33.8

Q ss_pred             CCCEEECCCCCCCHHHHHHHHHCC--CCCCEEE-ECCCCCCCCHHHHHHHHCCCCEEEEECC-----CHHHHHHHHH-CC
Q ss_conf             430000023556755555532013--3320012-0321012206898998427868999889-----9899888631-68
Q gi|254781099|r  323 GHVIFINDSKATNLHSVIHAFLNE--KRRIYWI-AGGLSKSDDFSTLFPFISKIAKAYFIGN-----SAMLFFHHFG-GK  393 (468)
Q Consensus       323 ~gv~iIDDS~atnp~a~~~Al~~~--~~~i~lI-~GG~~K~~d~~~L~~~~~~~~~~~liG~-----~~~~i~~~~~-~~  393 (468)
                      +++.++-|. +-++.+...|++..  .++++++ ++|..  .++ ++.....+-..  ++|.     +-....+.+. +.
T Consensus       234 g~~Dvvie~-~G~~~~~~~al~~~r~gG~iv~vG~~~~~--~~~-~~~~l~~kei~--i~Gs~~~~~~~~~~l~li~~g~  307 (343)
T PRK09880        234 GYFDVSFEV-SGHPSSVNTCLEVTRAKGVMVQVGMGGAM--PEF-PMMTLISKEIS--LKGSFRFTSEFNTAVSWLANGV  307 (343)
T ss_pred             CCCCEEEEE-CCCHHHHHHHHHHCCCCEEEEEEECCCCC--CCC-CHHHHHHCCCE--EEEECCCHHHHHHHHHHHHCCC
T ss_conf             997789992-19999999999737798399999727988--870-89999858849--9990486799999999998599


Q ss_pred             CC----EEEECCHHHHHHHHHHHH
Q ss_conf             98----899879999999999999
Q gi|254781099|r  394 IN----STLSKTLDQALKSVVRDV  413 (468)
Q Consensus       394 ~~----~~~~~~~~~a~~~i~~~~  413 (468)
                      ++    ......++++.++ ++.+
T Consensus       308 i~~~~lIt~~~~le~~~~A-f~~a  330 (343)
T PRK09880        308 INPLPLLSAEYPFTDLEEA-LIFA  330 (343)
T ss_pred             CCHHHEEEEEEEHHHHHHH-HHHH
T ss_conf             9804558879879999999-9984


No 185
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase. Members of this protein family are mycothiol-dependent formaldehyde dehydrogenase (EC 1.2.1.66). This protein is found, so far, only in the Actinobacteria (Mycobacterium sp., Streptomyces sp., Corynebacterium sp., and related species), where mycothione replaces glutathione.
Probab=96.22  E-value=0.041  Score=33.70  Aligned_cols=92  Identities=11%  Similarity=0.161  Sum_probs=37.9

Q ss_pred             CCEEECCCCCCCHHHHHHHHHCC--CCCCEEEECCCCCCCCHH-HHHHHHCCCCEE--EEECC-----CHHHHHHHHH-C
Q ss_conf             30000023556755555532013--332001203210122068-989984278689--99889-----9899888631-6
Q gi|254781099|r  324 HVIFINDSKATNLHSVIHAFLNE--KRRIYWIAGGLSKSDDFS-TLFPFISKIAKA--YFIGN-----SAMLFFHHFG-G  392 (468)
Q Consensus       324 gv~iIDDS~atnp~a~~~Al~~~--~~~i~lI~GG~~K~~d~~-~L~~~~~~~~~~--~liG~-----~~~~i~~~~~-~  392 (468)
                      |+.++=|. .-++.+...|+...  .++++ ++|.......+. ++.+...+...+  -.+|.     +-+...+.+. +
T Consensus       245 G~Dvvie~-~G~~~~~~~al~~~~~gG~iv-~~G~~~~~~~~~~~~~~~~~~~~~i~~s~~~~~~~~~~~~~~~~li~~g  322 (358)
T TIGR03451       245 GADVVIDA-VGRPETYKQAFYARDLAGTVV-LVGVPTPDMTLELPLLDVFGRGGALKSSWYGDCLPERDFPMLVDLYLQG  322 (358)
T ss_pred             CCCEEEEC-CCCHHHHHHHHHHHCCCCEEE-EEECCCCCCCCCCCHHHHHHCCCEEEEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             87499999-999899999999762796999-9922589973222699997377589998864876088999999999849


Q ss_pred             CCC----EEEECCHHHHHHHHHHHHHHCCCCCE
Q ss_conf             898----89987999999999999984489859
Q gi|254781099|r  393 KIN----STLSKTLDQALKSVVRDVENVQLPSI  421 (468)
Q Consensus       393 ~~~----~~~~~~~~~a~~~i~~~~~~~~~gDi  421 (468)
                      .++    .+....++++. .++.   ..+.|++
T Consensus       323 ~i~~~~lIt~~~~Le~~~-eAfe---~~~~g~~  351 (358)
T TIGR03451       323 RLPLDAFVTERIGLDDVE-EAFD---KMHAGDV  351 (358)
T ss_pred             CCCCCCCEEEEEEHHHHH-HHHH---HHHCCCC
T ss_conf             799841389998799999-9999---9877997


No 186
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=96.21  E-value=0.014  Score=36.85  Aligned_cols=37  Identities=30%  Similarity=0.295  Sum_probs=33.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             8799983685489999999985986999818964788
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      |+|+|+|.|.-|.++|..+...|++|..+|.++..+.
T Consensus         4 ~~VaViGaG~mG~~IA~~~a~~G~~V~l~D~~~~~l~   40 (282)
T PRK05808          4 QKIGVIGAGTMGNGIAQVCAVAGYDVVMVDISDEAVD   40 (282)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             6899989788999999999957993899979989999


No 187
>PRK07588 hypothetical protein; Provisional
Probab=96.18  E-value=0.0082  Score=38.53  Aligned_cols=33  Identities=27%  Similarity=0.339  Sum_probs=30.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             799983685489999999985986999818964
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      ||+|+|.|..|+++|..|.++|++|+++++.|.
T Consensus         2 kVlIvGaGiaGLalA~~L~r~G~~v~V~Er~~~   34 (391)
T PRK07588          2 KIAISGAGIAGATLAHWLQRTGHEPTLIERAPK   34 (391)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             799999328999999999868999899903898


No 188
>PRK12770 putative glutamate synthase subunit beta; Provisional
Probab=96.17  E-value=0.0095  Score=38.08  Aligned_cols=35  Identities=34%  Similarity=0.521  Sum_probs=32.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .||+|.|+|.|-.|+++|.++.+.|++|..+|..+
T Consensus        16 ~gkkV~IIGaGPaGlsAA~~aa~~G~~v~viEk~~   50 (350)
T PRK12770         16 TGKKVAIIGAGPAGLAAAGYLACLGHEVHVYDKLP   50 (350)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             97989999955889999999997899859995369


No 189
>PTZ00117 malate dehydrogenase; Provisional
Probab=96.16  E-value=0.036  Score=34.08  Aligned_cols=70  Identities=16%  Similarity=0.225  Sum_probs=45.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHH----HHHHH----CC--CEEE-CCCCCCCCCCCEEEECCCCCC
Q ss_conf             879998368548999999998598-699981896478----89997----89--8996-453157225888998888685
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAV----KQAKD----MG--IEVI-DFREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~----~~l~~----~g--~~~~-~~~~~~~~~~d~vv~Spgi~~   76 (468)
                      +||.|+|.|.-|.++|.+|..++. ++..+|.++...    ..+..    .+  ..+. ...-....+.|+||++.|+|.
T Consensus         2 ~KV~IIGaG~VG~~~A~~l~~~~~~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~i~~~~dy~~~~daDiVVitAG~~r   81 (313)
T PTZ00117          2 KKISIIGSGQIGAIVGLLLLQENLGDVYLYDVIEGVPQGKALDLKHFSTIIGVNANILGTNNYEDIKDSDVIVITAGVQR   81 (313)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHCCCCEEEECCCCCC
T ss_conf             78999897989999999997089987999958898308899887724203689857983799999689999998989989


Q ss_pred             CC
Q ss_conf             67
Q gi|254781099|r   77 TG   78 (468)
Q Consensus        77 ~~   78 (468)
                      ..
T Consensus        82 k~   83 (313)
T PTZ00117         82 KE   83 (313)
T ss_pred             CC
T ss_conf             97


No 190
>PRK12367 short chain dehydrogenase; Provisional
Probab=96.14  E-value=0.027  Score=34.95  Aligned_cols=89  Identities=19%  Similarity=0.210  Sum_probs=56.9

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH-HHHHHHCCCEEE---CCCCC----CCCCCCEEEECC
Q ss_conf             813218987999836-854899999999859869998189647-889997898996---45315----722588899888
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA-VKQAKDMGIEVI---DFREI----PWSIISFLVLSP   72 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~-~~~l~~~g~~~~---~~~~~----~~~~~d~vv~Sp   72 (468)
                      --+.|+||+|+|=|. |.=|+|+.+.|+++|++|.|....... .........+.+   ...+.    .....|.+|..-
T Consensus        11 ~~~~~kgKtIgITGAsGaLG~AL~k~f~~~GakVIalTh~~~~~~~~~~~~p~~wi~W~cG~E~~L~~~LkkiDILILNH   90 (250)
T PRK12367         11 INSRWNGKRIGITGASGALGKALTKLFRAKGAKVIGLTHSKINNSEISDESPNEWVSWECGKESSLDKTLAKIDVLILNH   90 (250)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHCCEEEECC
T ss_conf             55563898799967873899999999998899899983688887545567895289843499899999987588999838


Q ss_pred             CCCCCCCCCCHHHHHHHH
Q ss_conf             868567557888999997
Q gi|254781099|r   73 GIALTGENAHWCVKLANQ   90 (468)
Q Consensus        73 gi~~~~~~~~~~~~~a~~   90 (468)
                      ||-+...+....+..+-+
T Consensus        91 GIn~~~~~~~~~i~~s~E  108 (250)
T PRK12367         91 GINPGGRQNSNDINKALE  108 (250)
T ss_pred             CCCCCCCCCHHHHHHHHH
T ss_conf             777455659789999998


No 191
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=96.11  E-value=0.017  Score=36.28  Aligned_cols=37  Identities=35%  Similarity=0.541  Sum_probs=32.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             8799983685489999999985986999818964788
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      ++|+|+|.|.-|.+.|..+...|++|..+|.++....
T Consensus         3 ~~VaViGaG~mG~giA~~~a~~G~~V~l~D~~~~~l~   39 (308)
T PRK06129          3 GSIAIVGAGLIGRAWAIVFARAGHRVRLWDADPAALA   39 (308)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             8799977789999999999858993899989889999


No 192
>PRK08703 short chain dehydrogenase; Provisional
Probab=96.10  E-value=0.021  Score=35.76  Aligned_cols=44  Identities=23%  Similarity=0.303  Sum_probs=37.6

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             13218987999836-854899999999859869998189647889
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |.+|+||.|+|-|. ++-|.++|+.|.+.|++|...+++...++.
T Consensus         1 M~~L~gK~~lITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~   45 (239)
T PRK08703          1 MATLSDKTILVTGASQGLGEQVAKAYAAAGATVILVARHQKKLEK   45 (239)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             948596989994886289999999999879989999798889999


No 193
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional
Probab=96.10  E-value=0.02  Score=35.82  Aligned_cols=47  Identities=9%  Similarity=0.089  Sum_probs=39.2

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             13218987999836-854899999999859869998189647889997
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |..|+||.++|-|- ++-|.++|+.|.++|++|..+|.++..+..+..
T Consensus         1 M~~L~gK~alVTGas~GIG~aia~~l~~~Ga~V~~~~r~~~~l~~~~~   48 (263)
T PRK06200          1 MGWLTGQVALITGGGSGIGRALVERFLAEGARVAVLERSAEKCASLRQ   48 (263)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             987172889995866799999999999879999999799999999999


No 194
>PRK08265 short chain dehydrogenase; Provisional
Probab=96.09  E-value=0.022  Score=35.63  Aligned_cols=47  Identities=19%  Similarity=0.087  Sum_probs=38.4

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             13218987999836-854899999999859869998189647889997
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |.+|+||.++|-|- ++-|.++|+-|.++|++|.++|.+....+++.+
T Consensus         1 M~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~   48 (261)
T PRK08265          1 MIGLAGKVAIVTGGATLIGAAVARALVAAGACVAILDIDADNGAAVAA   48 (261)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             989999989994877689999999999879989999798899999999


No 195
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849   This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues. Among complete genomes, it is found is found in Bacillus subtilis and Mycobacterium tuberculosis, both of which also contain Gnd, and in Aquifex aeolicus. .
Probab=96.09  E-value=0.012  Score=37.36  Aligned_cols=51  Identities=31%  Similarity=0.552  Sum_probs=41.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH-H-CCCEEECCCC
Q ss_conf             8799983685489999999985986999818964788999-7-8989964531
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAK-D-MGIEVIDFRE   59 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~-~-~g~~~~~~~~   59 (468)
                      |+++.+|+|+=|.++++-|.++||+|+|||.++.+.+.++ + .++.+....|
T Consensus         2 ktlglIGLGrMG~ni~~rl~~rgh~~vgYd~~q~av~~~kG~d~~~gv~nl~E   54 (341)
T TIGR00872         2 KTLGLIGLGRMGANIAKRLADRGHEVVGYDRDQAAVEELKGEDRAEGVANLKE   54 (341)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHCCCCCCCCHHHHH
T ss_conf             52443133467899999985279469985388799999720113430012478


No 196
>PRK08277 D-mannonate oxidoreductase; Provisional
Probab=96.09  E-value=0.022  Score=35.58  Aligned_cols=52  Identities=25%  Similarity=0.254  Sum_probs=40.2

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCE
Q ss_conf             813218987999836-85489999999985986999818964788----99978989
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIE   53 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~   53 (468)
                      +|-+|+||.++|-|- ++-|.++|+.|.+.|++|..+|.+....+    .+...|.+
T Consensus         4 ~lf~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~l~~~g~~   60 (278)
T PRK08277          4 NLFSLKGKVAVITGGGGVLGGAMAKELARAGAKVAILDRNQEKAEAVVEEIKANGGE   60 (278)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCE
T ss_conf             063889998999586748999999999987998999979889999999999845990


No 197
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional
Probab=96.09  E-value=0.015  Score=36.74  Aligned_cols=112  Identities=16%  Similarity=0.121  Sum_probs=63.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCE----EEC---CCCC--CCCCCCEEEECCCCCCCC
Q ss_conf             9879998368548999999998598699981896478899978989----964---5315--722588899888868567
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE----VID---FREI--PWSIISFLVLSPGIALTG   78 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~----~~~---~~~~--~~~~~d~vv~Spgi~~~~   78 (468)
                      ...|+|+|+|.-|..+|+-|.++|++|.+||+.+...+.+.+..-.    +..   ..+.  ....+..|+..  ||.- 
T Consensus         5 ~~~IGiIGLGvMG~nmA~Nl~~~G~~V~vynrt~~k~~~~~~~~~~~~~~i~~~~sl~e~v~sl~~pr~Iilm--v~aG-   81 (474)
T PTZ00142          5 ESDIGLIGLAVMGQNLSLNMYSRGFKVSVYNRTTEKVEEFMKKAKEGNKFVKGYHSLEELVNSLKRPRRVMLL--IKAG-   81 (474)
T ss_pred             CCCEEEEEEHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCEEEEE--ECCC-
T ss_conf             6746687363867999999997898799977987999999985322467764667899999737999989998--2698-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             557888999997698099830342233430156886899603457521578999999873100
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~  141 (468)
                      +.    +....+.             .. ....+.- |-|-|+|---..|.=.+..|++.|..
T Consensus        82 ~~----Vd~vi~~-------------L~-~~L~~GD-IIID~GNs~~~dt~rr~~~l~~kgI~  125 (474)
T PTZ00142         82 EA----VDEFIDN-------------IL-PHLEKGD-IIIDGGNEWYNNSERRIKLCKEKGIL  125 (474)
T ss_pred             HH----HHHHHHH-------------HH-HCCCCCC-EEEECCCCCHHHHHHHHHHHHHCCCC
T ss_conf             25----9999999-------------98-5088999-89879988865799999999857991


No 198
>PRK06932 glycerate dehydrogenase; Provisional
Probab=96.08  E-value=0.018  Score=36.17  Aligned_cols=67  Identities=10%  Similarity=0.148  Sum_probs=30.6

Q ss_pred             HHHCCCEEEEEECCCHH--HHHHHHCCCEEECCCCC---CC-CCCCE-EEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             99859869998189647--88999789899645315---72-25888-998888685675578889999976980998
Q gi|254781099|r   27 LKDSGVHVIAWDDHPCA--VKQAKDMGIEVIDFREI---PW-SIISF-LVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        27 l~~~G~~V~~~D~~~~~--~~~l~~~g~~~~~~~~~---~~-~~~d~-vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
                      ..+..+++..+|..++.  .++++...+-+......   .+ ....+ +|...|+..++-+    +.+|+++||+|..
T Consensus        20 ~~~~~~~~~~~~~t~~eel~e~i~dad~ii~~~~~i~~~vl~~ap~LK~I~~~g~G~D~ID----~~aa~~~gI~V~n   93 (314)
T PRK06932         20 RPSFEHEWTEYDHTSADQTIERAKDADIVITSKVIFSRETLQQLPKLKLIAITATGTNNVD----LVAAKELGITVKN   93 (314)
T ss_pred             CCCCCCEEEECCCCCHHHHHHHHCCCCEEEECCCCCCHHHHHCCCCCEEEEECCCCCCCCC----HHHHHHCCEEEEE
T ss_conf             1356850797899998999998579989997898639999953999809988983456478----9999749979993


No 199
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional
Probab=96.08  E-value=0.07  Score=32.11  Aligned_cols=54  Identities=22%  Similarity=0.226  Sum_probs=38.8

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH---HHHHHHHCCCEE
Q ss_conf             9813218987999836-85489999999985986999818964---788999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC---AVKQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~---~~~~l~~~g~~~   54 (468)
                      |.+-+|+||.+.|-|- ++-|+++|+.|.+.|++|.+.|....   ..+.++..|...
T Consensus         8 m~~f~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~g~~~   65 (258)
T PRK06935          8 MDFFSLKGKVAIVTGGNTGLGQGYAVALAKAGADIIITTHGTNWDETRRLIEKEGRKV   65 (258)
T ss_pred             HHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHCCCCE
T ss_conf             5431999998999485758999999999987999999729978999999999669937


No 200
>PRK08339 short chain dehydrogenase; Provisional
Probab=96.07  E-value=0.023  Score=35.45  Aligned_cols=45  Identities=18%  Similarity=0.225  Sum_probs=36.8

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |+| +|+||.++|-|- ++-|.++|+.|.+.|++|..+|.++..+++
T Consensus         2 m~l-~L~gK~alITG~s~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~   47 (263)
T PRK08339          2 LKI-DLSGKLAFTTASSKGIGFGVARVLARAGADVIILSRNEENLKR   47 (263)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             741-7899989991626099999999999869999999798899999


No 201
>PRK06172 short chain dehydrogenase; Provisional
Probab=96.06  E-value=0.025  Score=35.13  Aligned_cols=53  Identities=23%  Similarity=0.299  Sum_probs=40.8

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             9813218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |.| +|+||.+.|-|- ++-|+++|+.|.+.|++|..+|.++...    +.++..|.+.
T Consensus         1 M~~-~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~   58 (253)
T PRK06172          1 MSM-TFSGQVALVTGGAAGIGRATAIAFAREGAKVVVADRDAAGGEETVALIREAGGEA   58 (253)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             998-8699989993757689999999999879989999798899999999999649937


No 202
>PRK07677 short chain dehydrogenase; Provisional
Probab=96.06  E-value=0.094  Score=31.21  Aligned_cols=72  Identities=13%  Similarity=0.173  Sum_probs=46.7

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEEC----CCC------------CCCCC
Q ss_conf             18987999836-8548999999998598699981896478----899978989964----531------------57225
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVID----FRE------------IPWSI   64 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~~----~~~------------~~~~~   64 (468)
                      ++||.++|-|- ++-|.++|+.|.+.|++|..+|++...+    +.++..|.++..    ..+            ..+..
T Consensus         1 L~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~g~   80 (254)
T PRK07677          1 MKEKVVIITGGSSGMGKAMAKRFAEEGANVVITGRTKEKLEEAKLEIEQFPGQVLTVQMDVRNPDDVQKMIEQIDEKFGR   80 (254)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCC
T ss_conf             95298999587678999999999987999999969999999999999856990999980389999999999999998399


Q ss_pred             CCEEEECCCCCCC
Q ss_conf             8889988886856
Q gi|254781099|r   65 ISFLVLSPGIALT   77 (468)
Q Consensus        65 ~d~vv~Spgi~~~   77 (468)
                      .|.+|-+.|+...
T Consensus        81 iDiLVnNAg~~~~   93 (254)
T PRK07677         81 IDALINNAAGNFI   93 (254)
T ss_pred             CCEEEECCCCCCC
T ss_conf             8889975755778


No 203
>PRK08605 D-lactate dehydrogenase; Validated
Probab=96.06  E-value=0.013  Score=37.05  Aligned_cols=71  Identities=18%  Similarity=0.133  Sum_probs=36.0

Q ss_pred             CEEEEECCCHHHHHH-HHHHHHCCCEEEEEECCCHH--HHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHH
Q ss_conf             879998368548999-99999859869998189647--889997898996453157225888998888685675578889
Q gi|254781099|r    9 HSIAVFGLGRSGLSA-ACALKDSGVHVIAWDDHPCA--VKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCV   85 (468)
Q Consensus         9 k~v~i~G~G~sG~s~-A~~l~~~G~~V~~~D~~~~~--~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~   85 (468)
                      +||.++|+----++. -+++.+.|++|...+.....  ++.               ..++|.+++...-+.    ....+
T Consensus         2 ~Ki~~~~~~~~e~~~~~~~~~~~~~ev~~~~~~~~ee~i~~---------------~~~~D~i~v~~~~~i----~~~vl   62 (332)
T PRK08605          2 TKIKLMSVRDEDAPYIKAWAEKHHVEVDLTKEALTDDNVEE---------------VEGFDGLSLSQQIPL----SEAIY   62 (332)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHH---------------HCCCCEEEEECCCCC----CHHHH
T ss_conf             76999827665699999988865907999669999899998---------------579988999707977----99999


Q ss_pred             HHHHHCCCEEEEE
Q ss_conf             9999769809983
Q gi|254781099|r   86 KLANQFNVEIIGD   98 (468)
Q Consensus        86 ~~a~~~gi~v~s~   98 (468)
                      .++++.++.+++.
T Consensus        63 ~~~~~l~iK~I~r   75 (332)
T PRK08605         63 KLLNELGIKQIAQ   75 (332)
T ss_pred             HHHHHCCCEEEEE
T ss_conf             9666369779997


No 204
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated
Probab=96.06  E-value=0.02  Score=35.86  Aligned_cols=35  Identities=31%  Similarity=0.308  Sum_probs=32.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             87999836854899999999859869998189647
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA   43 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~   43 (468)
                      |||+|+|.|.-|.+.|..+...|++|..+|.+|..
T Consensus         3 kkVAVIGAGvMGsGwAa~FA~aG~~V~L~Dp~peA   37 (489)
T PRK07531          3 MKAACIGGGVIGGGWAARFLLNGWDVAVFDPHPEA   37 (489)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHH
T ss_conf             67999871886899999999579969999488789


No 205
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of eukaryotic LDHs. Vertebrate LDHs are non-allosteric. This is in contrast to some bacterial LDHs that are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=96.05  E-value=0.023  Score=35.42  Aligned_cols=73  Identities=11%  Similarity=0.183  Sum_probs=47.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHH----CC-CEEEC-CCCCCCCCCCEEEECCCC
Q ss_conf             89879998368548999999998598--699981896478----89997----89-89964-531572258889988886
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKD----MG-IEVID-FREIPWSIISFLVLSPGI   74 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~----~g-~~~~~-~~~~~~~~~d~vv~Spgi   74 (468)
                      .+.||.|+|.|.-|-++|..|..+|.  ++..+|.++...    ..+..    .+ ..+.. ..-....+.|+||++.|.
T Consensus         2 ~r~Kv~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~h~~~~~~~~~v~~~~d~~~~~~aDvVVitAG~   81 (312)
T cd05293           2 PRNKVTVVGVGQVGMACAISILAKGLADELVLVDVVEDKLKGEAMDLQHGSAFLKNPKIEADKDYSVTANSKVVIVTAGA   81 (312)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEECCCHHHHCCCCEEEECCCC
T ss_conf             98869998978889999999996699887999938898332688886604012798559937999996899999988999


Q ss_pred             CCCCC
Q ss_conf             85675
Q gi|254781099|r   75 ALTGE   79 (468)
Q Consensus        75 ~~~~~   79 (468)
                      |....
T Consensus        82 ~~k~g   86 (312)
T cd05293          82 RQNEG   86 (312)
T ss_pred             CCCCC
T ss_conf             99989


No 206
>PRK06487 glycerate dehydrogenase; Provisional
Probab=96.05  E-value=0.013  Score=37.10  Aligned_cols=67  Identities=6%  Similarity=0.079  Sum_probs=36.6

Q ss_pred             HHHCCCEEEEEECCCHH--HHHHHHCCCEEECCCCC---CCC-CCCE-EEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             99859869998189647--88999789899645315---722-5888-998888685675578889999976980998
Q gi|254781099|r   27 LKDSGVHVIAWDDHPCA--VKQAKDMGIEVIDFREI---PWS-IISF-LVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        27 l~~~G~~V~~~D~~~~~--~~~l~~~g~~~~~~~~~---~~~-~~d~-vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
                      |.+.+.++..++...+.  .+.+....+-+......   .++ ...+ +|...|...++-+    +.+++++||+|..
T Consensus        21 l~~~~~~~~~~~~t~~~el~~~~~dadi~i~~~~~i~~~~l~~ap~LK~I~~~g~G~d~ID----~~aa~~~gI~V~n   94 (317)
T PRK06487         21 LEQAFDELQLHAATRPEQVAERLQGAQVAISNKVALDAAALAAAPQLKLILVAATGTNNVD----LAAARERGITVCN   94 (317)
T ss_pred             HHHHCCCEEEECCCCHHHHHHHHCCCCEEEECCCCCCHHHHHCCCCCEEEEECCCCCCCCC----HHHHHHCCCEEEE
T ss_conf             9852995799569998999998489919996897128999934999819988883632206----9999978998997


No 207
>PRK05875 short chain dehydrogenase; Provisional
Probab=96.05  E-value=0.025  Score=35.15  Aligned_cols=44  Identities=27%  Similarity=0.358  Sum_probs=35.9

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             9813218987999836-85489999999985986999818964788
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      |+| +|+||.++|-|. ++-|.++|+.|.+.|++|..++.++..+.
T Consensus         1 M~l-~L~gK~alVTGas~GIG~aiA~~la~~Ga~Vii~~r~~~~l~   45 (277)
T PRK05875          1 MQL-SLQDRTYLVTGGGSGIGKGVAAALVAAGAAVMIVGRNPDKLA   45 (277)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             904-689998999488749999999999987998999979889999


No 208
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated
Probab=96.05  E-value=0.064  Score=32.37  Aligned_cols=99  Identities=10%  Similarity=-0.058  Sum_probs=39.2

Q ss_pred             CCCCCEEECCCCCCCHHHHHHHHHCC--CCCCEEEECCCCCCCCHHHHHHHHCCCCEEE-EECCCH-H---HHHHHHHCC
Q ss_conf             03430000023556755555532013--3320012032101220689899842786899-988998-9---988863168
Q gi|254781099|r  321 RLGHVIFINDSKATNLHSVIHAFLNE--KRRIYWIAGGLSKSDDFSTLFPFISKIAKAY-FIGNSA-M---LFFHHFGGK  393 (468)
Q Consensus       321 ~~~gv~iIDDS~atnp~a~~~Al~~~--~~~i~lI~GG~~K~~d~~~L~~~~~~~~~~~-liG~~~-~---~i~~~~~~~  393 (468)
                      ...|+.++=|.- -++.+...+++..  .++++ ++|-......+ .+.....+...+. .+|.+. +   .+...+.+.
T Consensus       229 ~~~G~Dvvid~~-G~~~~~~~~~~~l~~gG~vv-~~G~~~~~~~i-~~~~~~~k~l~i~G~~g~~~~~~~~~~~~l~~~g  305 (341)
T PRK05396        229 MTEGFDVGLEMS-GAPSAFRQMLDAMNHGGRIA-MLGIPPGDMSI-DWNKVIFKGLTIKGIYGREMFETWYKMAALLQSG  305 (341)
T ss_pred             CCCCCEEEEECC-CCHHHHHHHHHHHHCCCEEE-EEECCCCCCCC-CHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCC
T ss_conf             899976999878-98999999999863598999-99557998750-7999986683899985510577899999999779


Q ss_pred             CC----EEEECCHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             98----8998799999999999998448985999
Q gi|254781099|r  394 IN----STLSKTLDQALKSVVRDVENVQLPSIVL  423 (468)
Q Consensus       394 ~~----~~~~~~~~~a~~~i~~~~~~~~~gDiVL  423 (468)
                      ++    ......++++. .+.+..+.-+.|-+||
T Consensus       306 ~~~~~lIt~~f~Lee~~-eA~~~~~~g~~gKvVl  338 (341)
T PRK05396        306 LDLSPIITHRFPIDDFQ-KGFEAMRSGQSGKVIL  338 (341)
T ss_pred             CCCCCEEEEEEEHHHHH-HHHHHHHCCCCCEEEE
T ss_conf             99874363598899999-9999997799717999


No 209
>PRK08017 short chain dehydrogenase; Provisional
Probab=96.03  E-value=0.066  Score=32.25  Aligned_cols=45  Identities=31%  Similarity=0.432  Sum_probs=37.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCE
Q ss_conf             87999836-8548999999998598699981896478899978989
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE   53 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~   53 (468)
                      |.|+|-|. ++-|+++|+.|.++|++|.+.++++..+.++...+..
T Consensus         3 K~vlITGassGIG~a~A~~la~~G~~V~~~~r~~~~l~~~~~~~~~   48 (256)
T PRK08017          3 KSVLITGCSSGIGLESALELKRQGFRVLAGCRKPDDVARMNSMGFT   48 (256)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCC
T ss_conf             7899965876899999999998799999996998999999856994


No 210
>PRK08862 short chain dehydrogenase; Provisional
Probab=96.03  E-value=0.024  Score=35.30  Aligned_cols=42  Identities=19%  Similarity=0.343  Sum_probs=35.6

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             218987999836-854899999999859869998189647889
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      +|+||.++|-|. ++-|+++|+.|.+.|++|..+|.++..+++
T Consensus         2 dlk~Kv~lITGas~GIG~aiA~~~A~~Ga~Vii~~r~~~~l~~   44 (227)
T PRK08862          2 DIKNSIILITSAGSVLGRTISCHFARLGATLILCDQDQSALND   44 (227)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             9999999997988799999999999879999999699999999


No 211
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=96.02  E-value=0.02  Score=35.81  Aligned_cols=36  Identities=25%  Similarity=0.254  Sum_probs=32.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.++|..+...|++|..+|.++..+
T Consensus         4 ~~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l   39 (288)
T PRK08293          4 KKVTVAGAGVLGSQIAFQTAFKGFDVTIYDISEEAL   39 (288)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             789998978899999999995799289998988999


No 212
>pfam02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain. This family also includes lambda crystallin.
Probab=96.01  E-value=0.018  Score=36.13  Aligned_cols=35  Identities=29%  Similarity=0.390  Sum_probs=31.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             79998368548999999998598699981896478
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      ||+|+|.|.-|.+.|..+...|++|..+|.++..+
T Consensus         1 kV~ViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l   35 (180)
T pfam02737         1 KVAVIGAGTMGAGIAQVFARAGLEVVLVDISEEAL   35 (180)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             98999978899999999996799399997998999


No 213
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase. The sequences in this family are members of the pfam01593 superfamily of flavin-containing amine oxidases which include the phytoene desaturases. These sequences also include a FAD-dependent oxidoreductase domain, pfam01266. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of squalene, the condensation product of the polyisoprenoid farnesyl pyrophosphate. This gene and its association with hopene biosynthesis in Zymomonas mobilis has been noted in the literature where the gene symbol hpnE was assigned. This gene is also found in contexts where the downstream conversion of squalene to hopenes is not evidence. The precise nature of the reaction catalyzed by this enzyme is unknown at this time.
Probab=96.01  E-value=0.01  Score=37.83  Aligned_cols=31  Identities=39%  Similarity=0.682  Sum_probs=28.6

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9998368548999999998598699981896
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |.|+|.|++|+++|+.|.+.|++|++.+.++
T Consensus         1 VvVIGaGlaGL~AA~~L~~~G~~V~VlEa~~   31 (430)
T TIGR03467         1 VVIIGGGLAGLSAAVELARAGVRVTLFEARP   31 (430)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             2998786899999999987899889994899


No 214
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated
Probab=96.01  E-value=0.02  Score=35.85  Aligned_cols=36  Identities=25%  Similarity=0.254  Sum_probs=32.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.+.|..+...|++|..+|.++..+
T Consensus         4 k~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l   39 (291)
T PRK06035          4 KVIGVVGSGVMGQGIAQVFARTGYDVTIVDVSEEIL   39 (291)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             889998876889999999995899889998998999


No 215
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=96.00  E-value=0.022  Score=35.60  Aligned_cols=36  Identities=25%  Similarity=0.412  Sum_probs=32.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.++|..+...|++|..+|.++..+
T Consensus         3 ~kV~ViGaG~mG~~IA~~~a~~G~~V~l~D~~~~~~   38 (284)
T PRK07819          3 QRVGVVGAGQMGSGIAEVCARAGVDVLVFETTEEAA   38 (284)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             679998977899999999995799089997988999


No 216
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed
Probab=95.99  E-value=0.06  Score=32.58  Aligned_cols=67  Identities=18%  Similarity=0.194  Sum_probs=51.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC---CEEEEEECCCHHHHHHHH-CCCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             87999836854899999999859---869998189647889997-8989964531572258889988886856
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG---VHVIAWDDHPCAVKQAKD-MGIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G---~~V~~~D~~~~~~~~l~~-~g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      +||+|+|.|.=|.++++-|.+.|   .++.++|.++...+.+.. .++.+........+..|+||++  +.|.
T Consensus         3 ~kI~~IG~G~Mg~Aii~gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~v~~~~~~~~~~~~~diIiLa--VKP~   73 (267)
T PRK11880          3 KKIGFIGGGNMASAIIGGLLASGVPAKDIIVSDPSPEKRAALAEEYGVRAATDNQEAAQEADVVVLA--VKPQ   73 (267)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCEEECCHHHHHHCCCEEEEE--ECHH
T ss_conf             8799986689999999999977989452899779999999999973967857869887219999997--2878


No 217
>PRK08085 gluconate 5-dehydrogenase; Provisional
Probab=95.98  E-value=0.029  Score=34.69  Aligned_cols=53  Identities=23%  Similarity=0.290  Sum_probs=40.9

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCEE
Q ss_conf             813218987999836-85489999999985986999818964788----999789899
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIEV   54 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~~   54 (468)
                      +|-+|+||.++|-|- ++-|+++|+.|.+.|++|..+|.++...+    ++...|.+.
T Consensus         3 ~~~~L~gK~alVTG~~~GIG~aiA~~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~   60 (254)
T PRK08085          3 DLFSLAGKNILITGSAQGIGFLLATGLAEYGAEIIINDITAERAEKAVAKLRQEGIKA   60 (254)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             6728999989996856789999999999869999999698899999999998449818


No 218
>KOG0399 consensus
Probab=95.96  E-value=0.036  Score=34.05  Aligned_cols=11  Identities=45%  Similarity=0.655  Sum_probs=4.5

Q ss_pred             EEEECCCCCCH
Q ss_conf             99603457521
Q gi|254781099|r  116 IAVTGTNGKSS  126 (468)
Q Consensus       116 I~VTGT~GKTT  126 (468)
                      |.+|||.|-+-
T Consensus      1373 i~~~GsAGQSf 1383 (2142)
T KOG0399        1373 INFTGSAGQSF 1383 (2142)
T ss_pred             EEEEECCCCCC
T ss_conf             98874365400


No 219
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases. L-2-hydroxyisocapronate dehydrogenase (HicDH) catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. This subfamily is composed of HicDHs and some bacterial L-lactate dehydrogenases (LDH). LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Bacterial LDHs can be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. Members of this subfamily with known structures such as the HicDH of Lactobacillus confusus, the non-allosteric LDH of Lactobacillus pentosus, and the allosteric LDH of Bacillus stearothermophilus, show that they exist as homotetramers. The HicDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine
Probab=95.95  E-value=0.068  Score=32.17  Aligned_cols=70  Identities=16%  Similarity=0.219  Sum_probs=47.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHH------CCCEEECCCCCCCCCCCEEEECCCCCC
Q ss_conf             879998368548999999998598--699981896478----89997------898996453157225888998888685
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKD------MGIEVIDFREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~------~g~~~~~~~~~~~~~~d~vv~Spgi~~   76 (468)
                      |||.|+|.|.-|.++|..|..++.  ++..+|.++...    ..+..      ....+.........+.|+||++-|+|.
T Consensus         1 rKI~IIGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~G~a~DL~~~~~~~~~~~~i~~~~~~~~~~aDvvVitAG~~r   80 (306)
T cd05291           1 RKVVIIGAGHVGSSFAYSLVNQGIADELVLIDINEEKAEGEALDLEDALAFLPSPVKIKAGDYSDCKDADIVVITAGAPQ   80 (306)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEEECCHHHHCCCCEEEECCCCCC
T ss_conf             95999996988999999998579987799981898701769998870133059973996088788478999999067667


Q ss_pred             CC
Q ss_conf             67
Q gi|254781099|r   77 TG   78 (468)
Q Consensus        77 ~~   78 (468)
                      ..
T Consensus        81 k~   82 (306)
T cd05291          81 KP   82 (306)
T ss_pred             CC
T ss_conf             99


No 220
>PRK07660 consensus
Probab=95.94  E-value=0.023  Score=35.39  Aligned_cols=36  Identities=25%  Similarity=0.248  Sum_probs=32.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.++|..+...|++|..+|.++..+
T Consensus         4 k~VaViGaG~MG~gIA~~~a~~G~~V~l~D~~~~~l   39 (283)
T PRK07660          4 QKIVVIGAGQMGSGIAQVCAMAGYDVKVQDLKQEQL   39 (283)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             889998969899999999996698189997988999


No 221
>KOG0069 consensus
Probab=95.93  E-value=0.028  Score=34.79  Aligned_cols=27  Identities=7%  Similarity=0.137  Sum_probs=19.5

Q ss_pred             EEEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             8998888685675578889999976980998
Q gi|254781099|r   67 FLVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        67 ~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
                      -++.++|+..++    .-+++++++||+|.-
T Consensus        86 K~i~t~~vG~D~----vDl~a~~krgI~V~n  112 (336)
T KOG0069          86 KLIVTMSVGYDH----VDLEAARKRGIRVAN  112 (336)
T ss_pred             EEEEEEECCCCH----HHHHHHHHCCCEEEC
T ss_conf             699984106532----138989865966860


No 222
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated
Probab=95.92  E-value=0.0083  Score=38.48  Aligned_cols=33  Identities=42%  Similarity=0.462  Sum_probs=31.5

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             189879998368548999999998598699981
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD   38 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D   38 (468)
                      .-||||+|.|+|-.|..++.+|.+.||.|++.|
T Consensus       399 ~tg~~VLVvGlGPAG~tLsH~Lln~Gh~Vv~ID  431 (1048)
T PRK06567        399 PTNYNILVTGLGPAGFSLSYYLLRSGHNVTAID  431 (1048)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             899648999248652018899874787289865


No 223
>pfam00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain. This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Probab=95.92  E-value=0.029  Score=34.75  Aligned_cols=72  Identities=14%  Similarity=0.198  Sum_probs=38.1

Q ss_pred             HHHHHHHHCCCEEEEEECCCHH--HHHHHHCCCEEEC-CCCCC---CCC-CCE-EEECCCCCCCCCCCCHHHHHHHHCCC
Q ss_conf             9999999859869998189647--8899978989964-53157---225-888-99888868567557888999997698
Q gi|254781099|r   22 SAACALKDSGVHVIAWDDHPCA--VKQAKDMGIEVID-FREIP---WSI-ISF-LVLSPGIALTGENAHWCVKLANQFNV   93 (468)
Q Consensus        22 s~A~~l~~~G~~V~~~D~~~~~--~~~l~~~g~~~~~-~~~~~---~~~-~d~-vv~Spgi~~~~~~~~~~~~~a~~~gi   93 (468)
                      +..++|.+.|++|...+..+..  .+.++....-+.. .....   ++. ..+ +|...|+..++-    -+.+|+++||
T Consensus        10 ~~~~~L~~~g~ev~~~~~~~~eel~~~~~~~d~li~~~~~~i~~e~l~~~~~LK~I~~~~~G~D~I----D~~~a~~~gI   85 (313)
T pfam00389        10 EELELLKEAGHEVEVHDELLTEELLEAAKDADALIVRSTTPVTAEVLEAAPGLKVIARRGVGVDNI----DLDAATERGI   85 (313)
T ss_pred             HHHHHHHHCCCEEEECCCCCHHHHHHHHCCCCEEEECCCCCCCHHHHHCCCCCEEEEECCCCCCHH----HHHHHHHCCC
T ss_conf             999999978988998999998999998389829998589976899994499984999888445530----5999997999


Q ss_pred             EEEE
Q ss_conf             0998
Q gi|254781099|r   94 EIIG   97 (468)
Q Consensus        94 ~v~s   97 (468)
                      +|..
T Consensus        86 ~V~n   89 (313)
T pfam00389        86 LVTN   89 (313)
T ss_pred             EEEE
T ss_conf             9998


No 224
>PRK07538 hypothetical protein; Provisional
Probab=95.92  E-value=0.013  Score=37.11  Aligned_cols=32  Identities=28%  Similarity=0.532  Sum_probs=30.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      +|.|+|.|.+|+++|..|+++|++|.+++..+
T Consensus         2 ~V~IvGaG~aGL~lA~~L~~~Gi~v~V~E~~~   33 (413)
T PRK07538          2 KVLIAGGGIGGLTLALTLHQRGIEVEVFEAAP   33 (413)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             89999905899999999997899989993699


No 225
>PRK09134 short chain dehydrogenase; Provisional
Probab=95.91  E-value=0.11  Score=30.84  Aligned_cols=75  Identities=16%  Similarity=0.221  Sum_probs=47.9

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEE-EECCCHH----HHHHHHCCCEEEC----CCC------------C
Q ss_conf             13218987999836-85489999999985986999-8189647----8899978989964----531------------5
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIA-WDDHPCA----VKQAKDMGIEVID----FRE------------I   60 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~-~D~~~~~----~~~l~~~g~~~~~----~~~------------~   60 (468)
                      |..+.+|.++|-|- ++-|.++|+.|.+.|++|.. ++.+...    ..+++..|.+...    ..+            .
T Consensus         4 m~~~~~KvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~i~~~g~~~~~~~~Dl~~~~~~~~~v~~~~~   83 (256)
T PRK09134          4 MPMAAPRAALVTGAARRIGRAIALDLAAHGFDVAVHYNRSRDEAEALAAEIRALGRRAVALQADLADEAQVRALVARASA   83 (256)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             98999997999488678999999999987998999849998999999999996499189997558999999999999999


Q ss_pred             CCCCCCEEEECCCCCCC
Q ss_conf             72258889988886856
Q gi|254781099|r   61 PWSIISFLVLSPGIALT   77 (468)
Q Consensus        61 ~~~~~d~vv~Spgi~~~   77 (468)
                      .+...|.+|-..|+...
T Consensus        84 ~~G~iDiLVnNAg~~~~  100 (256)
T PRK09134         84 ALGPITLLVNNASLFEY  100 (256)
T ss_pred             HHCCCCEEEECCCCCCC
T ss_conf             82998789988711689


No 226
>pfam03435 Saccharop_dh Saccharopine dehydrogenase. This family comprised of three structural domains that can not be separated in the linear sequence. In some organisms this enzyme is found as a bifunctional polypeptide with lysine ketoglutarate reductase. The saccharopine dehydrogenase can also function as a saccharopine reductase.
Probab=95.91  E-value=0.12  Score=30.48  Aligned_cols=83  Identities=14%  Similarity=0.104  Sum_probs=54.5

Q ss_pred             EEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHHHHHHH--CC--CEEE--CCCC-----CCCCCCCEEEECCCCCCC
Q ss_conf             9998368548999999998598--69998189647889997--89--8996--4531-----572258889988886856
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKD--MG--IEVI--DFRE-----IPWSIISFLVLSPGIALT   77 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~~l~~--~g--~~~~--~~~~-----~~~~~~d~vv~Spgi~~~   77 (468)
                      |+|+|.|..|.+++.+|.+.+.  +|++.|.+....+++..  .+  +...  +..+     ......|+||-.  .|+.
T Consensus         1 IlvlGaG~vG~~~~~~L~~~~~~~~i~vad~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~~diVv~~--~p~~   78 (384)
T pfam03435         1 VLIIGAGGVGQGVAPLLARHGDVDEITVADRSLEKAQALAAPKLGLRFIAIAVDADNYEALAALLKEGDLVINL--APPF   78 (384)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCEEEEC--CCHH
T ss_conf             98989778799999999728998869999898899898775236985389995778999999987128999999--8434


Q ss_pred             CCCCCHHHHHHHHCCCEEEE
Q ss_conf             75578889999976980998
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s   97 (468)
                        ...++++.+.+.|+.++.
T Consensus        79 --~~~~i~~~c~~~g~~yvd   96 (384)
T pfam03435        79 --LSLTVLKACIETGVHYVD   96 (384)
T ss_pred             --HCHHHHHHHHHCCCCEEE
T ss_conf             --169999999973997575


No 227
>PRK06475 salicylate hydroxylase; Provisional
Probab=95.90  E-value=0.013  Score=37.19  Aligned_cols=33  Identities=36%  Similarity=0.408  Sum_probs=30.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ..|+|+|.|.+|+++|.+|.++|++|.++++.+
T Consensus         3 ~~VlIVGaGiaGL~~A~~L~~~G~~v~V~E~~~   35 (400)
T PRK06475          3 GSILIAGAGVAGLSAALELAARGWAVTIIEKAQ   35 (400)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             979998958899999999997899999991799


No 228
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed
Probab=95.90  E-value=0.07  Score=32.08  Aligned_cols=16  Identities=31%  Similarity=0.480  Sum_probs=9.4

Q ss_pred             HHHCCCHHHHHHCCCCC
Q ss_conf             11001101222102222
Q gi|254781099|r  282 IQNLVTSAVVCMQLGLK  298 (468)
Q Consensus       282 i~NalaAia~a~~lGi~  298 (468)
                      -.|+++++ .|+.+|++
T Consensus       309 e~Ni~~~l-lAk~~g~~  324 (455)
T PRK09496        309 EANILSSL-LAKRLGAK  324 (455)
T ss_pred             HHHHHHHH-HHHHCCCC
T ss_conf             88999999-99873997


No 229
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.89  E-value=0.03  Score=34.61  Aligned_cols=43  Identities=19%  Similarity=0.304  Sum_probs=35.6

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             18987999836-85489999999985986999818964788999
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      |+||+++|-|. ++-|.++|+.|.++|++|..+|+++..++++.
T Consensus         3 l~gK~~lVTGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~   46 (238)
T PRK05786          3 LKGKNVLIVGVSPGLGYAVAYFALREGASVYAFARSEEKLKEIK   46 (238)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             79988999289878999999999987999999969889999999


No 230
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=95.88  E-value=0.024  Score=35.31  Aligned_cols=36  Identities=25%  Similarity=0.276  Sum_probs=32.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.++|..+...|++|..+|.++..+
T Consensus         3 kkV~ViGaG~MG~~IA~~~a~~G~~V~l~D~~~e~l   38 (289)
T PRK09260          3 EKIVVVGAGVMGRGIAYVFASSGFQTTLVDISQEQL   38 (289)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             769997968878999999996899889997998999


No 231
>PRK05562 precorrin-2 dehydrogenase; Provisional
Probab=95.87  E-value=0.16  Score=29.69  Aligned_cols=125  Identities=14%  Similarity=0.190  Sum_probs=76.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHHHHHCC-CEEE--CCCCCCCCCCCEEEECCCCCCCCCCCC
Q ss_conf             8987999836854899999999859869998189-64788999789-8996--453157225888998888685675578
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQAKDMG-IEVI--DFREIPWSIISFLVLSPGIALTGENAH   82 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g-~~~~--~~~~~~~~~~d~vv~Spgi~~~~~~~~   82 (468)
                      ++.+|+|+|=|.-+.-=++.|...|+.|++.-.. .+.+..+...+ +.+.  ++.+..+++.++||.+    .++++.|
T Consensus        23 ~klkvLVVGGG~VA~RKi~~Ll~agA~VtVVSP~~~~el~~L~~~~~I~~i~r~y~~~dL~~~~LVIaA----Tdd~~lN   98 (222)
T PRK05562         23 NKIKVLVIGGGKAAFIKGKTFLKKGCYVEILSKEFSKEFLDLKKYGNLKLIKGNYDKEFIKDKHLIIIA----TDDEELN   98 (222)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCEEEEECCCCHHHCCCCCEEEEE----CCCHHHH
T ss_conf             676699999879999999999878998999878668899999975986999686797780887399994----7988999


Q ss_pred             HHH-HHHHHCCCEEE--EEHHHHHHHHHHCCCCCC-EEEEECCCCCCHH-HHHHHHHHH
Q ss_conf             889-99997698099--830342233430156886-8996034575215-789999998
Q gi|254781099|r   83 WCV-KLANQFNVEII--GDIELFVRERRFSSLQSP-FIAVTGTNGKSST-VALISHVLR  136 (468)
Q Consensus        83 ~~~-~~a~~~gi~v~--s~~el~~~~~~~~~~~~~-vI~VTGT~GKTTt-~~ll~~iL~  136 (468)
                      ..+ +.|++.|+++.  +++++..-.........+ +|||+ |.|++-. +.+|..-|+
T Consensus        99 ~~I~~~a~~~~ilvNvvddp~~~~fi~Paiv~Rg~L~IAIS-T~G~SP~lAr~iR~klE  156 (222)
T PRK05562         99 NKIRKHCDRLYKLYIDCSDFKKGLCVIPYQRSSKNMVFALN-TKGGSPKTSVFIGEKVK  156 (222)
T ss_pred             HHHHHHHHHHCCEEEECCCCCCCCEEECEEEEECCEEEEEE-CCCCCHHHHHHHHHHHH
T ss_conf             99999999809988985788768179770997289799998-99989799999999999


No 232
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional
Probab=95.86  E-value=0.027  Score=34.93  Aligned_cols=40  Identities=15%  Similarity=0.226  Sum_probs=33.6

Q ss_pred             CHHHCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             132189879998368---5489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |-+|+||+++|-|.+   +-|+++|+.|.+.|++|..++.+..
T Consensus         1 m~~L~gK~~lVTGaag~rGIG~aiA~~la~~Ga~Vvi~~~~~~   43 (256)
T PRK08594          1 MLSLEGKTYVVMGVANKRSIAWGIARSLHNAGAKLVFTYAGER   43 (256)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCH
T ss_conf             9899998899989999963999999999987999999748806


No 233
>PRK06114 short chain dehydrogenase; Provisional
Probab=95.85  E-value=0.11  Score=30.82  Aligned_cols=77  Identities=21%  Similarity=0.255  Sum_probs=49.5

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH-----HHHHHHHCCCEEECC----CC------------
Q ss_conf             813218987999836-85489999999985986999818964-----788999789899645----31------------
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC-----AVKQAKDMGIEVIDF----RE------------   59 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~-----~~~~l~~~g~~~~~~----~~------------   59 (468)
                      +|-+|+||.+.|-|- ++-|.++|+.|.+.|++|...|.+..     ..+.++..|.+....    .+            
T Consensus        10 ~lf~L~gKvalVTGa~~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvt~~~~v~~~v~~~~   89 (262)
T PRK06114         10 KLFDLDGQVAFVTGAGSGIGQRIAIGLAQAGADVALFDLRTDDGLAETAEHIEAAGRRAIQIAADVTSKSDLAAAVARTE   89 (262)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             12498999899968478999999999998799899995897469999999999659958999816899999999999999


Q ss_pred             CCCCCCCEEEECCCCCCCC
Q ss_conf             5722588899888868567
Q gi|254781099|r   60 IPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        60 ~~~~~~d~vv~Spgi~~~~   78 (468)
                      ..+...|.+|-..|+....
T Consensus        90 ~~~G~iDiLVNnAGi~~~~  108 (262)
T PRK06114         90 AELGALTLAVNAAGIANAN  108 (262)
T ss_pred             HHCCCCCEEEECCCCCCCC
T ss_conf             9819998999899899998


No 234
>PRK07045 putative monooxygenase; Reviewed
Probab=95.83  E-value=0.016  Score=36.45  Aligned_cols=34  Identities=21%  Similarity=0.262  Sum_probs=30.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9879998368548999999998598699981896
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .-.|.|+|.|.+|+++|..|.++|++|+++++.+
T Consensus         5 ~~dVlIvGaG~aGl~lA~~L~r~G~~v~v~E~~~   38 (388)
T PRK07045          5 PVDVLINGSGIAGVALAHLLGARGHSVTVVERAA   38 (388)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9858999928899999999986799899990899


No 235
>PRK07774 short chain dehydrogenase; Provisional
Probab=95.83  E-value=0.035  Score=34.19  Aligned_cols=52  Identities=27%  Similarity=0.250  Sum_probs=39.9

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             13218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |-+|+||.++|-|- ++-|.++|+.|.++|++|..+|.++...    ++++..|.+.
T Consensus         1 m~~L~gK~alVTGgs~GiG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~   57 (250)
T PRK07774          1 MFDFDDKVAIVTGAAGGIGQAYAEALAREGASVVVADINAEGAERVAKQIVADGGTA   57 (250)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             907799889997976889999999999869999999798899999999998559849


No 236
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase. Members of this protein family are 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase, an enzyme in the anaerobic metabolism of aromatic enzymes by way of benzoyl-CoA, as seen in Thauera aromatica, Geobacter metallireducens, and Azoarcus sp. The experimentally characterized form from T. aromatica uses only NAD+, not NADP+. Note that Rhodopseudomonas palustris uses a different pathway to perform a similar degradation of benzoyl-CoA to 3-hydroxpimelyl-CoA.
Probab=95.82  E-value=0.041  Score=33.67  Aligned_cols=14  Identities=7%  Similarity=0.095  Sum_probs=8.9

Q ss_pred             HHHHHHHCCCCCCC
Q ss_conf             21110000112210
Q gi|254781099|r  196 RHHTLENYVNIKKK  209 (468)
Q Consensus       196 ~~~s~e~y~~aK~~  209 (468)
                      ..|.|.+|.....+
T Consensus       112 ~~Ggfaey~~vp~~  125 (349)
T TIGR03201       112 MQGGFASHIVVPAK  125 (349)
T ss_pred             CCCCCCCEEEEEHH
T ss_conf             88886135987504


No 237
>PRK09117 consensus
Probab=95.78  E-value=0.029  Score=34.72  Aligned_cols=36  Identities=28%  Similarity=0.381  Sum_probs=32.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.++|..+...|++|..+|.++..+
T Consensus         3 ~~VaViGaG~mG~~iA~~~a~~G~~V~l~D~~~~~l   38 (282)
T PRK09117          3 QTVGIIGAGTMGNGIAQACAVAGLDVVMVDISDAAV   38 (282)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             779998977999999999996799689998988999


No 238
>PRK07831 short chain dehydrogenase; Provisional
Probab=95.78  E-value=0.081  Score=31.65  Aligned_cols=39  Identities=18%  Similarity=0.199  Sum_probs=31.6

Q ss_pred             HCCCEEEEECCCH--HHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             1898799983685--48999999998598699981896478
Q gi|254781099|r    6 FRNHSIAVFGLGR--SGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         6 ~~~k~v~i~G~G~--sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+||+++|-|-++  -|.++|+.|.+.|++|..+|.+....
T Consensus        14 L~gKvalVTGgsg~GIG~a~a~~la~~Ga~V~i~d~~~~~~   54 (261)
T PRK07831         14 LAGKVVVVTAAAGTGIGSATARRALEEGADVVISDIHERRL   54 (261)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             69984999499964789999999998799899980877778


No 239
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit; InterPro: IPR012744    This entry describes NirB, the large subunit of nitrite reductase [NAD(P)H] (the assimilatory nitrite reductase), which associates with NirD, the small subunit (IPR012748 from INTERPRO). In a few bacteria such as Klebsiella pneumoniae and in fungi, the two regions are fused.; GO: 0008942 nitrite reductase [NAD(P)H] activity, 0050660 FAD binding, 0050661 NADP binding, 0042128 nitrate assimilation.
Probab=95.78  E-value=0.051  Score=33.04  Aligned_cols=78  Identities=27%  Similarity=0.320  Sum_probs=59.3

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEECCCHH-------------HHHHHHCCCEEEC--CC------------------
Q ss_conf             99836854899999999859869998189647-------------8899978989964--53------------------
Q gi|254781099|r   12 AVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-------------VKQAKDMGIEVID--FR------------------   58 (468)
Q Consensus        12 ~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~-------------~~~l~~~g~~~~~--~~------------------   58 (468)
                      +|+|-|.=|+=+|..|++.|.+|++..-.|-.             ...++..|+.+.-  ..                  
T Consensus       151 aViGGGLLGLEAA~aL~~LG~~v~Vi~~~p~LM~~QLD~~aG~lL~~~le~~G~~~l~Gt~k~t~eiv~~~d~~~~~~~r  230 (813)
T TIGR02374       151 AVIGGGLLGLEAARALKNLGMDVSVIELAPFLMAKQLDQTAGRLLQRELEKKGLTVLLGTEKDTVEIVGEDDVEKVERLR  230 (813)
T ss_pred             EEECCCHHHHHHHHHHHHCCCEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCEEEEEECCCHHHHCEEE
T ss_conf             58867415889999998779706446764898999999999999999998579579861761105764156401231224


Q ss_pred             --CCCCCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCEEE
Q ss_conf             --15722588899888868567557888999997698099
Q gi|254781099|r   59 --EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEII   96 (468)
Q Consensus        59 --~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~   96 (468)
                        +-..-++|+||.|-||.|.       .+-|.+.|++|=
T Consensus       231 f~DG~~l~aDlvv~A~GirP~-------~~LA~~aGl~v~  263 (813)
T TIGR02374       231 FKDGSSLEADLVVFAAGIRPR-------DELAAEAGLKVN  263 (813)
T ss_pred             CCCCCEEEECEEEEECCCCCC-------HHHHHHCCCCCC
T ss_conf             238978870379995156663-------689986597354


No 240
>pfam05368 NmrA NmrA-like family. NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA. NmrA is part of a system controlling nitrogen metabolite repression in fungi. This family only contains a few sequences as iteration results in significant matches to other Rossmann fold families.
Probab=95.77  E-value=0.098  Score=31.10  Aligned_cols=61  Identities=26%  Similarity=0.275  Sum_probs=43.1

Q ss_pred             EEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH--HHHHHHHCCCEEECC--CCCC-----CCCCCEEEEC
Q ss_conf             999836-85489999999985986999818964--788999789899645--3157-----2258889988
Q gi|254781099|r   11 IAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC--AVKQAKDMGIEVIDF--REIP-----WSIISFLVLS   71 (468)
Q Consensus        11 v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~--~~~~l~~~g~~~~~~--~~~~-----~~~~d~vv~S   71 (468)
                      |+|.|. |.-|.++++.|.++|++|.+..+++.  ..+.+...|+++...  .+..     .+++|.|+..
T Consensus         1 IlV~GatG~iG~~vv~~L~~~g~~Vr~l~R~~~~~~~~~l~~~gve~v~gD~~d~~sl~~al~gvd~v~~~   71 (232)
T pfam05368         1 ILVFGATGYQGGSVVRASLKAGHPVRALVRDPKSELAKSLKAAGVELVEGDLDDHESLVEALKGVDVVFSV   71 (232)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHCCCEEEEECCCCHHHHHHHHCCCCEEEEE
T ss_conf             09989682899999999985899389997187366566664179889990688878999996799889991


No 241
>PRK07856 short chain dehydrogenase; Provisional
Probab=95.77  E-value=0.016  Score=36.53  Aligned_cols=41  Identities=17%  Similarity=0.227  Sum_probs=33.7

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             9813218987999836-85489999999985986999818964
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |.| +|+||.++|-|- ++-|.++|+.|.++|++|..++++..
T Consensus         2 M~~-~l~~K~alITGgs~GIG~aia~~la~~Ga~V~i~~r~~~   43 (254)
T PRK07856          2 INL-DLTGRVVLVTGGTRGVGAGISEAFLAAGATVVVCGRRAP   43 (254)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             742-359998999476768999999999987999999979855


No 242
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism]
Probab=95.77  E-value=0.17  Score=29.42  Aligned_cols=15  Identities=20%  Similarity=0.193  Sum_probs=5.6

Q ss_pred             CCCCCCCCCCCCCCE
Q ss_conf             443221101688837
Q gi|254781099|r  149 GLPILNLEYFSPNRF  163 (468)
Q Consensus       149 G~p~~~~~~~~~~~~  163 (468)
                      |.|++.+....++.+
T Consensus       169 GkPla~lL~~~naTV  183 (283)
T COG0190         169 GKPLALLLLNANATV  183 (283)
T ss_pred             CHHHHHHHHHCCCEE
T ss_conf             679999998679989


No 243
>PRK13403 ketol-acid reductoisomerase; Provisional
Probab=95.76  E-value=0.032  Score=34.49  Aligned_cols=67  Identities=27%  Similarity=0.378  Sum_probs=53.5

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             13218987999836854899999999859869998189647889997898996453157225888998
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      ++-+++|+|+|+|.|--|.+=|.=|++.|.+|.+-=+.-.+.+..+..|.++.+..+.- ...|+|.+
T Consensus        11 l~~lk~k~iaVIGYGsQG~AhAlNLrDSG~~V~vglr~g~s~~~A~~~Gf~v~~~~eA~-~~aDvi~~   77 (335)
T PRK13403         11 VELLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAV-RTAQVVQM   77 (335)
T ss_pred             HHHHCCCEEEEEEECCHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHCCCEECCHHHHH-HHCCEEEE
T ss_conf             58887997999756707689885647639977999799856999998799316799999-85797875


No 244
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=95.75  E-value=0.028  Score=34.79  Aligned_cols=39  Identities=26%  Similarity=0.443  Sum_probs=34.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             898799983685489999999985986999818964788
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      +=|+|+|+|.|.-|.++|..+...|++|..+|.++..+.
T Consensus         4 ~Ik~VaViGAG~MG~gIA~~~a~~G~~V~l~D~~~~~l~   42 (310)
T PRK06130          4 PIQNLAIIGAGAMGSGIAALFASKGLDVVLIDPMPGALE   42 (310)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHH
T ss_conf             988898978779999999999858998899979999999


No 245
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.75  E-value=0.037  Score=34.02  Aligned_cols=50  Identities=20%  Similarity=0.220  Sum_probs=38.5

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             218987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      +++||.++|-|. ++-|+++|+.|.++|++|..+|.++..+    .+++..|.+.
T Consensus         2 ~L~gK~~lITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~~l~~~g~~~   56 (253)
T PRK08217          2 DLKDKVIVITGGAQGLGRAMAEYLAQKGAKLALIDLNQEKLEEAVAQCAALGGEA   56 (253)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             7899889994887789999999999879989999799999999999999659948


No 246
>PTZ00082 L-lactate dehydrogenase; Provisional
Probab=95.73  E-value=0.033  Score=34.31  Aligned_cols=72  Identities=17%  Similarity=0.187  Sum_probs=46.8

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHH----HHHHHC------CCEEE-CCCCCCCCCCCEEEECCC
Q ss_conf             189879998368548999999998598-699981896478----899978------98996-453157225888998888
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAV----KQAKDM------GIEVI-DFREIPWSIISFLVLSPG   73 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~----~~l~~~------g~~~~-~~~~~~~~~~d~vv~Spg   73 (468)
                      .+++||.|+|.|.-|-++|..|...+. ++..+|.++...    ..+...      ...+. ........+.|.||++-|
T Consensus         5 ~~~~KV~IIGaG~VG~~~A~~l~~~~l~eivLiDi~~~~a~g~a~Dl~h~~~~~~~~~~v~~~~dy~~~~~aDiVVitAG   84 (322)
T PTZ00082          5 IPRKKISLIGSGNIGGVMAYLIQLKNLADVVLFDIVPNIPAGKALDIMHANVMAGSNCKVIGTNSYDDIAGSDVVIVTAG   84 (322)
T ss_pred             CCCCCEEEECCCHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEECCCHHHHCCCCEEEECCC
T ss_conf             17982999896989999999996389977999978898008899987663644688857983799999779999998988


Q ss_pred             CCCC
Q ss_conf             6856
Q gi|254781099|r   74 IALT   77 (468)
Q Consensus        74 i~~~   77 (468)
                      +|..
T Consensus        85 ~~~k   88 (322)
T PTZ00082         85 LAKA   88 (322)
T ss_pred             CCCC
T ss_conf             8778


No 247
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=95.72  E-value=0.093  Score=31.23  Aligned_cols=86  Identities=13%  Similarity=0.195  Sum_probs=54.0

Q ss_pred             EEEEECCCHHHHHHHHHHHH--CCCEEE-EEECCCHHHHHHH-HCCCEEECC-CCC-CCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             79998368548999999998--598699-9818964788999-789899645-315-72258889988886856755788
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKD--SGVHVI-AWDDHPCAVKQAK-DMGIEVIDF-REI-PWSIISFLVLSPGIALTGENAHW   83 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~--~G~~V~-~~D~~~~~~~~l~-~~g~~~~~~-~~~-~~~~~d~vv~Spgi~~~~~~~~~   83 (468)
                      ||+|+|.|.-|..-++.+..  .+.++. .+|.++...+.+. ..++..+.. .+. ....+|.|+++.  |+  ..-..
T Consensus         2 ki~iiG~G~~g~~~~~~~~~~~~~~~i~ai~d~~~~~~~~~~~~~~~~~~~~~~~~l~~~~iD~v~I~t--p~--~~H~~   77 (120)
T pfam01408         2 RVGIVGAGKIGRRHLRALNESQDGAELVGVLDPDPARAEAVAESFGVPAYSDLEELLADPDVDAVSVAT--PP--GLHFE   77 (120)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCEECCHHHHHHCCCCCEEEECC--CH--HHHHH
T ss_conf             899990779999999999855999789999829999999999983996788699997377889899908--74--61899


Q ss_pred             HHHHHHHCCCEEEEEH
Q ss_conf             8999997698099830
Q gi|254781099|r   84 CVKLANQFNVEIIGDI   99 (468)
Q Consensus        84 ~~~~a~~~gi~v~s~~   99 (468)
                      ...++.+.|++|+-|-
T Consensus        78 ~~~~~l~~g~~v~~EK   93 (120)
T pfam01408        78 LALAALEAGKHVLVEK   93 (120)
T ss_pred             HHHHHHHHCCEEEEEC
T ss_conf             9999998199899968


No 248
>PRK07063 short chain dehydrogenase; Provisional
Probab=95.71  E-value=0.041  Score=33.68  Aligned_cols=43  Identities=19%  Similarity=0.156  Sum_probs=36.2

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             13218987999836-85489999999985986999818964788
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      |..|+||.++|-|- ++-|+++|+.|.+.|++|..+|.+.....
T Consensus         2 m~rL~gKvalVTGa~~GIG~aiA~~~a~~Ga~V~i~~~~~~~~~   45 (259)
T PRK07063          2 MNRLAGKVALVTGAAQGIGAAIARAFVREGAAVALADLDAALAE   45 (259)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             75359988999587878999999999987998999979878999


No 249
>PRK06101 short chain dehydrogenase; Provisional
Probab=95.71  E-value=0.057  Score=32.71  Aligned_cols=44  Identities=20%  Similarity=0.253  Sum_probs=36.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCC
Q ss_conf             87999836-854899999999859869998189647889997898
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGI   52 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~   52 (468)
                      |+|+|-|. ++-|.++|+.|.++|++|..+|+++..++++...+-
T Consensus         2 ktvlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~~~   46 (241)
T PRK06101          2 TSVLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQSS   46 (241)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC
T ss_conf             989992240499999999999879989999899999999997328


No 250
>PRK07035 short chain dehydrogenase; Provisional
Probab=95.70  E-value=0.043  Score=33.57  Aligned_cols=44  Identities=23%  Similarity=0.197  Sum_probs=36.7

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             813218987999836-85489999999985986999818964788
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      +|-+|+||.+.|-|. ++-|+++|+.|.+.|++|...|.+...++
T Consensus         2 ~~~~L~gKvalITGas~GIG~aia~~la~~Ga~V~i~~r~~~~l~   46 (252)
T PRK07035          2 NLFDLTGKIALVTGASRGIGEAIAKLLAQQGAHVIVSSRKLDGCQ   46 (252)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             864678998999588749999999999987998999979889999


No 251
>pfam00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain. L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate. The enzyme participates in the citric acid cycle. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. N-terminus (this family) is a Rossmann NAD-binding fold. C-terminus is an unusual alpha+beta fold.
Probab=95.70  E-value=0.059  Score=32.61  Aligned_cols=71  Identities=20%  Similarity=0.107  Sum_probs=46.1

Q ss_pred             EEEEECCC-HHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHHCC------CEEECCCCCCCCCCCEEEECCCCCC
Q ss_conf             79998368-548999999998598--699981896478----8999789------8996453157225888998888685
Q gi|254781099|r   10 SIAVFGLG-RSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKDMG------IEVIDFREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus        10 ~v~i~G~G-~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~~g------~~~~~~~~~~~~~~d~vv~Spgi~~   76 (468)
                      ||.|+|.| .-|.++|-.|..+|.  ++..+|.++...    ..+....      ............+.|+||++-|.|.
T Consensus         2 KV~IIGagg~VG~~~A~~l~~~~l~~elvL~D~~~~~a~g~alDl~~~~~~~~~~~~~~~~~~~~~~daDiVVitaG~~~   81 (142)
T pfam00056         2 KVAVVGAGGGVGSSLAFALALQGLADELVLVDINKDKAEGVAMDLSHGSTFLSVPGIVGGDDYEALKDADVVVITAGVPR   81 (142)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCHHHHHHHHCCCCCCCCCEEECCCCHHHHCCCCEEEEECCCCC
T ss_conf             89998987789999999997479663478850577641179999861443478876974883888378999998157778


Q ss_pred             CCCC
Q ss_conf             6755
Q gi|254781099|r   77 TGEN   80 (468)
Q Consensus        77 ~~~~   80 (468)
                      ...+
T Consensus        82 k~g~   85 (142)
T pfam00056        82 KPGM   85 (142)
T ss_pred             CCCC
T ss_conf             9998


No 252
>PRK00711 D-amino acid dehydrogenase small subunit; Validated
Probab=95.68  E-value=0.02  Score=35.89  Aligned_cols=32  Identities=31%  Similarity=0.526  Sum_probs=29.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ||.|+|.|..|.|.|..|.++|++|++.|+++
T Consensus         2 ~VvIIGaGi~G~stA~~La~~G~~V~vler~~   33 (416)
T PRK00711          2 RVVVLGSGVVGVTSAWYLARAGHEVTVIDRQP   33 (416)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             79999944999999999996899689996999


No 253
>PRK07067 sorbitol dehydrogenase; Provisional
Probab=95.68  E-value=0.15  Score=29.88  Aligned_cols=46  Identities=20%  Similarity=0.252  Sum_probs=35.4

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH-HHCC
Q ss_conf             18987999836-8548999999998598699981896478899-9789
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA-KDMG   51 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l-~~~g   51 (468)
                      |+||.++|-|- ++-|+++|+.|.+.|++|..+|.++...... +.+|
T Consensus         3 L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~g   50 (256)
T PRK07067          3 LQGKVALLTGAASGIGEAVAQRYLREGARVVLADIKPARAALAALEIG   50 (256)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC
T ss_conf             899889993767789999999999879999999798899999999819


No 254
>PRK05479 ketol-acid reductoisomerase; Provisional
Probab=95.68  E-value=0.04  Score=33.76  Aligned_cols=68  Identities=28%  Similarity=0.427  Sum_probs=54.3

Q ss_pred             CCHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             813218987999836854899999999859869998189-647889997898996453157225888998
Q gi|254781099|r    2 KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      .++-+++|+|+|+|.|--|.+=|.=|++.|.+|.+--+. ..+.+..++.|.++.+..+.- ...|+|.+
T Consensus        11 dl~~lk~k~iaViGYGsQG~AhAlNLrDSG~~V~vglr~gs~S~~kA~~dGf~v~~~~eA~-~~aDii~~   79 (336)
T PRK05479         11 DLSLIKGKKVAIIGYGSQGHAHALNLRDSGVDVVVGLREGSKSWKKAEADGFEVLTVAEAA-KWADVIMI   79 (336)
T ss_pred             CHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHCCCEECCHHHHH-HHCCEEEE
T ss_conf             9478779979997527076898855374499779997999803999998799436799999-74686654


No 255
>PRK12747 short chain dehydrogenase; Provisional
Probab=95.68  E-value=0.13  Score=30.21  Aligned_cols=49  Identities=18%  Similarity=0.152  Sum_probs=34.4

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEE-CCCHH----HHHHHHCCCEE
Q ss_conf             18987999836-8548999999998598699981-89647----88999789899
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWD-DHPCA----VKQAKDMGIEV   54 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D-~~~~~----~~~l~~~g~~~   54 (468)
                      |+||.++|-|- ++-|.++|+.|.+.|++|...+ .+...    ...++..+...
T Consensus         2 L~gKvalITGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~   56 (252)
T PRK12747          2 LKGKVALVTGASRGIGRAIAKRLANDGALVAIHYGNRKEEAEETVYEIQSNGGSA   56 (252)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCE
T ss_conf             8959999948477899999999998799999965998789999999999649957


No 256
>COG3349 Uncharacterized conserved protein [Function unknown]
Probab=95.68  E-value=0.019  Score=36.00  Aligned_cols=33  Identities=33%  Similarity=0.556  Sum_probs=30.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      +||.|.|.|+.|+++|..|.++|++|+.+..++
T Consensus         1 ~rVai~GaG~AgL~~a~~La~~g~~vt~~ea~~   33 (485)
T COG3349           1 MRVAIAGAGLAGLAAAYELADAGYDVTLYEARD   33 (485)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             928997462788899999986898539984267


No 257
>PRK05693 short chain dehydrogenase; Provisional
Probab=95.65  E-value=0.093  Score=31.25  Aligned_cols=46  Identities=22%  Similarity=0.206  Sum_probs=37.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEE
Q ss_conf             87999836-85489999999985986999818964788999789899
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEV   54 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~   54 (468)
                      |.|+|-|. .+-|+++|+.|.++|++|.+++++...++++...++..
T Consensus         2 KvvlITGassGIG~alA~~la~~G~~V~~~~R~~~~l~~l~~~~~~~   48 (274)
T PRK05693          2 PVVLITGCSSGIGRALADAFKAAGYEVWATARKAEDVEALAAAGFTA   48 (274)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCE
T ss_conf             98999488858999999999987999999979999999998489918


No 258
>PRK09242 tropinone reductase; Provisional
Probab=95.64  E-value=0.047  Score=33.27  Aligned_cols=46  Identities=22%  Similarity=0.233  Sum_probs=35.8

Q ss_pred             CCCH--HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             9813--218987999836-854899999999859869998189647889
Q gi|254781099|r    1 MKLS--SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         1 m~~~--~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |.++  +|+||+++|-|- ++-|.++|+.|.+.|++|..+|.+...+++
T Consensus         1 m~~~~f~L~gK~alITGgs~GIG~a~a~~la~~Ga~V~~~~r~~~~~~~   49 (258)
T PRK09242          1 MTQHRWRLDGQTALITGASKGIGLAIARELLGLGADVLIVARDADALAQ   49 (258)
T ss_pred             CCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             9857763799999994848689999999999879989999698899999


No 259
>PRK07832 short chain dehydrogenase; Provisional
Probab=95.63  E-value=0.093  Score=31.25  Aligned_cols=45  Identities=20%  Similarity=0.228  Sum_probs=34.3

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCE
Q ss_conf             87999836-85489999999985986999818964788----99978989
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIE   53 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~   53 (468)
                      |++.|-|. ++-|.++|+.|.++|++|..+|.+...++    ++...+..
T Consensus         1 K~alITGassGIG~a~A~~la~~Ga~v~l~~r~~~~l~~~~~~l~~~g~~   50 (272)
T PRK07832          1 KRCFVTGAASGIGRATALRLAAQGAELFLTDRDADGLAQTVADARALGGT   50 (272)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC
T ss_conf             97999472019999999999988998999989889999999999845897


No 260
>PRK06522 2-dehydropantoate 2-reductase; Reviewed
Probab=95.63  E-value=0.074  Score=31.94  Aligned_cols=47  Identities=19%  Similarity=0.313  Sum_probs=40.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC
Q ss_conf             79998368548999999998598699981896478899978989964
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID   56 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~   56 (468)
                      ||+|+|.|--|.-.|-.|.+.|++|+.+++.+.....+...|+.+..
T Consensus         2 kI~IiGaGaiG~~~a~~L~~ag~~V~li~r~~~~~~~i~~~Gl~i~~   48 (307)
T PRK06522          2 KIAILGAGAIGGLFGARLAQAGHDVTLVARGATLAEALNENGLRLLE   48 (307)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCEEEEC
T ss_conf             89999914999999999984899889997888899999968939952


No 261
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.62  E-value=0.045  Score=33.44  Aligned_cols=44  Identities=18%  Similarity=0.199  Sum_probs=35.9

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             218987999836-85489999999985986999818964788999
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      +|+||.++|-|- ++-|+++|+.|.++|++|...|.+...++++.
T Consensus         3 ~l~gK~alITGgs~GIG~aia~~la~~G~~V~i~~r~~~~~~~~~   47 (250)
T PRK07231          3 RLEGKVAIVTGAGSGFGEGIARRFAAEGARVVVTDRNQEAAERVA   47 (250)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             769988999388868999999999987999999979889999999


No 262
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. Members of this protein family are the enzyme 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase. The enzymatic properties were confirmed experimentally in Rhodopseudomonas palustris; the enzyme is homotetrameric, and not sensitive to oxygen. This enzyme is part of proposed pathway for degradation of benzoyl-CoA to 3-hydroxypimeloyl-CoA that differs from the analogous in Thauera aromatica. It also may occur in degradation of the non-aromatic compound cyclohexane-1-carboxylate.
Probab=95.60  E-value=0.11  Score=30.83  Aligned_cols=49  Identities=18%  Similarity=0.264  Sum_probs=37.4

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEE
Q ss_conf             18987999836-8548999999998598699981896478----8999789899
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV   54 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~   54 (468)
                      |+||.++|-|- ++-|.++|+.|.+.|++|..+|.+....    .+++..|...
T Consensus         1 L~gKvalITG~s~GIG~aia~~la~~Ga~V~i~~r~~~~~~~~~~~l~~~g~~~   54 (250)
T TIGR03206         1 LKDKTAIVTGGGGGIGGATCRRFAEEGAKVAVFDLNREAAEKVAADIRAKGGNA   54 (250)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             951999996857689999999999879999999798899999999999539928


No 263
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism]
Probab=95.58  E-value=0.028  Score=34.87  Aligned_cols=46  Identities=35%  Similarity=0.512  Sum_probs=41.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEE
Q ss_conf             7999836854899999999859869998189647889997898996
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVI   55 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~   55 (468)
                      +++.+|+|+-|..+++-|.+.|++|++||.++.+++.+...|+.-.
T Consensus         2 ~iGmiGLGrMG~n~v~rl~~~ghdvV~yD~n~~av~~~~~~ga~~a   47 (300)
T COG1023           2 QIGMIGLGRMGANLVRRLLDGGHDVVGYDVNQTAVEELKDEGATGA   47 (300)
T ss_pred             CCEEECCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCC
T ss_conf             0115400052699999998389728997388899999986577543


No 264
>PRK07109 short chain dehydrogenase; Provisional
Probab=95.57  E-value=0.052  Score=32.98  Aligned_cols=54  Identities=17%  Similarity=0.231  Sum_probs=43.5

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH----HHHCCCEE
Q ss_conf             9813218987999836-854899999999859869998189647889----99789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ----AKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~----l~~~g~~~   54 (468)
                      |.|..+++|.|.|-|. ++-|+++|+.|.++|++|...+.++..++.    ++..|.+.
T Consensus         1 ~~~k~l~~KvVvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~   59 (338)
T PRK07109          1 CMLKPLGRQVVVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEA   59 (338)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEE
T ss_conf             99960698989994843499999999999879989999899999999999999639818


No 265
>pfam01494 FAD_binding_3 FAD binding domain. This domain is involved in FAD binding in a number of enzymes.
Probab=95.56  E-value=0.021  Score=35.77  Aligned_cols=33  Identities=30%  Similarity=0.488  Sum_probs=29.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             799983685489999999985986999818964
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      -|.|+|.|.+|+++|.+|.++|++|.++|+.+.
T Consensus         3 DV~IvGaG~aGl~lA~~L~~~Gi~v~V~Er~~~   35 (349)
T pfam01494         3 DVLIVGGGPAGLMLALLLARAGVRVVLVERHAT   35 (349)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             789999288999999999877998999928999


No 266
>PRK07478 short chain dehydrogenase; Provisional
Probab=95.51  E-value=0.052  Score=32.96  Aligned_cols=52  Identities=15%  Similarity=0.203  Sum_probs=39.7

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCEE
Q ss_conf             13218987999836-85489999999985986999818964788----999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~~   54 (468)
                      |..|+||.++|-|- ++-|+++|+.|.+.|++|...|.++..++    +++..|.+.
T Consensus         1 Mm~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~l~~~~~ei~~~g~~~   57 (254)
T PRK07478          1 MMLLNGKVAIITGASSGIGRAAAKLFAREGAKVVVGARRQAELDQLVAEIRAEGGEA   57 (254)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             988899879995887689999999999879999999798899999999999649908


No 267
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated
Probab=95.51  E-value=0.045  Score=33.44  Aligned_cols=36  Identities=28%  Similarity=0.421  Sum_probs=32.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             879998368548999999998598699981896478
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |+|+|+|.|.-|.++|..+...|+.|..+|.++..+
T Consensus         4 ~~VaViGaGtMG~gIA~~~a~aG~~V~l~D~~~~~l   39 (503)
T PRK08268          4 ATVAVIGAGAMGAGIAQVAAQAGHTVLLYDARAGAA   39 (503)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             789997968899999999993899089997998999


No 268
>PRK07806 short chain dehydrogenase; Provisional
Probab=95.50  E-value=0.084  Score=31.56  Aligned_cols=53  Identities=21%  Similarity=0.218  Sum_probs=40.6

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH-----HHHHHHCCCEEE
Q ss_conf             13218987999836-854899999999859869998189647-----889997898996
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA-----VKQAKDMGIEVI   55 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~-----~~~l~~~g~~~~   55 (468)
                      |.+|+||.++|-|- .+-|.++|+.|.+.|++|...+.+...     .++++..|.+..
T Consensus         1 M~~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~~~~a~~~~~~i~~~g~~a~   59 (248)
T PRK07806          1 MDDLPGKIALVTGSSRGIGAEVAKYLAGAGAHVVVNYRNKAARAEKVVAEIRAAGGRAS   59 (248)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEE
T ss_conf             98989988999378859999999999987998999838956899999999996198399


No 269
>TIGR03219 salicylate_mono salicylate 1-monooxygenase. Members of this protein family are salicylate 1-monooxygenase, also called salicylate hydroxylase. This enzyme converts salicylate to catechol, which is a common intermediate in the degradation of a number of aromatic compounds (phenol, toluene, benzoate, etc.). The gene for this protein may occur in catechol degradation genes, such as those of the meta-cleavage pathway.
Probab=95.49  E-value=0.024  Score=35.30  Aligned_cols=32  Identities=25%  Similarity=0.457  Sum_probs=28.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEEECCC
Q ss_conf             7999836854899999999859-8699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSG-VHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G-~~V~~~D~~~   41 (468)
                      ||+|+|.|.+|+++|..|.++| ++|+++++.+
T Consensus         2 kV~IVGaGiaGL~lA~~L~r~g~i~V~V~Er~~   34 (414)
T TIGR03219         2 RVAIIGGGIAGVALALNLCKHSHLNVQLFEAAP   34 (414)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             899999448999999999853999889994289


No 270
>PRK07776 consensus
Probab=95.49  E-value=0.059  Score=32.63  Aligned_cols=48  Identities=23%  Similarity=0.252  Sum_probs=38.0

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889997
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |+ -+|+||.++|-|- ++-|.++|+.|.+.|++|..+|.++..++....
T Consensus         2 m~-~~L~gKv~lITG~~~GIG~aiA~~la~~Ga~V~i~~~~~~~l~~~~~   50 (252)
T PRK07776          2 TS-LDLTGRTAIVTGASRGIGLAIAQALAAAGANVVITARKQEALDEAAA   50 (252)
T ss_pred             CC-CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             98-89999989994778799999999999879989999798899999999


No 271
>PRK06720 hypothetical protein; Provisional
Probab=95.48  E-value=0.058  Score=32.67  Aligned_cols=75  Identities=24%  Similarity=0.261  Sum_probs=50.7

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH----HHHHHHCCCEEECCC----C------------
Q ss_conf             9813218987999836-854899999999859869998189647----889997898996453----1------------
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVIDFR----E------------   59 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~----~~~l~~~g~~~~~~~----~------------   59 (468)
                      |+| +|+||.+.|-|. ++-|+++|+.|.+.|++|..+|.+...    .+++...|.+.....    +            
T Consensus        10 M~~-~L~gKvalITGa~~GIG~a~A~~la~~Ga~Vvi~d~~~~~~~~~~~~i~~~g~~a~~~~~Dvs~~~~v~~~i~~~~   88 (169)
T PRK06720         10 MKM-KLAGKVAIVTGGGIGIGRNTALLLAKQGAKVIVTDIDQESGQATVEEITNLGGEALFVSYDMEKQGDWQRVISITL   88 (169)
T ss_pred             CCC-CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHH
T ss_conf             868-6299999998975489999999999869989995276365999999999749953789758899999999999999


Q ss_pred             CCCCCCCEEEECCCCCC
Q ss_conf             57225888998888685
Q gi|254781099|r   60 IPWSIISFLVLSPGIAL   76 (468)
Q Consensus        60 ~~~~~~d~vv~Spgi~~   76 (468)
                      ..+...|.+|-..||..
T Consensus        89 ~~~g~iDiLvNNAGI~~  105 (169)
T PRK06720         89 NAFSRIDMLFQNAGLYK  105 (169)
T ss_pred             HHCCCCCEEEECCCCCC
T ss_conf             97598998998942178


No 272
>PRK08278 short chain dehydrogenase; Provisional
Probab=95.48  E-value=0.043  Score=33.55  Aligned_cols=40  Identities=15%  Similarity=0.232  Sum_probs=33.8

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             13218987999836-85489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |.+|+||.++|-|. ++-|+++|+.|.+.|++|..++++..
T Consensus         1 Mm~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~   41 (273)
T PRK08278          1 MMSLSGKTLFITGASRGIGLAIALRAARDGANIVIAAKTAE   41 (273)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             98989998999487659999999999987998999967722


No 273
>PTZ00075 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=95.47  E-value=0.042  Score=33.61  Aligned_cols=52  Identities=15%  Similarity=0.080  Sum_probs=31.1

Q ss_pred             HHCCCEEEEECCCHHHH-H-HHHHHHHCCCEEEEEECCCHHH-----HHHH-HCCCEEECC
Q ss_conf             21898799983685489-9-9999998598699981896478-----8999-789899645
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGL-S-AACALKDSGVHVIAWDDHPCAV-----KQAK-DMGIEVIDF   57 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~-s-~A~~l~~~G~~V~~~D~~~~~~-----~~l~-~~g~~~~~~   57 (468)
                      -|+|.+|... +=++-. + +++.|...|++|..+-.+|.+.     ..+. ..|+.++..
T Consensus        42 PlkG~rI~~~-LHlt~kTAvL~~tL~~~GA~V~~~~~Np~STQDdvaAAL~~~~gi~VfA~  101 (476)
T PTZ00075         42 PLKGAKIAGC-LHMTVETAVLIETLVALGAEVRWCSCNIFSTQDNAAAAIAKKGGVTVFAW  101 (476)
T ss_pred             CCCCCEEEEE-EECHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEE
T ss_conf             9899989999-82289999999999985986999647975436699999886079269995


No 274
>pfam07991 IlvN Acetohydroxy acid isomeroreductase, catalytic domain. Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates. This reaction is the second in the synthetic pathway of the essential branched side chain amino acids valine and isoleucine.
Probab=95.45  E-value=0.046  Score=33.39  Aligned_cols=64  Identities=31%  Similarity=0.411  Sum_probs=51.9

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             18987999836854899999999859869998189-647889997898996453157225888998
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      +++|+|+|+|.|--|.+=|.=|++.|.+|.+--+. ..+.++.++.|.++.+..+.- ...|+|.+
T Consensus         2 lk~k~iaViGYGsQG~AhAlNLrDSG~~V~vglr~~s~S~~kA~~dGf~v~~~~eA~-~~aDiim~   66 (165)
T pfam07991         2 LKGKKIAVIGYGSQGHAHALNLRDSGVNVIVGLRPGSKSWEKAKKDGFEVYTVAEAV-KKADVVMI   66 (165)
T ss_pred             CCCCEEEEEEECCHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHCCCCCCCHHHHH-HHCCEEEE
T ss_conf             679989999346164888723053499789997899867999997897004899998-65789998


No 275
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional
Probab=95.45  E-value=0.04  Score=33.77  Aligned_cols=54  Identities=20%  Similarity=0.165  Sum_probs=35.7

Q ss_pred             HHCCCEEEEECCCHHHH--HHHHHHHHCCCEEEEEECCCHH-----HHHHHHCCCEEECCCC
Q ss_conf             21898799983685489--9999999859869998189647-----8899978989964531
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGL--SAACALKDSGVHVIAWDDHPCA-----VKQAKDMGIEVIDFRE   59 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~--s~A~~l~~~G~~V~~~D~~~~~-----~~~l~~~g~~~~~~~~   59 (468)
                      .|+|.+|+.. +=++-.  -+++.|...|++|..+-.+|.+     ...|...|+.++..+.
T Consensus        42 Pl~G~rI~~c-lHle~kTA~L~~tL~~~GAeV~~~~~NplSTQDdvaAaL~~~Gi~VfA~~g  102 (427)
T PRK05476         42 PLKGARIAGC-LHMTIQTAVLIETLKALGAEVRWASCNPFSTQDHAAAALAAAGIPVFAWKG  102 (427)
T ss_pred             CCCCCEEEEE-EEECHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHCCEEEEEECC
T ss_conf             9899889999-830088999999999849989995479876457999999868916999789


No 276
>KOG1399 consensus
Probab=95.44  E-value=0.02  Score=35.81  Aligned_cols=34  Identities=32%  Similarity=0.548  Sum_probs=31.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             8987999836854899999999859869998189
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      -.++|+|+|+|.||+++|+-|++.|++|+++.+.
T Consensus         5 ~~~~vaIIGAG~sGL~~ar~l~~~g~~v~vfEr~   38 (448)
T KOG1399           5 MSKDVAVIGAGPAGLAAARELLREGHEVVVFERT   38 (448)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             7785489785668889999998779983699705


No 277
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism]
Probab=95.42  E-value=0.079  Score=31.73  Aligned_cols=146  Identities=20%  Similarity=0.107  Sum_probs=59.6

Q ss_pred             HHHHHHHCCCEEEEEECCCHH-----HHHH-HHCCCEEECCCCCCC------------CCCCEEEECCCCC--CCCCCCC
Q ss_conf             999999859869998189647-----8899-978989964531572------------2588899888868--5675578
Q gi|254781099|r   23 AACALKDSGVHVIAWDDHPCA-----VKQA-KDMGIEVIDFREIPW------------SIISFLVLSPGIA--LTGENAH   82 (468)
Q Consensus        23 ~A~~l~~~G~~V~~~D~~~~~-----~~~l-~~~g~~~~~~~~~~~------------~~~d~vv~Spgi~--~~~~~~~   82 (468)
                      ++.-|...|.+|...--+|.+     ...+ ...|+.++-.+....            ..+|.++-.-|--  .-+ ..+
T Consensus        61 LietL~a~GAeV~~a~cNplSTqD~vaaAl~~~~GipVfA~kGe~~eeY~~~~~~vl~~~p~iiiDDG~D~~~~vh-~~~  139 (420)
T COG0499          61 LIETLKAGGAEVRWASCNPLSTQDDVAAALAAKEGIPVFAWKGETLEEYYEAIDQVLDWEPNIIIDDGGDLTKLVH-LER  139 (420)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCCEEEEEE-CCC
T ss_conf             9999985585699852788766678999987505961799707878999999999956599879824732021000-054


Q ss_pred             HHHHHHHHCCCEE-EEEHHHHHHHHHHCCCCCCEEEEECCCCCCHH-------HHHHHHHHHH-----HHHHCCCCC--C
Q ss_conf             8899999769809-98303422334301568868996034575215-------7899999987-----310000000--1
Q gi|254781099|r   83 WCVKLANQFNVEI-IGDIELFVRERRFSSLQSPFIAVTGTNGKSST-------VALISHVLRK-----NGYDVQLGG--N  147 (468)
Q Consensus        83 ~~~~~a~~~gi~v-~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt-------~~ll~~iL~~-----~g~~~~~~G--N  147 (468)
                      +.+...-.-+.+= ++.+.-...+.+.-...-|+|+|--|.=|..-       -+++..|++.     +|+++.++|  -
T Consensus       140 ~~l~~~i~G~tEETTTGV~RL~am~~~G~L~fPai~VNDs~tK~~FDNrYGtgqS~~DgI~RaTn~liaGK~vVV~GYG~  219 (420)
T COG0499         140 PELLDAIKGGTEETTTGVHRLRAMEKDGVLKFPAINVNDSVTKSLFDNRYGTGQSLLDGILRATNVLLAGKNVVVAGYGW  219 (420)
T ss_pred             HHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCEEEECCHHHHCCCCCCCCCCHHHHHHHHHHHCEEECCCEEEEECCCC
T ss_conf             87887742877534228999998976697323558604344413145665641248999986420011486699963564


Q ss_pred             CCCCCCCCCCCCCCCEEEEECC
Q ss_conf             2443221101688837999217
Q gi|254781099|r  148 IGLPILNLEYFSPNRFYVIECS  169 (468)
Q Consensus       148 iG~p~~~~~~~~~~~~~V~E~S  169 (468)
                      .|........--..++.|-|++
T Consensus       220 vGrG~A~~~rg~GA~ViVtEvD  241 (420)
T COG0499         220 VGRGIAMRLRGMGARVIVTEVD  241 (420)
T ss_pred             CCHHHHHHHHCCCCEEEEEECC
T ss_conf             4366999862289869998248


No 278
>PRK06914 short chain dehydrogenase; Provisional
Probab=95.41  E-value=0.17  Score=29.42  Aligned_cols=44  Identities=16%  Similarity=0.066  Sum_probs=33.8

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             18987999836-854899999999859869998189647889997
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      +.+|.++|-|. .+-|+++|+.|.++|++|.+++.++...+++..
T Consensus         1 l~~K~alITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~~l~~   45 (280)
T PRK06914          1 MNKKIAIITGASSGFGLLTTLELAKKDYLVIATMRNLEKQENLIS   45 (280)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             951989990734499999999999879989999898899999999


No 279
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed
Probab=95.40  E-value=0.069  Score=32.16  Aligned_cols=68  Identities=24%  Similarity=0.346  Sum_probs=51.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCC----EEEEEECCCHHHHHHHH-CCCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             9879998368548999999998598----69998189647889997-8989964531572258889988886856
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGV----HVIAWDDHPCAVKQAKD-MGIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~----~V~~~D~~~~~~~~l~~-~g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      +|+|+|+|.|.=|.+++.-|.+.|.    ++..+|.++...+++.+ .++.+........+..|+||++  |.|.
T Consensus         2 ~kkI~fIG~GnMg~Aii~Gl~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~Dii~La--VKP~   74 (272)
T PRK12491          2 NKQIGFIGCGNMGIAMIGGMINKNIVSPDQIICSDLNVSNLKNASDKYGITITTNNNEVANSADILILS--IKPD   74 (272)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCEEECCHHHHHHHCCEEEEE--ECHH
T ss_conf             986999856799999999999788989676999697999999999971978866879997319999999--5778


No 280
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]
Probab=95.40  E-value=0.078  Score=31.77  Aligned_cols=37  Identities=30%  Similarity=0.451  Sum_probs=31.5

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEEC
Q ss_conf             132189879998368548999999998598-6999818
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDD   39 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~   39 (468)
                      |+-|++.+|.|+|+|+-|--+++.|.+.|+ +.+..|.
T Consensus        25 lekl~~~~V~VvGiGGVGSw~veALaRsGig~itlID~   62 (263)
T COG1179          25 LEKLKQAHVCVVGIGGVGSWAVEALARSGIGRITLIDM   62 (263)
T ss_pred             HHHHHCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             99975094899945845399999999818881899712


No 281
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated
Probab=95.38  E-value=0.029  Score=34.79  Aligned_cols=39  Identities=26%  Similarity=0.349  Sum_probs=32.2

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             132189879998368548999999998598699981896
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |++-...-|.|+|.|.+|+++|..|.++|++|...|.++
T Consensus         1 m~~~~~~DV~IvGaGp~Gl~lA~~L~~~G~~v~liE~~~   39 (392)
T PRK08773          1 MSRRSRRDAVIVGGGVVGAACALALADAGLSVALVEGRE   39 (392)
T ss_pred             CCCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             999999988999906999999999986699789991789


No 282
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional
Probab=95.36  E-value=0.089  Score=31.38  Aligned_cols=37  Identities=11%  Similarity=0.114  Sum_probs=30.5

Q ss_pred             HCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             189879998368---5489999999985986999818964
Q gi|254781099|r    6 FRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         6 ~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      ++||+++|-|.|   +-|.++|+.|.+.|++|..+.+...
T Consensus         8 L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~   47 (272)
T PRK08159          8 MQGKRGLILGVANNRSIAWGIAKACRAAGAELAFTYQGDA   47 (272)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHH
T ss_conf             5899999988999868999999999986999999748668


No 283
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.34  E-value=0.06  Score=32.57  Aligned_cols=51  Identities=22%  Similarity=0.278  Sum_probs=39.5

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCEE
Q ss_conf             3218987999836-85489999999985986999818964788----999789899
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIEV   54 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~~   54 (468)
                      .+|+||.+.|-|. .+-|+++|+.|.++|++|..+|++...++    .++..|...
T Consensus         2 ksL~gKvalITGas~GIG~aiA~~la~~Ga~V~l~~r~~~~l~~~~~~i~~~g~~~   57 (238)
T PRK07666          2 ESLQGKNALITGAGRGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKA   57 (238)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             89999989991637789999999999879989999899999999999999559927


No 284
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of some bacterial LDHs from firmicutes, gammaproteobacteria, and actinobacteria. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenase, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=95.33  E-value=0.077  Score=31.83  Aligned_cols=68  Identities=12%  Similarity=0.117  Sum_probs=45.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHH----CC---CEEECCCCCCCCCCCEEEECCCCCC
Q ss_conf             79998368548999999998598--699981896478----89997----89---8996453157225888998888685
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKD----MG---IEVIDFREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~----~g---~~~~~~~~~~~~~~d~vv~Spgi~~   76 (468)
                      ||.|+|.|.-|.++|..|..+|.  ++..+|.++...    ..+..    .+   ..+.........+.|+||++-|+|.
T Consensus         1 KI~IIGaG~VG~~~A~~l~~~~~~~elvL~Di~~~~a~g~a~Dl~h~~~~~~~~~~~~~~~~y~~~~~aDiVVitaG~~~   80 (307)
T cd05290           1 KLVVIGAGHVGSAVLNYALALGLFSEIVLIDVNEGVAEGEALDFHHATALTYSTNTKIRAGDYDDCADADIIVITAGPSI   80 (307)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCCEEECCCCHHHHCCCCEEEECCCCCC
T ss_conf             98999969899999999985699887999928898237999987612035899865866799899469999998677765


Q ss_pred             C
Q ss_conf             6
Q gi|254781099|r   77 T   77 (468)
Q Consensus        77 ~   77 (468)
                      .
T Consensus        81 k   81 (307)
T cd05290          81 D   81 (307)
T ss_pred             C
T ss_conf             8


No 285
>PRK08328 hypothetical protein; Provisional
Probab=95.31  E-value=0.055  Score=32.81  Aligned_cols=36  Identities=31%  Similarity=0.514  Sum_probs=31.3

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEEC
Q ss_conf             32189879998368548999999998598-6999818
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDD   39 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~   39 (468)
                      ..+++++|+|+|+|+-|-.+|.+|...|. ++...|.
T Consensus        23 ~kL~~s~VlvvG~GGlGs~~~~~La~~GvG~i~lvD~   59 (230)
T PRK08328         23 EKLKKAKVAVVGVGGLGSPVAYYLAAAGVGTVLLIDE   59 (230)
T ss_pred             HHHHCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9985597899887878999999999848986898748


No 286
>PRK09291 short chain dehydrogenase; Provisional
Probab=95.31  E-value=0.12  Score=30.43  Aligned_cols=41  Identities=24%  Similarity=0.226  Sum_probs=33.1

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             987999836-85489999999985986999818964788999
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      +|+|+|-|. .+-|+++|+.|.++|++|.++++....++.+.
T Consensus         2 gK~vLITGAssGIGraiA~~la~~G~~Vi~~~r~~~~l~~l~   43 (257)
T PRK09291          2 SKTILITGAGSGFGREVALRLARKGHRVIAGVQIAPQVTELR   43 (257)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             998999689858999999999987998999968789999999


No 287
>PRK04148 hypothetical protein; Provisional
Probab=95.30  E-value=0.083  Score=31.58  Aligned_cols=87  Identities=26%  Similarity=0.324  Sum_probs=62.3

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC-----CCCCCCCCCCEEEECCCCCCCCCCC
Q ss_conf             89879998368548999999998598699981896478899978989964-----5315722588899888868567557
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID-----FREIPWSIISFLVLSPGIALTGENA   81 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~-----~~~~~~~~~d~vv~Spgi~~~~~~~   81 (468)
                      ++.+|.=+|+|.- .-+|..|.+.|+.|.+.|-++.++......|+..+-     +.-...+++|++. |  |.+.-+-.
T Consensus        16 ~~~kIvEvGIGf~-~~vA~~L~e~g~dv~~~Din~~aV~~a~~~Gl~~v~DDif~P~l~iY~~a~lIY-S--IRPp~Elq   91 (135)
T PRK04148         16 KNGKIAELGIGFY-FKVAKKLKESGFDVIVIDINKKAVEKAKKLGLNAFVDDIFNPNLEIYKNAKLIY-S--IRPPRDLQ   91 (135)
T ss_pred             CCCEEEEEECCCC-HHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCCEEECCCCCCCHHHHCCCCEEE-E--ECCCHHHH
T ss_conf             2873899923666-789999987499889995765543221232876375158899888851788799-8--18987888


Q ss_pred             CHHHHHHHHCCCEEEE
Q ss_conf             8889999976980998
Q gi|254781099|r   82 HWCVKLANQFNVEIIG   97 (468)
Q Consensus        82 ~~~~~~a~~~gi~v~s   97 (468)
                      .+++.-|++.+.+++=
T Consensus        92 ~~il~lakkv~~dliI  107 (135)
T PRK04148         92 PFILELAKKLNCPLYI  107 (135)
T ss_pred             HHHHHHHHHCCCCEEE
T ss_conf             9999999975998999


No 288
>PRK06483 short chain dehydrogenase; Provisional
Probab=95.28  E-value=0.18  Score=29.29  Aligned_cols=48  Identities=27%  Similarity=0.296  Sum_probs=37.4

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHHCCCEEE
Q ss_conf             987999836-8548999999998598699981896-47889997898996
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP-CAVKQAKDMGIEVI   55 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~-~~~~~l~~~g~~~~   55 (468)
                      +|+|+|-|. ++-|.++|+.|.++|++|.+.++++ +..+.++..+...+
T Consensus         2 ~ktVlVTGas~GIG~aiA~~la~~Ga~Vvi~~r~~~~~~~~l~~~~~~~~   51 (236)
T PRK06483          2 SAPILITGAGQRIGLALAKHLLAQGQPVIVSYRSHYPAIDELRQAGATCI   51 (236)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHCCCEEE
T ss_conf             98799978998899999999998899899995984799999985699899


No 289
>PRK12937 short chain dehydrogenase; Provisional
Probab=95.27  E-value=0.16  Score=29.56  Aligned_cols=73  Identities=25%  Similarity=0.215  Sum_probs=44.2

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH-----HHHHHHCCCEEECC----CC------------CCCC
Q ss_conf             18987999836-854899999999859869998189647-----88999789899645----31------------5722
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA-----VKQAKDMGIEVIDF----RE------------IPWS   63 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~-----~~~l~~~g~~~~~~----~~------------~~~~   63 (468)
                      +-||.++|-|- ++-|.++|+-|.+.|++|..++.+...     .+.++..+.+....    .+            ..+.
T Consensus         3 ~sgK~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dv~~~~~~~~~v~~~~~~~g   82 (245)
T PRK12937          3 DSNKVAIVTGASRGIGAAIARRLAADGFAVAVNYAGSAAMADELVEEIEAAGGRAIAVQADVADAAAVDRLFEAAETAFG   82 (245)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHC
T ss_conf             99988999485778999999999987999999769986899999999996599589998378999999999999999819


Q ss_pred             CCCEEEECCCCCCCC
Q ss_conf             588899888868567
Q gi|254781099|r   64 IISFLVLSPGIALTG   78 (468)
Q Consensus        64 ~~d~vv~Spgi~~~~   78 (468)
                      ..|.+|-..|+.+..
T Consensus        83 ~iDilVnNAg~~~~~   97 (245)
T PRK12937         83 RIDVLVNSAGIMPLA   97 (245)
T ss_pred             CCCEEEEECCCCCCC
T ss_conf             988999805489998


No 290
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional
Probab=95.27  E-value=0.055  Score=32.80  Aligned_cols=42  Identities=14%  Similarity=0.096  Sum_probs=33.5

Q ss_pred             CHHHCCCEEEEECC-CH--HHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             13218987999836-85--48999999998598699981896478
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GR--SGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~--sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      |-+|+||+++|-|. |.  -|.++|+.|.+.|++|...|.++...
T Consensus         1 m~~L~GK~alVTGaa~g~GIG~aiA~~la~~Ga~V~i~~~~~~~~   45 (254)
T PRK07533          1 MMPLAGKRGLVVGIANEQSIAWGCARAFRALGAELAVTYLNDKAR   45 (254)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             998999989996888980899999999998799999982887789


No 291
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase. Members of this family occur as the BphD protein of biphenyl catabolism and as the TodD protein of toluene catabolism. Members catalyze the second step in each pathway and proved interchangeable when tested; the first and fourth enzymes in each pathway confer metabolic specificity. In the context of biphenyl degradation, the enzyme acts as cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (EC 1.3.1.56), while in toluene degradation it acts as cis-toluene dihydrodiol dehydrogenase.
Probab=95.27  E-value=0.065  Score=32.32  Aligned_cols=45  Identities=13%  Similarity=0.209  Sum_probs=36.6

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC
Q ss_conf             18987999836-8548999999998598699981896478899978
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM   50 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~   50 (468)
                      |+||.++|-|- ++-|+++|+.|.+.|++|..+|.+...+.++...
T Consensus         3 L~gKvalITGgs~GIG~aia~~~a~~Ga~V~i~~r~~~~l~~~~~~   48 (262)
T TIGR03325         3 LKGEVVLVTGGASGLGRAIVDRFVAEGARVAVLDKSAAGLQELEAA   48 (262)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH
T ss_conf             8998899906787899999999998799999998998999999986


No 292
>PRK07680 late competence protein ComER; Validated
Probab=95.26  E-value=0.15  Score=29.89  Aligned_cols=66  Identities=17%  Similarity=0.169  Sum_probs=49.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC----CEEEEEECCCHHHHHHHHC--CCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             7999836854899999999859----8699981896478899978--989964531572258889988886856
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSG----VHVIAWDDHPCAVKQAKDM--GIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G----~~V~~~D~~~~~~~~l~~~--g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      ||+|+|.|.=|.++++-|.+.|    .++..+|+++.....+...  ++.+..-.......+|+||++  |.|.
T Consensus         2 kI~fIG~GnMg~Aii~gl~~~~~~~~~~i~i~~r~~~~~~~l~~~~~~i~~~~~~~~~~~~~dvIiLa--VKPq   73 (273)
T PRK07680          2 NIGFIGTGNMGTILIEAFLESRAVKPSCLTITNRTPAKAYHIKEKYPSIHVAKTIEEVIEQSELIFIC--VKPL   73 (273)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCEEEECCHHHHHHCCCEEEEE--CCHH
T ss_conf             89998769999999999997799894569998899899999998769908868889998409989996--4888


No 293
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like enzymes involved in molybdopterin and thiamine biosynthesis family. The common reaction mechanism catalyzed by MoeB and ThiF, like other E1 enzymes, begins with a nucleophilic attack of the C-terminal carboxylate of MoaD and ThiS, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of  a thiocarboxylate at the C termini of MoaD and ThiS. MoeB, as the MPT synthase (MoaE/MoaD complex) sulfurase, is involved in the biosynthesis of the molybdenum cofactor, a derivative of the tricyclic pterin, molybdopterin (MPT). ThiF catalyzes the adenylation of ThiS, as part of the biosynthesis pathway of thiamin pyrophosphate (vitamin B1).
Probab=95.26  E-value=0.13  Score=30.18  Aligned_cols=36  Identities=33%  Similarity=0.413  Sum_probs=31.1

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHCCC-EEEEEEC
Q ss_conf             32189879998368548999999998598-6999818
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDSGV-HVIAWDD   39 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~   39 (468)
                      ..+++.+|+|+|+|+-|-.+|.+|...|. ++...|.
T Consensus        17 ~~L~~s~VlivG~GGlGs~~~~~La~~Gvg~i~lvD~   53 (228)
T cd00757          17 EKLKNARVLVVGAGGLGSPAAEYLAAAGVGKLGLVDD   53 (228)
T ss_pred             HHHHCCCEEEECCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             9986497899887788999999999839975899978


No 294
>PRK06126 hypothetical protein; Provisional
Probab=95.25  E-value=0.033  Score=34.33  Aligned_cols=39  Identities=23%  Similarity=0.328  Sum_probs=33.3

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             132189879998368548999999998598699981896
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |++-..--|+|+|.|.+|+.+|..|..+|.+|.+.|+.+
T Consensus         2 m~~~~~~DVlIVGaGPvGL~lA~~La~~Gi~v~viEr~~   40 (545)
T PRK06126          2 MENTSETPVLIVGGGPVGLALALELGRRGVDSILVERGD   40 (545)
T ss_pred             CCCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             999888998999949899999999998799999988999


No 295
>PRK05866 short chain dehydrogenase; Provisional
Probab=95.25  E-value=0.061  Score=32.50  Aligned_cols=50  Identities=18%  Similarity=0.187  Sum_probs=38.9

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH----HHHCCCE
Q ss_conf             3218987999836-854899999999859869998189647889----9978989
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ----AKDMGIE   53 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~----l~~~g~~   53 (468)
                      .||+||.++|-|. .+-|.++|+.|.++|++|..+|.+...++.    +...|..
T Consensus        36 ~dL~GKvaLITGassGIG~aiA~~la~~Ga~Vvl~~R~~~~l~~~~~~i~~~g~~   90 (290)
T PRK05866         36 VDLTGKRILLTGASSGIGEAAAEKFARRGATVVAVARRKDLLDAVADRITAAGGD   90 (290)
T ss_pred             CCCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCE
T ss_conf             7899998999081309999999999986998999989999999999999964990


No 296
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=95.24  E-value=0.13  Score=30.29  Aligned_cols=46  Identities=22%  Similarity=0.312  Sum_probs=39.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC
Q ss_conf             79998368548999999998598699981896478899978989964
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID   56 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~   56 (468)
                      ||+|+|.|--|.-.+-+|.+.|++|+..++ +...+.+...|+.+.+
T Consensus         4 kI~IiGaGAvG~~~a~~L~~aG~~V~lv~r-~~~~~~i~~~Gl~i~~   49 (341)
T PRK08229          4 RICVLGAGSIGCYLGGRLAAAGADVTLIGR-ARIGDEIRAHGLRLTD   49 (341)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEEC-HHHHHHHHHCCCEEEC
T ss_conf             799989679999999999858998799956-7899999967909963


No 297
>PRK13566 anthranilate synthase; Provisional
Probab=95.23  E-value=0.24  Score=28.40  Aligned_cols=28  Identities=18%  Similarity=0.332  Sum_probs=16.9

Q ss_pred             CCCEEEECCCCCCCCCCCCHHHHHHHHH
Q ss_conf             9859994522166313479899999999
Q gi|254781099|r  418 LPSIVLFSPGCASFDQYNNFRERGFSFM  445 (468)
Q Consensus       418 ~gDiVLlSPa~aS~d~f~~y~~RG~~F~  445 (468)
                      ..|.|+||||=-.=..|.-=..-...|.
T Consensus       566 ~pD~vvlSPGPG~P~d~g~~~~i~~~~~  593 (724)
T PRK13566        566 NPDLVVLSPGPGRPEDFDCKATIDAALA  593 (724)
T ss_pred             CCCEEEECCCCCCCHHCCCHHHHHHHHH
T ss_conf             8898998799979000558599999985


No 298
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion]
Probab=95.23  E-value=0.26  Score=28.20  Aligned_cols=42  Identities=29%  Similarity=0.389  Sum_probs=36.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC
Q ss_conf             879998368548999999998598699981896478899978
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM   50 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~   50 (468)
                      .+|.|+|.|.=|.++|..|.+.|++|..|..++....++...
T Consensus         2 ~kI~ViGaGswGTALA~~la~ng~~V~lw~r~~~~~~~i~~~   43 (329)
T COG0240           2 MKIAVIGAGSWGTALAKVLARNGHEVRLWGRDEEIVAEINET   43 (329)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC
T ss_conf             618998178379999999996698469996289999999734


No 299
>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase.
Probab=95.23  E-value=0.057  Score=32.71  Aligned_cols=52  Identities=15%  Similarity=0.080  Sum_probs=34.9

Q ss_pred             HHCCCEEEEECCCHHHH-H-HHHHHHHCCCEEEEEECCCHHH-----HHHHHCCCEEECC
Q ss_conf             21898799983685489-9-9999998598699981896478-----8999789899645
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGL-S-AACALKDSGVHVIAWDDHPCAV-----KQAKDMGIEVIDF   57 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~-s-~A~~l~~~G~~V~~~D~~~~~~-----~~l~~~g~~~~~~   57 (468)
                      .|+|.+|... +=++-. + +++.|...|++|..+-.+|.+.     ..|...|+.++..
T Consensus        40 Pl~G~rI~~~-lHle~kTA~L~~tL~~~GA~V~~~~~NplSTQDdvaAaL~~~Gi~VfA~   98 (430)
T pfam05221        40 PLKGARIAGC-LHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAW   98 (430)
T ss_pred             CCCCCEEEEE-EECHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHCCCEEEEE
T ss_conf             9999889999-8317999999999998598799965897532379999999679769993


No 300
>PTZ00325 malate dehydrogenase; Provisional
Probab=95.23  E-value=0.23  Score=28.47  Aligned_cols=123  Identities=18%  Similarity=0.124  Sum_probs=63.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCCHHHH--HHHHCCCE----EECCC--CCCCCCCCEEEECCCCCCC
Q ss_conf             87999836-8548999999998598--6999818964788--99978989----96453--1572258889988886856
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGV--HVIAWDDHPCAVK--QAKDMGIE----VIDFR--EIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~--~l~~~g~~----~~~~~--~~~~~~~d~vv~Spgi~~~   77 (468)
                      +||.|+|. |.-|.++|-.|..+|.  ++..+|.++..-.  .+......    .+...  ....++.|.||++-|.|..
T Consensus         2 ~KV~IIGA~G~VG~s~A~~l~~~~~~~elvL~Di~~a~g~a~Dl~~~~~~~~~~~~~~~~~~e~~~~aDIVVitaG~~rk   81 (313)
T PTZ00325          2 FKVAVLGAAGGIGQPLSLLLKRNPYVSTLSLYDIVGAPGVAADLSHIPSPAKVTGYAKGELHKAVDGADVVLIVAGVPRK   81 (313)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCCCEECCCCHHHHHCCCCEEEECCCCCCC
T ss_conf             38999899986999999999838997779998089726689888675553566545279888984899899988898899


Q ss_pred             CCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHH
Q ss_conf             75578889999976980998303422334301568868996034575215789999998731
Q gi|254781099|r   78 GENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNG  139 (468)
Q Consensus        78 ~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g  139 (468)
                      ..+....+   .+.+.+++.++  ..... ....++  |=|-=||==-+.+.+.++.++..+
T Consensus        82 pg~tR~dL---l~~N~~I~~~i--~~~i~-~~~~~a--iiivvtNPvD~mt~i~~~~~~~~~  135 (313)
T PTZ00325         82 PGMTRDDL---FNTNAGIVRDL--VLACA-SSAPKA--IFGIITNPVNSTVPIAAETLKKAG  135 (313)
T ss_pred             CCCCHHHH---HHHHHHHHHHH--HHHHH-HHCCCE--EEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             78968999---99706999999--99999-769980--999736824799999999999747


No 301
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated
Probab=95.18  E-value=0.089  Score=31.39  Aligned_cols=38  Identities=16%  Similarity=0.083  Sum_probs=31.2

Q ss_pred             CCCHHHCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             98132189879998368---5489999999985986999818
Q gi|254781099|r    1 MKLSSFRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~   39 (468)
                      |. -+|+||+++|-|.+   +-|.++|+.|.+.|++|..++.
T Consensus         1 M~-~~L~GK~alVTGaag~~GiG~aia~~la~~GA~V~i~~~   41 (259)
T PRK07370          1 MM-LDLTGKKALVTGIANNRSIAWGIAQQLHAAGAELGITYL   41 (259)
T ss_pred             CC-CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             99-899999899979899857999999999986999999947


No 302
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy). The equilibrium lies far on the side of AdoHyc synthesis, but in nature the removal of Ado and Hyc is sufficiently fast, so that the net reaction is in the direction of hydrolysis. Since AdoHyc is a potent inhibitor of S-adenosyl-L-methionine dependent methyltransferases,  AdoHycase plays a critical role in the modulation of the activity of various methyltransferases. The enzyme forms homooligomers of 45-50kDa subunits, each binding one molecule of NAD+.
Probab=95.18  E-value=0.066  Score=32.29  Aligned_cols=52  Identities=17%  Similarity=0.074  Sum_probs=34.5

Q ss_pred             HHCCCEEEEECCCHHHH--HHHHHHHHCCCEEEEEECCCHHH-----HHHHHCCCEEECC
Q ss_conf             21898799983685489--99999998598699981896478-----8999789899645
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGL--SAACALKDSGVHVIAWDDHPCAV-----KQAKDMGIEVIDF   57 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~--s~A~~l~~~G~~V~~~D~~~~~~-----~~l~~~g~~~~~~   57 (468)
                      .|+|.+|+.. +=++-.  -+++.|...|++|..+-.+|.+.     ..|.+.|+.++..
T Consensus        33 Pl~G~rI~~c-lHle~kTA~L~~tL~~~GA~V~~~~~NplSTQDdvaAaL~~~gi~VfA~   91 (413)
T cd00401          33 PLKGARIAGC-LHMTVQTAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAAAGIPVFAW   91 (413)
T ss_pred             CCCCCEEEEE-EECHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHCCCEEEEE
T ss_conf             9899889999-8205889999999998599899963797653289999999679769984


No 303
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional
Probab=95.18  E-value=0.075  Score=31.89  Aligned_cols=41  Identities=22%  Similarity=0.210  Sum_probs=34.7

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9813218987999836-8548999999998598699981896
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |-..+|+||.++|-|- ++-|+++|+.|.+.|++|..+|+++
T Consensus         1 mM~~~l~gKvalITGas~GIG~aiA~~la~~Ga~V~~~~r~~   42 (260)
T PRK12823          1 MMNQRFAGKVAVVTGAAQGIGRGVALRAAAEGARVVLVDRSE   42 (260)
T ss_pred             CCCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH
T ss_conf             988887999899948867899999999998799999996946


No 304
>PRK07985 oxidoreductase; Provisional
Probab=95.17  E-value=0.22  Score=28.63  Aligned_cols=35  Identities=23%  Similarity=0.157  Sum_probs=28.9

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             218987999836-85489999999985986999818
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~   39 (468)
                      .|+||.+.|-|- ++-|+++|+.|.+.|++|...+.
T Consensus        46 rL~gKvalVTGas~GIG~aiA~~lA~~GA~Vvi~~~   81 (294)
T PRK07985         46 RLKDRKALVTGGDSGIGRAAAIAYAREGADVAISYL   81 (294)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECC
T ss_conf             789997999172669999999999987999999429


No 305
>PRK06057 short chain dehydrogenase; Provisional
Probab=95.16  E-value=0.086  Score=31.48  Aligned_cols=47  Identities=23%  Similarity=0.290  Sum_probs=37.5

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             9813218987999836-85489999999985986999818964788999
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      |. ..|+||.+.|-|- ++-|.++|+.|.+.|++|...|.++...+.+.
T Consensus         1 M~-~rL~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~d~~~~~~~~~~   48 (255)
T PRK06057          1 LS-QRLAGRVAVITGGASGIGLATARRMRAEGATVVVGDIDPEAGKAAA   48 (255)
T ss_pred             CC-CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             99-8889998999684888999999999986998999969889999999


No 306
>TIGR00292 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR002922 This family includes P32318 from SWISSPROT a putative thiamine biosynthetic enzyme . This enzyme is involved in the biosynthesis of the thiamine precursor thiazole, and is repressed by thiamine.; GO: 0009228 thiamin biosynthetic process.
Probab=95.15  E-value=0.06  Score=32.54  Aligned_cols=36  Identities=28%  Similarity=0.569  Sum_probs=30.8

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCC--CEEEEEECC
Q ss_conf             218987999836854899999999859--869998189
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSG--VHVIAWDDH   40 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G--~~V~~~D~~   40 (468)
                      +|-.-=|.|.|.|-||+++|+||.+.|  .+|.+..++
T Consensus        18 ~~~e~DViiVGAGpSGLtAAyylA~~gPDLKv~vlEr~   55 (283)
T TIGR00292        18 DYAESDVIIVGAGPSGLTAAYYLAKEGPDLKVVVLERK   55 (283)
T ss_pred             HHHHCCEEEECCCCCHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             55010667987897466899999842998069998511


No 307
>PRK12935 acetoacetyl-CoA reductase; Provisional
Probab=95.14  E-value=0.21  Score=28.83  Aligned_cols=76  Identities=20%  Similarity=0.240  Sum_probs=46.7

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCCHH----HHHHHHCCCEEEC----CCC------------C
Q ss_conf             13218987999836-854899999999859869998-189647----8899978989964----531------------5
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAW-DDHPCA----VKQAKDMGIEVID----FRE------------I   60 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~-D~~~~~----~~~l~~~g~~~~~----~~~------------~   60 (468)
                      |.+|+||.++|-|- ++-|.++|+.|.+.|++|... +.+...    .+.+...|.....    ..+            .
T Consensus         1 M~~L~gKvalVTG~s~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~~~~~v~~~~~   80 (247)
T PRK12935          1 MVQLNGKVAIVTGGAKGIGKAITVALAQEGAKVVINYNSSKEAAENLVNELGKEGHDVYAVQADVSKVEDANRLVEEAVN   80 (247)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
T ss_conf             99889698999172768999999999987998999769998999999999984399589998579999999999999999


Q ss_pred             CCCCCCEEEECCCCCCCC
Q ss_conf             722588899888868567
Q gi|254781099|r   61 PWSIISFLVLSPGIALTG   78 (468)
Q Consensus        61 ~~~~~d~vv~Spgi~~~~   78 (468)
                      .+...|.+|-..|+....
T Consensus        81 ~~G~iDiLVNNAGi~~~~   98 (247)
T PRK12935         81 HFGKVDILVNNAGITRDR   98 (247)
T ss_pred             HCCCCCEEEECCCCCCCC
T ss_conf             839998999899889999


No 308
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional
Probab=95.14  E-value=0.043  Score=33.57  Aligned_cols=32  Identities=44%  Similarity=0.528  Sum_probs=29.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|.|+|.|..|+++|..|.++|++|...|..+
T Consensus         7 DV~IvGaGp~Gl~lAl~La~~G~~v~lie~~~   38 (386)
T PRK07494          7 DIAVSGGGPAGLAAAIALASAGASVALVAPAP   38 (386)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             68999906899999999987899889995799


No 309
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=95.13  E-value=0.1  Score=30.97  Aligned_cols=67  Identities=27%  Similarity=0.424  Sum_probs=53.2

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEEC-CCHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             1321898799983685489999999985986999818-9647889997898996453157225888998
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDD-HPCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~-~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      ++=+++|+|+|+|.|--|.+=|.-|++.|.+|+.-=+ ...+.+..++.|.++.+..+.- ...|+|..
T Consensus        13 l~~LkgK~iaIIGYGsQG~ahalNlRDSGlnViiGlr~g~~s~~kA~~dGf~V~~v~ea~-k~ADvim~   80 (338)
T COG0059          13 LDLLKGKKVAIIGYGSQGHAQALNLRDSGLNVIIGLRKGSSSWKKAKEDGFKVYTVEEAA-KRADVVMI   80 (338)
T ss_pred             HHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHCCCEEECHHHHH-HCCCEEEE
T ss_conf             456549869999027087888742242487479985688724899996697751399985-22799998


No 310
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional
Probab=95.13  E-value=0.083  Score=31.59  Aligned_cols=28  Identities=11%  Similarity=0.045  Sum_probs=14.4

Q ss_pred             EEEECCHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             8998799999999999998448985999
Q gi|254781099|r  396 STLSKTLDQALKSVVRDVENVQLPSIVL  423 (468)
Q Consensus       396 ~~~~~~~~~a~~~i~~~~~~~~~gDiVL  423 (468)
                      +.....++++.++.......-..|-+||
T Consensus       317 It~~~~le~~~eA~~~l~~~~~~GKvvl  344 (347)
T PRK10309        317 IAHRGSFESFAQAVRDLAGNPMPGKVLL  344 (347)
T ss_pred             EEEEEEHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             5449849999999999981999189999


No 311
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed predominantly of bacterial LDHs and a few fungal LDHs. Bacterial LDHs may be non-allosteric or may be activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=95.12  E-value=0.25  Score=28.27  Aligned_cols=69  Identities=16%  Similarity=0.192  Sum_probs=45.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHH----HHHHHH----CC-CEEECCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             79998368548999999998598--69998189647----889997----89-899645315722588899888868567
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCA----VKQAKD----MG-IEVIDFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~----~~~l~~----~g-~~~~~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      ||.|+|.|.-|.++|..|..+|.  ++..+|.++..    ...|..    .+ ..+.........+.|+||++-|+|...
T Consensus         2 KI~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~DL~~a~~~~~~~~i~~~~~~~l~daDvVVitaG~~rk~   81 (308)
T cd05292           2 KVAIVGAGFVGSTTAYALLLRGLASEIVLVDINKAKAEGEAMDLAHGTPFVKPVRIYAGDYADCKGADVVVITAGANQKP   81 (308)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEECCHHHHCCCCEEEECCCCCCCC
T ss_conf             79999948889999999986799887999918898451256876624103688168409999977999999899999998


No 312
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only]
Probab=95.12  E-value=0.19  Score=29.12  Aligned_cols=67  Identities=24%  Similarity=0.307  Sum_probs=45.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHH-HHHCCCEEECCCCCC-CCCCCEEEECCCCCCC
Q ss_conf             87999836854899999999859869998189-647889-997898996453157-2258889988886856
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQ-AKDMGIEVIDFREIP-WSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~-l~~~g~~~~~~~~~~-~~~~d~vv~Spgi~~~   77 (468)
                      ++++|+|.|.-|.++|+.|...||+|...-.+ |..... .+.++..+....... .+..|.|+.+  ||+.
T Consensus         2 ~~~~i~GtGniG~alA~~~a~ag~eV~igs~r~~~~~~a~a~~l~~~i~~~~~~dA~~~aDVVvLA--VP~~   71 (211)
T COG2085           2 MIIAIIGTGNIGSALALRLAKAGHEVIIGSSRGPKALAAAAAALGPLITGGSNEDAAALADVVVLA--VPFE   71 (211)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHCCCCCCCCHHHHHHCCCEEEEE--CCHH
T ss_conf             179996257187899999996797399964788067889998645653347768888439989995--4578


No 313
>PRK12827 short chain dehydrogenase; Provisional
Probab=95.11  E-value=0.069  Score=32.16  Aligned_cols=38  Identities=29%  Similarity=0.428  Sum_probs=33.6

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             13218987999836-854899999999859869998189
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |.+|+||.+.|-|- ++-|+++|+.|.+.|++|...|..
T Consensus         1 M~~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~   39 (251)
T PRK12827          1 MASLDSRRVLITGGSGGLGRAIAVRLAADGADVIVLDIH   39 (251)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             989899889996825589999999999879989998488


No 314
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed
Probab=95.11  E-value=0.042  Score=33.63  Aligned_cols=34  Identities=26%  Similarity=0.320  Sum_probs=30.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9879998368548999999998598699981896
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .-.|.|+|.|..|+++|..|.+.|++|.+.|..+
T Consensus         5 ~~DV~IvG~G~vGl~lAl~La~~G~~V~viE~~~   38 (391)
T PRK08020          5 PTEIAIVGGGMVGGALALGLAQHGFSVAVIEHAA   38 (391)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9848999936999999999986699789994899


No 315
>PRK07479 consensus
Probab=95.07  E-value=0.084  Score=31.55  Aligned_cols=41  Identities=20%  Similarity=0.209  Sum_probs=33.9

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             18987999836-854899999999859869998189647889
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |+||.++|-|- ++-|+++|+.|.+.|++|...|.++...++
T Consensus         3 L~gK~alITGgs~GIG~a~a~~la~~G~~V~i~~~~~~~~~~   44 (252)
T PRK07479          3 LSGKVAIVTGAGSGFGEGIAKRFAREGAKVVVADLNAAAAER   44 (252)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             799889993887689999999999879999999798999999


No 316
>PRK13771 putative alcohol dehydrogenase; Provisional
Probab=95.06  E-value=0.24  Score=28.38  Aligned_cols=101  Identities=15%  Similarity=0.175  Sum_probs=37.9

Q ss_pred             CCCCCCEEECCCCCCCHHHHHHHHHCC--CCCCEEEECCCCCC-CCHHHHHHHHCCCCEEE-EECCCHH---HHHHHHH-
Q ss_conf             003430000023556755555532013--33200120321012-20689899842786899-9889989---9888631-
Q gi|254781099|r  320 ARLGHVIFINDSKATNLHSVIHAFLNE--KRRIYWIAGGLSKS-DDFSTLFPFISKIAKAY-FIGNSAM---LFFHHFG-  391 (468)
Q Consensus       320 ~~~~gv~iIDDS~atnp~a~~~Al~~~--~~~i~lI~GG~~K~-~d~~~L~~~~~~~~~~~-liG~~~~---~i~~~~~-  391 (468)
                      .+.+|+.++-|.-.  ..+...+++..  .++++ ++|+.+.. ..+ ++.....+-..+. .++....   ...+.+. 
T Consensus       221 ~~~~g~Dvvid~~G--~~~~~~~~~~l~~~G~iv-~~G~~~~~~~~~-~~~~~~~k~~~i~g~~~~~~~~~~~~~~l~~~  296 (332)
T PRK13771        221 KKLGGADIVIETVG--GPTLEESLRSLNWGGKIV-LIGNVDPSPASL-RLGLLILKDIEILGHISATKKDVEEALKLVAE  296 (332)
T ss_pred             HHCCCCCEEEECCC--HHHHHHHHHHHCCCCEEE-EEECCCCCCCCC-CHHHHHHCCCEEEEEECCCHHHHHHHHHHHHC
T ss_conf             73468638984576--688998888625896999-993457875764-58999866878999855789999999999986


Q ss_pred             CCCC--EEEECCHHHHHHHHHHHHHHCC-CCCEEEECC
Q ss_conf             6898--8998799999999999998448-985999452
Q gi|254781099|r  392 GKIN--STLSKTLDQALKSVVRDVENVQ-LPSIVLFSP  426 (468)
Q Consensus       392 ~~~~--~~~~~~~~~a~~~i~~~~~~~~-~gDiVLlSP  426 (468)
                      +.+.  ......++++. .+.+..+.-+ .|- |++-|
T Consensus       297 g~i~~~i~~~~~l~~~~-~A~~~l~~~~~~GK-vVl~P  332 (332)
T PRK13771        297 GKIKPVIAGHVSLSDID-KALEMLKDKSHIGR-ILVKP  332 (332)
T ss_pred             CCCEEEEEEEEEHHHHH-HHHHHHHCCCCCEE-EEEEC
T ss_conf             99864572798289999-99999977998657-99979


No 317
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=95.05  E-value=0.058  Score=32.68  Aligned_cols=39  Identities=28%  Similarity=0.382  Sum_probs=33.2

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             218987999836-854899999999859869998189647
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA   43 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~   43 (468)
                      +|+||+++|-|- ++-|+++|+.|.+.|++|.++|.+++.
T Consensus         2 ~L~gK~alVTG~s~GIG~aia~~la~~GA~V~~~d~~~~~   41 (261)
T PRK12428          2 RLDGKTIVVTGVASGIGAEVARLLRFLGARVIGLDRRPPG   41 (261)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_conf             8999889997857799999999999869999999688554


No 318
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=95.05  E-value=0.29  Score=27.83  Aligned_cols=53  Identities=17%  Similarity=0.236  Sum_probs=39.7

Q ss_pred             CCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH-----HHHHHHHCCCEE
Q ss_conf             813218987999836-85489999999985986999818964-----788999789899
Q gi|254781099|r    2 KLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC-----AVKQAKDMGIEV   54 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~-----~~~~l~~~g~~~   54 (468)
                      +..||+||.+.|-|. ++-|+++|+.|.+.|++|...|.++.     ..+.+...|.+.
T Consensus         3 ~~~dL~GKvalVTGas~GIGraiA~~lA~~GA~Vvi~d~~~~~~~~~~~~ei~~~G~~~   61 (303)
T PRK07792          3 NTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDIASALDASDVLDEIRAAGAKA   61 (303)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHCCCCE
T ss_conf             97568999899928866899999999998699999971897247999999998449938


No 319
>PRK08324 short chain dehydrogenase; Validated
Probab=95.04  E-value=0.29  Score=27.82  Aligned_cols=41  Identities=5%  Similarity=-0.098  Sum_probs=22.0

Q ss_pred             CCCCCEEEECCCCCCCCHHHHHHHH-CCCCEEEEECCCHHHHHH
Q ss_conf             3332001203210122068989984-278689998899899888
Q gi|254781099|r  346 EKRRIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFH  388 (468)
Q Consensus       346 ~~~~i~lI~GG~~K~~d~~~L~~~~-~~~~~~~liG~~~~~i~~  388 (468)
                      +.+|++||.||- .|.... .+..+ .+=.++++.+-+.+...+
T Consensus       419 L~GKVALVTGga-~GIG~A-~A~~fa~eGA~Vvl~D~~~~~l~~  460 (676)
T PRK08324        419 LAGKVALVTGAA-GGIGLA-TAKRLAAEGACVVLADIDEEAAEA  460 (676)
T ss_pred             CCCCEEEEECCC-CCHHHH-HHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             899879994798-816299-999999879989999588899999


No 320
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IPR011548   3-hydroxyisobutyrate dehydrogenase is an enzyme that catalyzes the NAD+-dependent oxidation of 3-hydroxyisobutyrate to methylmalonate semialdehyde of the valine catabolism pathway.    In Pseudomonas aeruginosa, 3-hydroxyisobutyrate dehydrogenase (mmsB) is co-induced with methylmalonate-semialdehyde dehydrogenase (mmsA) when grown on medium containing valine as the sole carbon source. The positive transcriptional regulator of this operon (mmsR) is located upstream of these genes and has been identified as a member of the XylS/AraC family of transcriptional regulators .    3-hydroxyisobutyrate dehydrogenase shares high sequence homology to the characterised 3-hydroxyisobutyrate dehydrogenase from rat liver  with conservation of proposed NAD+ binding residues at the N-terminus (G-8,10,13,24 and D-31).    This enzyme belongs to the 3-hydroxyacid dehydrogenase family, sharing a common evolutionary origin and enzymatic mechanism with 6-phosphogluconate . HIBADH exhibits sequence similarity to the NAD binding domain of 6-phosphogluconate dehydrogenase. ; GO: 0008442 3-hydroxyisobutyrate dehydrogenase activity, 0051287 NAD binding.
Probab=95.04  E-value=0.027  Score=35.00  Aligned_cols=58  Identities=22%  Similarity=0.249  Sum_probs=50.3

Q ss_pred             EECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEE
Q ss_conf             9836854899999999859869998189647889997898996453157225888998
Q gi|254781099|r   13 VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL   70 (468)
Q Consensus        13 i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~   70 (468)
                      ++|+|.=|-+.|+=|.+.||.|.+||-.|..++.+.+.|.+.-.-...-.++.|.||-
T Consensus         1 FIGLGNMGgPMA~NL~KAGH~v~~FDL~p~av~~~v~aG~~~A~S~~~a~~~Ad~vIT   58 (290)
T TIGR01692         1 FIGLGNMGGPMAANLLKAGHAVRVFDLSPKAVEELVEAGAQAAASAAEAAEGADVVIT   58 (290)
T ss_pred             CCCCCCCCHHHHHHHHHHCCEEEEEECCHHHHHHHHHCCHHCCCCHHHHHCCCCEEEE
T ss_conf             9788888227999986118725775178899999996002205457988455886863


No 321
>COG2403 Predicted GTPase [General function prediction only]
Probab=95.03  E-value=0.12  Score=30.49  Aligned_cols=131  Identities=20%  Similarity=0.283  Sum_probs=71.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHH--CCCEEEEEE---------C-CCHH-HHHHHHCCCEEECCCCCC-------CCCCC
Q ss_conf             89879998368548999999998--598699981---------8-9647-889997898996453157-------22588
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKD--SGVHVIAWD---------D-HPCA-VKQAKDMGIEVIDFREIP-------WSIIS   66 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~--~G~~V~~~D---------~-~~~~-~~~l~~~g~~~~~~~~~~-------~~~~d   66 (468)
                      ..|+|.++|.|.--...-+...+  .-++|..+-         + .|++ ...+...|+.+....+..       -...|
T Consensus         5 a~kRviiLgaggrdfhv~n~a~r~~~~yevvaf~aaqiiG~~er~yppsleg~~~p~Gvpi~~~k~~~~lek~ire~~VD   84 (449)
T COG2403           5 ARKRVIILGAGGRDFHVFNVALRDNPEYEVVAFTAAQIIGGTERIYPPSLEGVLYPLGVPILPEKDYDDLEKIIREKDVD   84 (449)
T ss_pred             CCEEEEEEECCCCCCCHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCC
T ss_conf             75269999506756622467860687524788899883277665389970113233783304664689999999870766


Q ss_pred             EEEE--CCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECC---CCCCHHHHHHHHHHHHHHHH
Q ss_conf             8998--888685675578889999976980998303422334301568868996034---57521578999999873100
Q gi|254781099|r   67 FLVL--SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT---NGKSSTVALISHVLRKNGYD  141 (468)
Q Consensus        67 ~vv~--Spgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT---~GKTTt~~ll~~iL~~~g~~  141 (468)
                      .+|.  |. +++.+-  --+.-+....|...+   +|- -.........|+|+||||   .|||+++..++.+|++-||+
T Consensus        85 ~~VlaySD-vs~e~v--~~IaS~vLs~GA~f~---~~g-P~et~~~~ekPviaV~atrtg~GKsaVS~~v~r~l~ergyr  157 (449)
T COG2403          85 IVVLAYSD-VSYEHV--FRIASRVLSAGADFK---ELG-PKETMLKLEKPVIAVTATRTGVGKSAVSRYVARLLRERGYR  157 (449)
T ss_pred             EEEEECCC-CCHHHH--HHHHHHHHHCCCEEE---EEC-CCHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             16877012-898998--789999974785368---727-52776651485599997236655678889999999866982


Q ss_pred             CCC
Q ss_conf             000
Q gi|254781099|r  142 VQL  144 (468)
Q Consensus       142 ~~~  144 (468)
                      +-+
T Consensus       158 v~v  160 (449)
T COG2403         158 VCV  160 (449)
T ss_pred             EEE
T ss_conf             379


No 322
>PRK08945 short chain dehydrogenase; Provisional
Probab=95.00  E-value=0.089  Score=31.38  Aligned_cols=43  Identities=21%  Similarity=0.224  Sum_probs=35.1

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             3218987999836-854899999999859869998189647889
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      +-|+||.|+|-|. ++-|.++|+.|.++|++|..+++++..++.
T Consensus         9 ~~L~gK~~lITGas~GIG~aiA~~la~~Ga~Vil~~r~~~~l~~   52 (245)
T PRK08945          9 DLLKDRIILVTGAGDGIGREAALTYARHGATVILLGRTEEKLEA   52 (245)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             67897989994886189999999999879989999698899999


No 323
>PRK07454 short chain dehydrogenase; Provisional
Probab=94.99  E-value=0.096  Score=31.16  Aligned_cols=52  Identities=19%  Similarity=0.250  Sum_probs=39.0

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH----HHHCCCEE
Q ss_conf             9813218987999836-854899999999859869998189647889----99789899
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ----AKDMGIEV   54 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~----l~~~g~~~   54 (468)
                      |+|+  +.|.++|-|. ++-|.++|+.|.+.|++|..++++...+++    +...|.+.
T Consensus         1 m~~~--~mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~   57 (241)
T PRK07454          1 MSLN--SMPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKV   57 (241)
T ss_pred             CCCC--CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             9989--99889991758789999999999879989999899999999999999659928


No 324
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional
Probab=94.98  E-value=0.3  Score=27.72  Aligned_cols=15  Identities=20%  Similarity=0.313  Sum_probs=4.7

Q ss_pred             CCCCCCCHHHCCCHH
Q ss_conf             222211000000001
Q gi|254781099|r  296 GLKVEEIKRALLSCG  310 (468)
Q Consensus       296 Gi~~~~i~~~L~~f~  310 (468)
                      |.+++.-.-+++.|-
T Consensus       247 ~~~l~gk~vaIqGfG  261 (469)
T PTZ00079        247 NIVVEKKTAVVSGSG  261 (469)
T ss_pred             CCCCCCCEEEEECCC
T ss_conf             998578889997667


No 325
>PRK12828 short chain dehydrogenase; Provisional
Probab=94.95  E-value=0.1  Score=30.91  Aligned_cols=45  Identities=24%  Similarity=0.317  Sum_probs=36.6

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             9813218987999836-854899999999859869998189647889
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |. .+|+||.++|-|- ++-|+++|+.|.+.|++|..+|.+....+.
T Consensus         1 M~-~~L~gKvalITGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~   46 (239)
T PRK12828          1 ME-HSLQGKVVAITGGFGGLGRATAAWLAARGARVALIGRGAAPLSQ   46 (239)
T ss_pred             CC-CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             99-99698989994725489999999999879989999798778999


No 326
>PRK07890 short chain dehydrogenase; Provisional
Probab=94.95  E-value=0.095  Score=31.20  Aligned_cols=48  Identities=19%  Similarity=0.287  Sum_probs=36.6

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH----HHHHCCCE
Q ss_conf             18987999836-85489999999985986999818964788----99978989
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK----QAKDMGIE   53 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~----~l~~~g~~   53 (468)
                      |+||.++|-|- ++-|+++|+.|.++|++|...|++...++    ++...|..
T Consensus         3 L~gK~alVTG~s~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~i~~~g~~   55 (258)
T PRK07890          3 LKDKVVVVSGVGPGLGTTLAVRAAREGADVVLAARTAERLDEVAKQIDDLGRR   55 (258)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCC
T ss_conf             89988999685658999999999987998999979899999999999964995


No 327
>pfam01266 DAO FAD dependent oxidoreductase. This family includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase EC:1.1.99.5, Sarcosine oxidase beta subunit EC:1.5.3.1, D-alanine oxidase EC:1.4.99.1, D-aspartate oxidase EC:1.4.3.1.
Probab=94.95  E-value=0.044  Score=33.47  Aligned_cols=32  Identities=31%  Similarity=0.431  Sum_probs=29.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .|.|+|.|..|+++|..|.++|++|.+.|+.+
T Consensus         1 dv~IIGaGi~Gls~A~~La~~G~~V~vie~~~   32 (309)
T pfam01266         1 DVVVIGGGIVGLSTAYELARRGLSVTLLERGD   32 (309)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             99999927999999999997899599994999


No 328
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family. This family consists of fungal proteins of unknown function associated with secondary metabolite biosynthesis, such as of the ergot alkaloids such as ergovaline. Nomenclature differs because gene order differs - this is EasG in Neotyphodium lolii but is designated ergot alkaloid biosynthetic protein A in several other fungi.
Probab=94.95  E-value=0.061  Score=32.50  Aligned_cols=87  Identities=15%  Similarity=0.127  Sum_probs=52.3

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCC----C-------CCCCEEE-ECCCCCC
Q ss_conf             7999836-854899999999859869998189647889997898996453157----2-------2588899-8888685
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP----W-------SIISFLV-LSPGIAL   76 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~----~-------~~~d~vv-~Spgi~~   76 (468)
                      +|+|.|. |..|..+++.|.+.|+.|.+..+++.........++.+-..+...    .       ...+.+. ++|..+.
T Consensus         1 TIlVtGATG~iG~~v~~~L~~~g~~v~~~~R~~~~~~~~~~~~v~~d~~d~~~~~~a~~~~d~~~~~v~~v~l~~p~~~~   80 (285)
T TIGR03649         1 TILLTGGTGKTASRIARLLQAASVPFLVASRSSSSSAGPNEKHVKFDWLDEDTWDNPFSSDDGMEPEISAVYLVAPPIPD   80 (285)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC
T ss_conf             98999899818999999998689978999588566466667536864448114888976353231274189983899877


Q ss_pred             CCCCCCHHHHHHHHCCCEEE
Q ss_conf             67557888999997698099
Q gi|254781099|r   77 TGENAHWCVKLANQFNVEII   96 (468)
Q Consensus        77 ~~~~~~~~~~~a~~~gi~v~   96 (468)
                      ..+.....+.+|++.|++-+
T Consensus        81 ~~~~~~~~i~aA~~aGV~~i  100 (285)
T TIGR03649        81 LAPPMIKFIDFARSKGVRRF  100 (285)
T ss_pred             HHHHHHHHHHHHHHCCCCEE
T ss_conf             67899999999998499889


No 329
>PRK08226 short chain dehydrogenase; Provisional
Probab=94.94  E-value=0.084  Score=31.54  Aligned_cols=51  Identities=16%  Similarity=0.203  Sum_probs=38.6

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH---HHHHHHCCCE
Q ss_conf             13218987999836-854899999999859869998189647---8899978989
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA---VKQAKDMGIE   53 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~---~~~l~~~g~~   53 (468)
                      |..|+||.++|-|- ++-|.++|+.|.+.|++|..+|.++..   .+++...|.+
T Consensus         1 M~~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~d~~~~~~~~~~~~~~~g~~   55 (263)
T PRK08226          1 MGKLTGKTALITGALQGIGEGIARVFARHGANLILLDISPEIEKLADELCGRGHR   55 (263)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCC
T ss_conf             9998998899947377999999999998799899996987999999999836991


No 330
>PRK08589 short chain dehydrogenase; Validated
Probab=94.94  E-value=0.08  Score=31.69  Aligned_cols=52  Identities=25%  Similarity=0.300  Sum_probs=39.4

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH---HHHHHHHCCCEE
Q ss_conf             13218987999836-85489999999985986999818964---788999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC---AVKQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~---~~~~l~~~g~~~   54 (468)
                      |..|+||.++|-|- ++-|+++|+.|.+.|++|...|.++.   ..+.+...|.+.
T Consensus         1 M~rL~gKvalVTGas~GIG~aiA~~la~~Ga~Vv~~d~~~~~~~~~~~i~~~g~~~   56 (272)
T PRK08589          1 MKRLENKVAVITGASTGIGQASAIALAQEGAYVLAVDIAEAVSETVDKIKSNGGKA   56 (272)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCE
T ss_conf             99999798999782569999999999986999999838278999999999559948


No 331
>PRK07608 hypothetical protein; Provisional
Probab=94.94  E-value=0.042  Score=33.63  Aligned_cols=33  Identities=39%  Similarity=0.520  Sum_probs=30.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      --|.|+|.|.+|+++|..|.++|++|.+.|.++
T Consensus         6 ~DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~~   38 (389)
T PRK07608          6 FDVAVVGGGLVGKSLALALAQSGLRVALLEAQP   38 (389)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             988999906899999999983799889995899


No 332
>PRK06184 hypothetical protein; Provisional
Probab=94.93  E-value=0.048  Score=33.22  Aligned_cols=39  Identities=23%  Similarity=0.498  Sum_probs=32.4

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             132189879998368548999999998598699981896
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |++-..--|+|+|.|.+|+.+|.+|.++|.+|.+.|+++
T Consensus         1 m~~~~tTDVlIVGaGPvGL~lA~~La~~Gi~v~viEr~~   39 (503)
T PRK06184          1 MTEYTTTDVLIVGAGPTGLTLAIELARRGVSFRLIEKSP   39 (503)
T ss_pred             CCCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             998885798999909999999999997799899994899


No 333
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]
Probab=94.92  E-value=0.043  Score=33.55  Aligned_cols=33  Identities=30%  Similarity=0.474  Sum_probs=30.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             987999836854899999999859869998189
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      ...|.|+|-|+.|+++|..|.+.|++|..+|..
T Consensus         2 ~~dV~IvGaG~aGl~lA~~L~~~G~~V~liE~~   34 (387)
T COG0654           2 MLDVAIVGAGPAGLALALALARAGLDVTLLERA   34 (387)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             854999997899999999998289968999077


No 334
>PRK07326 short chain dehydrogenase; Provisional
Probab=94.86  E-value=0.11  Score=30.86  Aligned_cols=43  Identities=21%  Similarity=0.171  Sum_probs=34.9

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH
Q ss_conf             18987999836-85489999999985986999818964788999
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK   48 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~   48 (468)
                      +.||.++|-|. ++-|+++|+.|.++|++|..+|++...++++.
T Consensus         3 ~~GKvalITGas~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~   46 (235)
T PRK07326          3 GNGKAALVTGGSKGIGFAVAEALAAAGYRVAICARDESELEAAA   46 (235)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH
T ss_conf             99989999382679999999999987999999989889999999


No 335
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. Members of this subfamily are localized to the glycosome and mitochondria. MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Probab=94.86  E-value=0.32  Score=27.50  Aligned_cols=69  Identities=16%  Similarity=0.123  Sum_probs=44.4

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCCHHHHH--HHHC----CCEEECCCC---CCCCCCCEEEECCCCCCC
Q ss_conf             7999836-8548999999998598--69998189647889--9978----989964531---572258889988886856
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGV--HVIAWDDHPCAVKQ--AKDM----GIEVIDFRE---IPWSIISFLVLSPGIALT   77 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~--~V~~~D~~~~~~~~--l~~~----g~~~~~~~~---~~~~~~d~vv~Spgi~~~   77 (468)
                      ||.|+|. |.-|.++|-+|..+|.  ++..+|.+...-..  |...    .+..+....   ....+.|+||++.|+|..
T Consensus         2 KV~IIGA~G~VG~~~A~~l~~~~~~~elvLiDi~~~~g~a~DL~h~~~~~~v~~~~~~~~~~~~l~daDiVVitAG~~rk   81 (310)
T cd01337           2 KVAVLGAAGGIGQPLSLLLKLNPLVSELALYDIVNTPGVAADLSHINTPAKVTGYLGPEELKKALKGADVVVIPAGVPRK   81 (310)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCCCCCCEEEEECCCCHHHHHCCCCEEEECCCCCCC
T ss_conf             89999999818999999997299977699982774266755321656568512570887466774799999987898899


Q ss_pred             C
Q ss_conf             7
Q gi|254781099|r   78 G   78 (468)
Q Consensus        78 ~   78 (468)
                      .
T Consensus        82 p   82 (310)
T cd01337          82 P   82 (310)
T ss_pred             C
T ss_conf             7


No 336
>pfam03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent.
Probab=94.84  E-value=0.05  Score=33.12  Aligned_cols=66  Identities=21%  Similarity=0.302  Sum_probs=46.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEE-EEECCCHHHHHHH-HCCCEEEC-CCCCCCCCCCEEEECCCCCCC
Q ss_conf             79998368548999999998598699-9818964788999-78989964-531572258889988886856
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVI-AWDDHPCAVKQAK-DMGIEVID-FREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~-~~D~~~~~~~~l~-~~g~~~~~-~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      ||+|+|.|.-|.++++-|.+.|+++. ++++++.....+. ..+..... .........|+|+++  +||.
T Consensus         1 KIg~IG~G~mg~ai~~~l~~~g~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~DvIila--vkp~   69 (93)
T pfam03807         1 KIGIIGAGNMGEALARGLAAAGHEVIIANSRNPEKAAALAEELGVGATAVSNEEAAEEADVVILA--VKPE   69 (93)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHHHHCCCCCCCCHHHHHHCCCEEEEE--ECHH
T ss_conf             98999700999999999997799612786487899999999819976458999997449989999--7999


No 337
>PRK06701 short chain dehydrogenase; Provisional
Probab=94.84  E-value=0.33  Score=27.46  Aligned_cols=51  Identities=12%  Similarity=0.194  Sum_probs=37.6

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH-----HHHHHHHCCCEEE
Q ss_conf             218987999836-85489999999985986999818964-----7889997898996
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC-----AVKQAKDMGIEVI   55 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~-----~~~~l~~~g~~~~   55 (468)
                      .|+||.++|=|- .+-|+++|+.|.+.|++|..+|.+..     ....++..|....
T Consensus        42 rL~GKvalVTGgs~GIG~aiA~~la~~GA~V~i~~~~~~~~a~~~~~~~~~~G~~~~   98 (289)
T PRK06701         42 KLKGKVALITGGDSGIGRAVAVAFAKEGADIAIVYLDEHEDANETKQRVEKEGVKCL   98 (289)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCEEE
T ss_conf             779998999682579999999999987998999828946789999999996399089


No 338
>PRK09186 flagellin modification protein A; Provisional
Probab=94.81  E-value=0.11  Score=30.68  Aligned_cols=41  Identities=27%  Similarity=0.306  Sum_probs=33.8

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             18987999836-854899999999859869998189647889
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      |+||.+.|-|- ++-|.++|+.|.+.|++|..+|.+.+....
T Consensus         2 L~gK~~lVTGgs~GIG~aia~~la~~Ga~V~~~~~~~~~~~~   43 (255)
T PRK09186          2 LEGKTILITGAGGLIGSALVKAILEAGGIVIAADINKEALNK   43 (255)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             895989997958689999999999879999999698899999


No 339
>PRK06346 consensus
Probab=94.80  E-value=0.11  Score=30.75  Aligned_cols=49  Identities=18%  Similarity=0.159  Sum_probs=37.4

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCE
Q ss_conf             218987999836-8548999999998598699981896478----899978989
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIE   53 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~   53 (468)
                      +|+||.+.|-|- ++-|+++|+.|.+.|++|..+|.++...    ..+...+.+
T Consensus         2 ~l~gKv~lITGgs~GIG~a~a~~la~~Ga~V~i~~r~~e~~~~~~~~l~~~~~~   55 (251)
T PRK06346          2 KLKGKVAIVTGAASGMGKSIAELFAKEGAKVVVADLNLERAQKVVEEITSNGGT   55 (251)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCE
T ss_conf             889988999475788999999999987998999979899999999999963990


No 340
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional
Probab=94.78  E-value=0.18  Score=29.25  Aligned_cols=39  Identities=21%  Similarity=0.158  Sum_probs=31.3

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             987999836-854899999999859869998189647889
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      +|.++|-|- ++-|.++|+.|.+.|++|..+|.+....+.
T Consensus         2 nKvalITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~   41 (259)
T PRK12384          2 NKVAVVIGGGQTLGAFLCHGLAEEGYRVAVADINSEKAAN   41 (259)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             9789994688689999999999879999999798899999


No 341
>PRK08251 short chain dehydrogenase; Provisional
Probab=94.77  E-value=0.34  Score=27.35  Aligned_cols=40  Identities=13%  Similarity=0.155  Sum_probs=32.9

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             987999836-8548999999998598699981896478899
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      .|+|+|-|. .+-|.++|+.|.++|++|..++++...++++
T Consensus         2 ~K~vlITGAssGIG~alA~~la~~G~~v~l~~r~~~~l~~~   42 (248)
T PRK08251          2 RQKILITGASSGLGAGMAREFAAKGRDLALCARRTDRLEEL   42 (248)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             99899947863999999999998799899998988899999


No 342
>PRK09126 hypothetical protein; Provisional
Probab=94.77  E-value=0.052  Score=33.01  Aligned_cols=32  Identities=41%  Similarity=0.591  Sum_probs=29.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|.|+|.|.+|+++|..|.++|++|.+.|.++
T Consensus         5 DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~~   36 (392)
T PRK09126          5 DILVVGAGPAGLSFARSLAGSGLKVTLIERQP   36 (392)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99999925899999999986899899990898


No 343
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this protein family are 6-phospho 3-hexuloisomerase (PHI), or the PHI domain of a fusion protein. This enzyme is part of the ribulose monophosphate (RuMP) pathway, which in one direction removes the toxic metabolite formaldehyde by assimilation into fructose-6-phosphate. In the other direction, in species lacking a complete pentose phosphate pathway, the RuMP pathway yields ribulose-5-phosphate, necessary for nucleotide biosynthesis, at the cost of also yielding formaldehyde. These latter species tend usually have a formaldehyde-activating enzyme to attach formaldehyde to the C1 carrier tetrahydromethanopterin.
Probab=94.74  E-value=0.21  Score=28.74  Aligned_cols=33  Identities=36%  Similarity=0.479  Sum_probs=24.9

Q ss_pred             CCCEEEEECCCHHHHHH---HHHHHHCCCEEEEEEC
Q ss_conf             89879998368548999---9999985986999818
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSA---ACALKDSGVHVIAWDD   39 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~---A~~l~~~G~~V~~~D~   39 (468)
                      +.++|.++|.|.||..+   +.-|...|..+....+
T Consensus        29 ~a~~I~v~G~G~Sg~ia~~~a~rL~~~G~~~~~~~d   64 (179)
T TIGR03127        29 KAKRIFVAGAGRSGLVGKAFAMRLMHLGFNVYVVGE   64 (179)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             399099999554399999999999851975799764


No 344
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=94.73  E-value=0.076  Score=31.85  Aligned_cols=34  Identities=29%  Similarity=0.486  Sum_probs=30.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9879998368548999999998598699981896
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ...|.|+|.|..|+++|.+|.++|++|.+.+++.
T Consensus         3 ~~dvvVIGaG~~GL~aAa~LA~~G~~V~VlE~~~   36 (487)
T COG1233           3 MYDVVVIGAGLNGLAAAALLARAGLKVTVLEKND   36 (487)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             7629998988789999999996899799996378


No 345
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated
Probab=94.73  E-value=0.056  Score=32.77  Aligned_cols=33  Identities=21%  Similarity=0.431  Sum_probs=30.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -.|+|+|.|-+|+.+|.+|..+|.+|.+.|+.+
T Consensus         3 t~V~IVGaGP~GL~LA~lLar~GI~~vVlEr~~   35 (392)
T PRK08243          3 TQVAIIGAGPAGLLLGQLLHLAGIDSVVLERRS   35 (392)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             889999977999999999997799889997689


No 346
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=94.73  E-value=0.35  Score=27.28  Aligned_cols=49  Identities=20%  Similarity=0.291  Sum_probs=34.3

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC-CHH----HHHHHHCCCEE
Q ss_conf             18987999836-854899999999859869998189-647----88999789899
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDH-PCA----VKQAKDMGIEV   54 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~-~~~----~~~l~~~g~~~   54 (468)
                      |+||.++|-|- .+-|.++|+.|.+.|++|..+..+ ...    .+.++..+.+.
T Consensus         1 L~gKvalITGgs~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~   55 (249)
T PRK06077          1 LKDKVVVVTGSGRGIGRAIAVRLAKEGAKVVVNAKKRAEEMNETLRMVKEYGGEG   55 (249)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCE
T ss_conf             9619899926367899999999998799899984887689999999999759958


No 347
>pfam01946 Thi4 Thi4 family. This family includes a putative thiamine biosynthetic enzyme.
Probab=94.73  E-value=0.097  Score=31.13  Aligned_cols=38  Identities=29%  Similarity=0.504  Sum_probs=32.8

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             13218987999836854899999999859869998189
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |.++-..-|.|+|.|-||+++|.+|.+.|.+|..++++
T Consensus        12 l~~~~e~DV~IVGaGpsGL~aA~~LAk~g~KV~i~E~~   49 (229)
T pfam01946        12 LLDYAESDVVIVGAGPSGLTAAYYLAKKGLKVAIIERS   49 (229)
T ss_pred             HHHHHHCCEEEECCCCHHHHHHHHHHHCCCEEEEEECC
T ss_conf             98764268899887817999999998789859999645


No 348
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated
Probab=94.72  E-value=0.18  Score=29.33  Aligned_cols=44  Identities=27%  Similarity=0.394  Sum_probs=37.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCC
Q ss_conf             87999836854899999999859869998189647889997898
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGI   52 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~   52 (468)
                      .||.|+|.|-=|.++|..|.+.|++|..|-.++...+.+.....
T Consensus         2 mkI~ViGaGawGtAlA~~la~n~~~V~lw~r~~~~~~~In~~~~   45 (325)
T PRK00094          2 MKIAVLGAGSWGTALAILLARNGHDVVLWGRDPEHAAEINTDRE   45 (325)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHHHHHHHCCC
T ss_conf             88999898999999999999789978999838999999996498


No 349
>pfam10727 Rossmann-like Rossmann-like domain. This family of proteins contain a Rossmann-like domain.
Probab=94.72  E-value=0.047  Score=33.27  Aligned_cols=59  Identities=20%  Similarity=0.284  Sum_probs=41.1

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEECC-CHHHHHHHH-CCCEEECCCCCCCCCCCEEEEC
Q ss_conf             99836854899999999859869998189-647889997-8989964531572258889988
Q gi|254781099|r   12 AVFGLGRSGLSAACALKDSGVHVIAWDDH-PCAVKQAKD-MGIEVIDFREIPWSIISFLVLS   71 (468)
Q Consensus        12 ~i~G~G~sG~s~A~~l~~~G~~V~~~D~~-~~~~~~l~~-~g~~~~~~~~~~~~~~d~vv~S   71 (468)
                      +|+|.|+-|.+++.+|.+.||.|+++-.+ +...+.+.. .+..+.+..+ .....|+|+++
T Consensus         1 GiIGaGrvG~~L~~al~~aGh~v~gv~srs~~s~~~a~~~~~~~~~~~~e-v~~~adlv~it   61 (111)
T pfam10727         1 GIISAGRVGVALGEALERAGHVVHAISAISDASRERAERRLDSPVLPIPD-VIRRAELVVLA   61 (111)
T ss_pred             CCCCCCHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHCCCCCCCHHH-HHHHCCEEEEE
T ss_conf             94376577999999999789828999838988999999866997679589-89767999998


No 350
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated
Probab=94.71  E-value=0.055  Score=32.83  Aligned_cols=32  Identities=38%  Similarity=0.647  Sum_probs=29.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|.|+|.|.+|+++|..|.++|++|.+.|.++
T Consensus        19 DV~IVGaGp~Gl~lAl~La~~Gi~v~viE~~~   50 (413)
T PRK07364         19 DVVIVGGGIVGLTLAAALKDSGLRIALIEAQP   50 (413)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             98999927999999999986899889991799


No 351
>PRK06179 short chain dehydrogenase; Provisional
Probab=94.70  E-value=0.14  Score=30.07  Aligned_cols=39  Identities=23%  Similarity=0.273  Sum_probs=29.9

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             8987999836-85489999999985986999818964788
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      .+|.+.|-|. ++-|.++|+.|.++|++|.+++++....+
T Consensus         3 ~~KvalITGassGIG~a~A~~la~~G~~V~~~~r~~~~~~   42 (270)
T PRK06179          3 NKKVALVTGASSGIGRATAEALARAGYRVFGTSRNPARAT   42 (270)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             9958999072469999999999987999999968977730


No 352
>KOG2380 consensus
Probab=94.69  E-value=0.091  Score=31.31  Aligned_cols=66  Identities=21%  Similarity=0.265  Sum_probs=50.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC-CCCCCCCCCCEEEECCCC
Q ss_conf             9879998368548999999998598699981896478899978989964-531572258889988886
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID-FREIPWSIISFLVLSPGI   74 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~-~~~~~~~~~d~vv~Spgi   74 (468)
                      -++|+|+|+|.-|+=.|+.|..+|+.|..+|+.. .....+..|...++ .++..-+..|+|+++-.+
T Consensus        52 tl~IaIIGfGnmGqflAetli~aGh~li~hsRsd-yssaa~~yg~~~ft~lhdlcerhpDvvLlctsi  118 (480)
T KOG2380          52 TLVIAIIGFGNMGQFLAETLIDAGHGLICHSRSD-YSSAAEKYGSAKFTLLHDLCERHPDVVLLCTSI  118 (480)
T ss_pred             CEEEEEEECCCHHHHHHHHHHHCCCEEEECCCCH-HHHHHHHHCCCCCCCHHHHHHCCCCEEEEEEHH
T ss_conf             4489997137088999999986486267447500-689999741233461777875489979997025


No 353
>PRK09564 coenzyme A disulfide reductase; Reviewed
Probab=94.67  E-value=0.12  Score=30.50  Aligned_cols=31  Identities=23%  Similarity=0.385  Sum_probs=26.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHC--CCEEEEEECC
Q ss_conf             799983685489999999985--9869998189
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDS--GVHVIAWDDH   40 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~--G~~V~~~D~~   40 (468)
                      ||.|+|-|..|+++|..+.+.  +.+|+.+|+.
T Consensus         2 kvVIIG~G~AG~saA~~l~~~~~~~~I~v~e~~   34 (443)
T PRK09564          2 KIIIIGGTAAGTSAAAKAKRLNKELEIVVYEKT   34 (443)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             699999609999999999814939999999488


No 354
>PRK06138 short chain dehydrogenase; Provisional
Probab=94.66  E-value=0.13  Score=30.23  Aligned_cols=42  Identities=19%  Similarity=0.219  Sum_probs=34.4

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH
Q ss_conf             218987999836-854899999999859869998189647889
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ   46 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~   46 (468)
                      +|+||.++|-|- ++-|+++|+.|.+.|++|..+|.+....++
T Consensus         2 ~L~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~   44 (252)
T PRK06138          2 RLAGRVAIVTGAGSGIGRATAKLFAREGARVVVADRDAEAAER   44 (252)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             8899889994746799999999999879989999688789999


No 355
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional
Probab=94.65  E-value=0.099  Score=31.05  Aligned_cols=87  Identities=20%  Similarity=0.188  Sum_probs=53.2

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHC-CC---EEE--EEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCC
Q ss_conf             8987999836-85489999999985-98---699--98189647889997898996453157225888998888685675
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDS-GV---HVI--AWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGE   79 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~-G~---~V~--~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~   79 (468)
                      |+-+|+|+|. |..|+-+.++|.++ .+   ++.  ++.+..-..-+.....+.+.+.....+.++|+++.+.+    ..
T Consensus         4 k~~nVaIvGATG~VG~~li~lL~~h~~f~v~~v~~~aS~~saGk~v~~~~~~~~v~~~~~~~~~~~Divf~a~~----~~   79 (347)
T PRK06728          4 KGYHVAVVGATGAVGQKIIELLEKETKFNIAEVTLLSSKRSAGKTVQFKGREIIIQEAKINSFEGVDIAFFSAG----GE   79 (347)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCEEECCCEEEEEECCHHHHHCCCEEEECCC----HH
T ss_conf             88779999880399999999997278987510799865877997626899278998578446516978997685----78


Q ss_pred             CCCHHHHHHHHCCCEEEE
Q ss_conf             578889999976980998
Q gi|254781099|r   80 NAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        80 ~~~~~~~~a~~~gi~v~s   97 (468)
                      -...+..++.+.|+.|++
T Consensus        80 ~s~~~~~~~~~~G~~VID   97 (347)
T PRK06728         80 VSRQFVNQAVSSGAIVID   97 (347)
T ss_pred             HHHHHHHHHHHCCCEEEE
T ss_conf             899999999858969998


No 356
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=94.58  E-value=0.089  Score=31.39  Aligned_cols=37  Identities=30%  Similarity=0.440  Sum_probs=32.4

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             218987999836-8548999999998598699981896
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      +|+||.++|-|- ++-|.++|+.|.+.|++|.+.|..+
T Consensus         2 dl~gK~alVTGas~GIG~aia~~~a~~Ga~V~~~d~~~   39 (237)
T PRK06550          2 EFMTKTVLVTGAASGIGLAQARAFLEQGAHVYGVDKSD   39 (237)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCH
T ss_conf             98998999937477999999999998799999970861


No 357
>PRK06139 short chain dehydrogenase; Provisional
Probab=94.57  E-value=0.12  Score=30.48  Aligned_cols=45  Identities=13%  Similarity=0.204  Sum_probs=37.1

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             13218987999836-8548999999998598699981896478899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      |-.|+||.|.|-|. .+-|.++|+.|.++|++|..+|.+...++++
T Consensus         1 Mg~L~gKvvlITGASsGIG~aiA~~~A~~Ga~Vvl~~R~~~~L~~~   46 (324)
T PRK06139          1 MGPLHGAVVVITGASSGIGRATAEAFARRGARLVLAARDEEALFEV   46 (324)
T ss_pred             CCCCCCCEEEEECHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             9985997799938254999999999998799899998999999999


No 358
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated
Probab=94.56  E-value=0.073  Score=31.98  Aligned_cols=32  Identities=19%  Similarity=0.484  Sum_probs=29.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|.|+|.|.+|+.+|..|.++|++|..+|.++
T Consensus         3 DV~IvGaG~vGl~lAl~La~~g~~v~lie~~~   34 (374)
T PRK06617          3 NTVILGCGLSGMLTALSFAQKGIKTTIFESKS   34 (374)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             29999966999999999985799699997899


No 359
>PRK05855 short chain dehydrogenase; Validated
Probab=94.55  E-value=0.38  Score=27.00  Aligned_cols=28  Identities=29%  Similarity=0.326  Sum_probs=16.6

Q ss_pred             EEEECCCHHHH---HHHHHHHHCCCEEEEEEC
Q ss_conf             99983685489---999999985986999818
Q gi|254781099|r   11 IAVFGLGRSGL---SAACALKDSGVHVIAWDD   39 (468)
Q Consensus        11 v~i~G~G~sG~---s~A~~l~~~G~~V~~~D~   39 (468)
                      |+|-|+=-+-.   .++..|.. -+.|+.||-
T Consensus        29 vlvHGyPD~~~vW~~v~~~La~-~f~vv~yDv   59 (582)
T PRK05855         29 VLVHGYPDSHEVWDGVAPLLAE-RFRVVAYDV   59 (582)
T ss_pred             EEEECCCCCHHHHHHHHHHHCC-CEEEEEECC
T ss_conf             9980688836668999998504-605995557


No 360
>PRK06185 hypothetical protein; Provisional
Probab=94.55  E-value=0.06  Score=32.56  Aligned_cols=34  Identities=24%  Similarity=0.427  Sum_probs=30.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9879998368548999999998598699981896
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .-.|.|+|.|..|+.+|.+|.+.|++|.+.|+.+
T Consensus         6 ~tDV~IVGaGpaGL~lAl~Lar~Gi~V~VlEk~~   39 (409)
T PRK06185          6 TTDCCIVGGGPAGMMLGLLLARAGVDVTVLEKHA   39 (409)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             8998999918899999999997799999991899


No 361
>KOG2614 consensus
Probab=94.51  E-value=0.072  Score=32.00  Aligned_cols=35  Identities=26%  Similarity=0.456  Sum_probs=31.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             98799983685489999999985986999818964
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      ..+|.|+|-|..|.+.|.+|+++|++|.+++...+
T Consensus         2 ~~~VvIvGgGI~Gla~A~~l~r~G~~v~VlE~~e~   36 (420)
T KOG2614           2 EPKVVIVGGGIVGLATALALHRKGIDVVVLESRED   36 (420)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             97489988838989999999875874899862146


No 362
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.51  E-value=0.15  Score=29.83  Aligned_cols=47  Identities=23%  Similarity=0.310  Sum_probs=35.4

Q ss_pred             HHHCCCEEEEECCC-H--HHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC
Q ss_conf             32189879998368-5--48999999998598699981896478899978
Q gi|254781099|r    4 SSFRNHSIAVFGLG-R--SGLSAACALKDSGVHVIAWDDHPCAVKQAKDM   50 (468)
Q Consensus         4 ~~~~~k~v~i~G~G-~--sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~   50 (468)
                      --|+||.++|-|.+ .  -|.++|+.|.+.|++|...+.++...+.+...
T Consensus         3 g~L~gK~~lVTGaag~~GIG~a~A~~la~~Ga~Vv~~~~~~~~~~~~~~~   52 (252)
T PRK06079          3 GILSGKKIVVMGVANKRSIAWGCAQAIKDQGATVIYTYQNDRMKKSLQKL   52 (252)
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH
T ss_conf             61399889998999987799999999998699999984887999999985


No 363
>PRK05717 oxidoreductase; Validated
Probab=94.50  E-value=0.15  Score=29.84  Aligned_cols=45  Identities=20%  Similarity=0.087  Sum_probs=36.2

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             13218987999836-8548999999998598699981896478899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      +..+.||.++|-|- ++-|.++|+.|.+.|++|..+|.+.....++
T Consensus         5 ~~~l~GKvalITG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~   50 (255)
T PRK05717          5 NPGHNGRVALVTGAARGIGLGIAAWLIAEGWQVVLADLDRERGAKV   50 (255)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             6899998899958788899999999998799899996988999999


No 364
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional
Probab=94.49  E-value=0.061  Score=32.53  Aligned_cols=33  Identities=33%  Similarity=0.518  Sum_probs=30.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             879998368548999999998598699981896
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      .-|.|+|.|.+|+++|..|.++|++|...|..|
T Consensus         3 ~DV~IvGaGpvGl~lAl~L~~~G~~v~lie~~~   35 (405)
T PRK05714          3 ADLLIVGAGMVGSALALALEGSGLEVLLVDGGP   35 (405)
T ss_pred             CCEEEECCCHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             889999905999999999961899789995899


No 365
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=94.48  E-value=0.19  Score=29.07  Aligned_cols=87  Identities=15%  Similarity=0.171  Sum_probs=54.7

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCC---EEEEEECCCHHHHHHHH--CCCEEECCCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             8987999836-8548999999998598---69998189647889997--8989964531572258889988886856755
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDSGV---HVIAWDDHPCAVKQAKD--MGIEVIDFREIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~G~---~V~~~D~~~~~~~~l~~--~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      +.-||+|+|. |..|+-+.++|.++++   ++.........-+....  ..+.+.+..+..+..+|+++.+-+    ..-
T Consensus         3 ~~~~VaIvGATG~VG~~li~lL~~~~~p~~~l~~laS~~saGk~i~~~~~~l~v~~~~~~~~~~vDlvffa~~----~~v   78 (336)
T PRK05671          3 QPLDIAVVGATGSVGEALVQVLEERDFPVGTLHLLASMESAGHSVPFAGKNLRVREVDSFDFSQVKLAFFAAG----AAV   78 (336)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCEEEECCCEEEEEECCCCCCCCCCEEEECCC----HHH
T ss_conf             8887999998649999999998636998026999987656898754689678999788244245988998688----166


Q ss_pred             CCHHHHHHHHCCCEEEE
Q ss_conf             78889999976980998
Q gi|254781099|r   81 AHWCVKLANQFNVEIIG   97 (468)
Q Consensus        81 ~~~~~~~a~~~gi~v~s   97 (468)
                      ...+..++.+.|+.|+.
T Consensus        79 s~~~a~~~~~aG~~VID   95 (336)
T PRK05671         79 SRSFAEKALAAGCSVID   95 (336)
T ss_pred             HHHHHHHHHHCCCEEEE
T ss_conf             79989999976997995


No 366
>PRK06227 consensus
Probab=94.48  E-value=0.15  Score=29.79  Aligned_cols=50  Identities=18%  Similarity=0.216  Sum_probs=37.6

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHH----HHHHHHCCCEE
Q ss_conf             218987999836-854899999999859869998189647----88999789899
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEV   54 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~----~~~l~~~g~~~   54 (468)
                      +|+||.++|-|- ++-|.++|+.|.+.|++|...|.++..    .+.++..|.+.
T Consensus         2 ~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~   56 (256)
T PRK06227          2 NLSGKVAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDA   56 (256)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             8999889995866889999999999879999999698889999999999559918


No 367
>PRK06949 short chain dehydrogenase; Provisional
Probab=94.48  E-value=0.17  Score=29.44  Aligned_cols=75  Identities=17%  Similarity=0.156  Sum_probs=49.2

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEEC----CCC------------CCC
Q ss_conf             3218987999836-8548999999998598699981896478----899978989964----531------------572
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVID----FRE------------IPW   62 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~~----~~~------------~~~   62 (468)
                      =+|+||.++|-|. ++-|+++|+.|.++|++|..+|.+...+    .+++..+.....    ..+            ..+
T Consensus         5 ~~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~i~~~g~~~~~~~~Dv~~~~~v~~~v~~~~~~~   84 (258)
T PRK06949          5 INLEGKVALVTGASSGLGQRFAQVLSQAGAKVVLASRRVERLKELRAEIEAEGGAAHVVSLDVTDYQSIKAAVAHAETEA   84 (258)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             87899989995857799999999999879999999698899999999999659928999826899999999999999984


Q ss_pred             CCCCEEEECCCCCCCC
Q ss_conf             2588899888868567
Q gi|254781099|r   63 SIISFLVLSPGIALTG   78 (468)
Q Consensus        63 ~~~d~vv~Spgi~~~~   78 (468)
                      ..+|.+|-..|+....
T Consensus        85 G~iDiLVnnAG~~~~~  100 (258)
T PRK06949         85 GTIDILVNNSGVSTTQ  100 (258)
T ss_pred             CCCCEEEECCCCCCCC
T ss_conf             9998999899889998


No 368
>PRK06834 hypothetical protein; Provisional
Probab=94.43  E-value=0.07  Score=32.11  Aligned_cols=32  Identities=31%  Similarity=0.441  Sum_probs=29.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             87999836854899999999859869998189
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      ..|+|+|.|.+|+.+|.+|.++|.+|.+.|++
T Consensus         4 ~dVlIVGaGPvGL~lA~~La~~Gi~v~viE~~   35 (488)
T PRK06834          4 HAVVIAGGGPTGLMLAGELALAGVDVAIVERR   35 (488)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             98999893889999999999769999999689


No 369
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.42  E-value=0.16  Score=29.62  Aligned_cols=40  Identities=15%  Similarity=0.150  Sum_probs=32.6

Q ss_pred             CHHHCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             132189879998368---5489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |.-|+||+++|-|.+   +-|.++|+.|.+.|++|...+.++.
T Consensus         1 Mg~L~GK~alVTGaa~~~GiG~aiA~~la~~GA~V~i~~~~~~   43 (262)
T PRK07984          1 MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDK   43 (262)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             9988998799989999725999999999987999999827778


No 370
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional
Probab=94.40  E-value=0.14  Score=29.99  Aligned_cols=37  Identities=11%  Similarity=0.061  Sum_probs=30.8

Q ss_pred             HCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             189879998368---5489999999985986999818964
Q gi|254781099|r    6 FRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         6 ~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      ++||+++|-|.+   +-|+++|+.|.+.|++|..++.+..
T Consensus         3 L~GK~alITGaag~~GIG~aiA~~la~~GA~V~i~~~~~~   42 (274)
T PRK08415          3 MKGKKGLIVGVANNKSIAYGIAKACFEQGAELAFTYLNDA   42 (274)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             8998799989999837999999999986999999848878


No 371
>pfam00743 FMO-like Flavin-binding monooxygenase-like. This family includes FMO proteins and cyclohexanone monooxygenase.
Probab=94.40  E-value=0.052  Score=33.01  Aligned_cols=32  Identities=31%  Similarity=0.486  Sum_probs=11.5

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             18987999836854899999999859869998
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSGVHVIAW   37 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~   37 (468)
                      |+||+|+|+|.|.||.-+|.-|.....+|..+
T Consensus       181 f~GKrVlVVG~GnSg~DIA~els~~a~~V~ls  212 (532)
T pfam00743       181 FQGKRVLVIGLGNSGGDIAVELSRTAAQVFLS  212 (532)
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHCCEEEEE
T ss_conf             59974999788898410599998527868999


No 372
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated
Probab=94.40  E-value=0.09  Score=31.36  Aligned_cols=35  Identities=29%  Similarity=0.565  Sum_probs=30.8

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ..--|+|+|.|.+|+.+|.+|.++|++|.+.|+++
T Consensus        11 ~d~dVlIVGaGPvGL~lA~~Lar~Gi~v~vvEr~~   45 (554)
T PRK06183         11 HDTDVVIVGAGPVGLTLANLLGQQGVRVLVLERWP   45 (554)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             98888999959899999999997799999991899


No 373
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364. This clade of FAD dependent oxidoreductases (members of the pfam01266 family) is syntenically associated with a family of proposed phosphonatase-like enzymes (TIGR03351) and is also found (less frequently) in association with phosphonate transporter components. A likely role for this enzyme involves the oxidative deamination of an aminophosphonate differring slightly from 2-aminoethylphosphonate, possibly 1-hydroxy-2-aminoethylphosphonate (see the comments for TIGR03351). Many members of the larger FAD dependent oxidoreductase family act as amino acid oxidative deaminases.
Probab=94.38  E-value=0.07  Score=32.09  Aligned_cols=31  Identities=26%  Similarity=0.407  Sum_probs=29.0

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9998368548999999998598699981896
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |.|+|.|.+|+|+|..|.++|.+|.+.|..+
T Consensus         3 v~VIGaGi~Gls~A~~La~~G~~V~vle~~~   33 (365)
T TIGR03364         3 LIIVGAGILGLAHAYAAARRGLSVTVIERSS   33 (365)
T ss_pred             EEEECCHHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             9999932999999999997899499998999


No 374
>pfam02558 ApbA Ketopantoate reductase PanE/ApbA. This is a family of 2-dehydropantoate 2-reductases also known as ketopantoate reductases, EC:1.1.1.169. The reaction catalysed by this enzyme is: (R)-pantoate + NADP(+) <= 2-dehydropantoate + NADPH. AbpA catalyses the NADPH reduction of ketopantoic acid to pantoic acid in the alternative pyrimidine biosynthetic (APB) pathway. ApbA and PanE are allelic. ApbA, the ketopantoate reductase enzyme is required for the synthesis of thiamine via the APB biosynthetic pathway.
Probab=94.36  E-value=0.22  Score=28.67  Aligned_cols=45  Identities=20%  Similarity=0.342  Sum_probs=37.5

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC
Q ss_conf             9998368548999999998598699981896478899978989964
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID   56 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~   56 (468)
                      |+|+|.|--|.-.|..|.+.|++|+.+++.+ ..+.++..|+.+..
T Consensus         1 I~IiGaGaiG~~~a~~L~~ag~~V~lv~R~~-~~~~i~~~G~~~~~   45 (150)
T pfam02558         1 IAILGAGAVGSLYGARLARAGHDVTLIARGR-HLEAIRENGLRITS   45 (150)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHCCEEEEE
T ss_conf             9999668999999999997799289997563-67887749769994


No 375
>KOG0024 consensus
Probab=94.36  E-value=0.2  Score=28.94  Aligned_cols=38  Identities=13%  Similarity=0.135  Sum_probs=16.7

Q ss_pred             CCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHHHHCCCCCCEEEC
Q ss_conf             011012221022222110000000013454433210034300000
Q gi|254781099|r  285 LVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFIN  329 (468)
Q Consensus       285 alaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E~i~~~~gv~iID  329 (468)
                      .|.++.+|+.+|.+.-.+.+.      .+.|+|.-.+ =|.+.++
T Consensus       182 Gl~t~l~Aka~GA~~VVi~d~------~~~Rle~Ak~-~Ga~~~~  219 (354)
T KOG0024         182 GLLTGLVAKAMGASDVVITDL------VANRLELAKK-FGATVTD  219 (354)
T ss_pred             HHHHHHHHHHCCCCCEEEEEC------CHHHHHHHHH-HCCEEEE
T ss_conf             999999998749872899606------7779999998-2975773


No 376
>TIGR01372 soxA sarcosine oxidase, alpha subunit family; InterPro: IPR006277   This set of sequences describe the alpha subunit of a family of known and putative heterotetrameric sarcosine oxidases. Five operons of such oxidases are found in Mesorhizobium loti and three in Agrobacterium tumefaciens, a high enough copy number to suggest that not all members share the same function. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine to glycine. The reaction converts tetrahydrofolate to 5,10-methylene-tetrahydrofolate .    Bacterial sarcosine oxidases have been isolated from over a dozen different organisms and fall into two major classes (1) monomeric form that contains only covalent flavin and (2) heterotetrameric (alpha, beta, gamma, delta) form that contain a covalent and noncovalent flavin, this entry represents the heterotetrameric form. ; GO: 0008115 sarcosine oxidase activity, 0046653 tetrahydrofolate metabolic process.
Probab=94.35  E-value=0.077  Score=31.81  Aligned_cols=31  Identities=39%  Similarity=0.581  Sum_probs=29.2

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9998368548999999998598699981896
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |+|+|.|-.|+++|+.....|.+|+.+|+++
T Consensus       179 VLVVGaGPAGLAAA~aAa~~GArViL~DE~~  209 (1026)
T TIGR01372       179 VLVVGAGPAGLAAALAAARAGARVILVDEQA  209 (1026)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             7887889679999999964798899970676


No 377
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]
Probab=94.34  E-value=0.35  Score=27.28  Aligned_cols=89  Identities=17%  Similarity=0.141  Sum_probs=54.3

Q ss_pred             CCCEEEEECCCHHHH-HHHHHHHHCCC---EEEEEECCCHHHHH-HHHCCCE-EE-CCCCCCC-CCCCEEEECCCCCCCC
Q ss_conf             898799983685489-99999998598---69998189647889-9978989-96-4531572-2588899888868567
Q gi|254781099|r    7 RNHSIAVFGLGRSGL-SAACALKDSGV---HVIAWDDHPCAVKQ-AKDMGIE-VI-DFREIPW-SIISFLVLSPGIALTG   78 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~-s~A~~l~~~G~---~V~~~D~~~~~~~~-l~~~g~~-~~-~~~~~~~-~~~d~vv~Spgi~~~~   78 (468)
                      +..+|+|+|.|+.+. ..+..+...+.   -|..+|.++...+. .+..++. .+ +..+... ..+|+|++.  .|++ 
T Consensus         2 ~~irvgiiG~G~~~~~~~~~~~~~~~~~~~~vav~d~~~~~a~~~a~~~~~~~~~~~~~~ll~~~~iD~V~Ia--tp~~-   78 (342)
T COG0673           2 KMIRVGIIGAGGIAGKAHLPALAALGGGLELVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIA--TPNA-   78 (342)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHCCCCCCCCCHHHHHCCCCCCEEEEE--CCCH-
T ss_conf             9327999898767888889999738874699999649989999999981997452999999459999889996--9806-


Q ss_pred             CCCCHHHHHHHHCCCEEEEEH
Q ss_conf             557888999997698099830
Q gi|254781099|r   79 ENAHWCVKLANQFNVEIIGDI   99 (468)
Q Consensus        79 ~~~~~~~~~a~~~gi~v~s~~   99 (468)
                       .-.+...+|.+.|+.|+.|-
T Consensus        79 -~H~~~a~~AL~aGkhVl~EK   98 (342)
T COG0673          79 -LHAELALAALEAGKHVLCEK   98 (342)
T ss_pred             -HHHHHHHHHHHCCCEEEEEC
T ss_conf             -77999999997799699928


No 378
>TIGR03453 partition_RepA plasmid partitioning protein RepA. Members of this family are the RepA (or ParA) protein involved in replicon partitioning. All known examples occur in bacterial species with two or more replicons, on a plasmid or the smaller chromosome. Note that an apparent exception may be seen as a pseudomolecule from assembly of an incompletely sequenced genome. Members of this family belong to a larger family that also includes the enzyme cobyrinic acid a,c-diamide synthase, but assignment of that name to members of this family would be in error.
Probab=94.33  E-value=0.033  Score=34.33  Aligned_cols=36  Identities=36%  Similarity=0.426  Sum_probs=31.5

Q ss_pred             CCCCCEEEEE---CCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             5688689960---34575215789999998731000000
Q gi|254781099|r  110 SLQSPFIAVT---GTNGKSSTVALISHVLRKNGYDVQLG  145 (468)
Q Consensus       110 ~~~~~vI~VT---GT~GKTTt~~ll~~iL~~~g~~~~~~  145 (468)
                      ..+.+||+|.   |=.|||||+.-|++.|...|++|.++
T Consensus       101 g~~~~VIav~N~KGGVGKTTtav~LA~~LA~~G~RVLvI  139 (387)
T TIGR03453       101 GEHLQVIAVTNFKGGSGKTTTSAHLAQYLALRGYRVLAI  139 (387)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             998808999788876569999999999999779988999


No 379
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional
Probab=94.31  E-value=0.098  Score=31.08  Aligned_cols=38  Identities=24%  Similarity=0.322  Sum_probs=34.0

Q ss_pred             CCCHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             98132189879998368548999999998598699981896
Q gi|254781099|r    1 MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |.|.+|.   |.|+|-|-.|+++|..+.+.|.+|...|+.+
T Consensus         2 m~m~~YD---viVIGaGpaG~~aA~~aa~~G~kV~viE~~~   39 (465)
T PRK05249          2 MHMYDYD---AVVIGSGPAGEGAAMQAAKLGKRVAVIERYR   39 (465)
T ss_pred             CCCCCCC---EEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             9877789---8999977899999999997899299997699


No 380
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional
Probab=94.31  E-value=0.17  Score=29.45  Aligned_cols=41  Identities=15%  Similarity=0.250  Sum_probs=32.4

Q ss_pred             CCCHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCCH
Q ss_conf             9813218987999836-854899999999859869998-18964
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAW-DDHPC   42 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~-D~~~~   42 (468)
                      |. .+|+||.++|-|- ++-|+++|+.|.+.|++|... +.+..
T Consensus         2 M~-~~L~gK~alVTGgs~GIG~aia~~la~~Ga~V~i~~~~~~~   44 (260)
T PRK08416          2 MN-NEMKGKTLVISGGTRGIGKAIVYEFAQSGVNIAFTYNSNVE   44 (260)
T ss_pred             CC-CCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCCCHH
T ss_conf             88-77899989996734099999999999879999998599889


No 381
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family. Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains
Probab=94.28  E-value=0.1  Score=31.04  Aligned_cols=68  Identities=22%  Similarity=0.327  Sum_probs=44.1

Q ss_pred             EEEECC-CHHHHHHHHHHHHCC----CEEEEEECCCHHH----HHHHHCC-----CEE--ECCCCCCCCCCCEEEECCCC
Q ss_conf             999836-854899999999859----8699981896478----8999789-----899--64531572258889988886
Q gi|254781099|r   11 IAVFGL-GRSGLSAACALKDSG----VHVIAWDDHPCAV----KQAKDMG-----IEV--IDFREIPWSIISFLVLSPGI   74 (468)
Q Consensus        11 v~i~G~-G~sG~s~A~~l~~~G----~~V~~~D~~~~~~----~~l~~~g-----~~~--~~~~~~~~~~~d~vv~Spgi   74 (468)
                      |.|+|. |.-|.++|-.|..++    -++..+|.++...    ..+....     ..+  .........+.|+||++.|+
T Consensus         1 V~IIGA~G~VG~~~a~~l~~~~~~~~~el~L~Di~~~~~~g~a~Dl~~~~~~~~~~~v~~~~~~~~~~~daDvVVitag~   80 (263)
T cd00650           1 IAVIGAGGNVGPALAFGLADGSVLLAIELVLYDIDEEKLKGVAMDLQDAVEPLADIKVSITDDPYEAFKDADVVIITAGV   80 (263)
T ss_pred             CEEECCCCHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCEEEECCCHHHHHCCCCEEEEECCC
T ss_conf             98987797799999999982899999889999589872087999998545235787399748738983799899990577


Q ss_pred             CCCC
Q ss_conf             8567
Q gi|254781099|r   75 ALTG   78 (468)
Q Consensus        75 ~~~~   78 (468)
                      |...
T Consensus        81 ~~k~   84 (263)
T cd00650          81 GRKP   84 (263)
T ss_pred             CCCC
T ss_conf             8899


No 382
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion]
Probab=94.24  E-value=0.28  Score=27.95  Aligned_cols=69  Identities=17%  Similarity=0.187  Sum_probs=44.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHH------CCCEEEC-CCCCCCCCCCEEEECCCCC
Q ss_conf             879998368548999999998598--699981896478----89997------8989964-5315722588899888868
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKD------MGIEVID-FREIPWSIISFLVLSPGIA   75 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~------~g~~~~~-~~~~~~~~~d~vv~Spgi~   75 (468)
                      +||.|+|.|.-|.++|-.|..++.  ++..+|.+....    ..|..      ....+.. .......+.|+||++-|+|
T Consensus         1 ~KV~viGaG~VG~s~a~~l~~~~~~~el~LiDi~~~~~~G~a~DL~~~~~~~~~~~~i~~~~~y~~~~~aDiVvitAG~p   80 (313)
T COG0039           1 MKVAVIGAGNVGSSLAFLLLLQGLGSELVLIDINEEKAEGVALDLSHAAAPLGSDVKITGDGDYEDLKGADIVVITAGVP   80 (313)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHCCHHHCCHHCCCCEEEECCCCHHHHCCCCEEEEECCCC
T ss_conf             93999898747899999996255566599997466656401102533400026761883478702316998999968888


Q ss_pred             CC
Q ss_conf             56
Q gi|254781099|r   76 LT   77 (468)
Q Consensus        76 ~~   77 (468)
                      ..
T Consensus        81 rK   82 (313)
T COG0039          81 RK   82 (313)
T ss_pred             CC
T ss_conf             99


No 383
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]
Probab=94.23  E-value=0.088  Score=31.43  Aligned_cols=35  Identities=37%  Similarity=0.687  Sum_probs=31.1

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCE-EEEEECCC
Q ss_conf             898799983685489999999985986-99981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVH-VIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~-V~~~D~~~   41 (468)
                      ....|+|+|.|.||+++|..|.+.|.. +.+.|.+.
T Consensus         7 ~~~~v~IIGaG~sGlaaa~~L~~~g~~~~~i~Ek~~   42 (443)
T COG2072           7 THTDVAIIGAGQSGLAAAYALKQAGVPDFVIFEKRD   42 (443)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             755489989878899999999975998679997057


No 384
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism]
Probab=94.21  E-value=0.4  Score=26.89  Aligned_cols=66  Identities=17%  Similarity=0.178  Sum_probs=49.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC----CEEEEEECCCHHHH-HHHHCCCEEECCCCCCCCCCCEEEECCCCCC
Q ss_conf             87999836854899999999859----86999818964788-9997898996453157225888998888685
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG----VHVIAWDDHPCAVK-QAKDMGIEVIDFREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G----~~V~~~D~~~~~~~-~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~   76 (468)
                      .+|+|+|.|.-|.+++.-|.+.|    .+|.+++.++.... .....|+..........+..|+|+++  +.|
T Consensus         2 ~~IgfIG~G~Mg~Ai~~gl~~~g~~~~~~I~v~~~~~e~~~~l~~~~g~~~~~~~~~~~~~advv~La--vKP   72 (266)
T COG0345           2 MKIGFIGAGNMGEAILSGLLKSGALPPEEIIVTNRSEEKRAALAAEYGVVTTTDNQEAVEEADVVFLA--VKP   72 (266)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCCHHHHHHHCCEEEEE--ECH
T ss_conf             65899846889999999999668998023898379999999999984985568679887408989998--482


No 385
>PRK08244 hypothetical protein; Provisional
Probab=94.21  E-value=0.082  Score=31.62  Aligned_cols=31  Identities=26%  Similarity=0.359  Sum_probs=29.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             7999836854899999999859869998189
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      -|+|+|.|..|+.+|.+|.++|.+|.+.|+.
T Consensus         4 DVlIVGaGPvGL~lAl~La~~Gv~v~vvEr~   34 (494)
T PRK08244          4 DVIIIGGGPVGLMLASELALAGVRTCVIERL   34 (494)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             9999994789999999999779999999089


No 386
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism]
Probab=94.21  E-value=0.087  Score=31.43  Aligned_cols=32  Identities=41%  Similarity=0.613  Sum_probs=29.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CEEEEEECC
Q ss_conf             87999836854899999999859--869998189
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG--VHVIAWDDH   40 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G--~~V~~~D~~   40 (468)
                      ++|.|+|-|.+|+++|-.|++.+  +++++++..
T Consensus         1 ~~i~IiG~GiaGLsaAy~L~k~~p~~~i~lfE~~   34 (444)
T COG1232           1 MKIAIIGGGIAGLSAAYRLQKAGPDVEVTLFEAD   34 (444)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECC
T ss_conf             9399987828889999999985899867998348


No 387
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins. Amino acid dehydrogenase(DH)-like NAD(P)-binding domains are members of the Rossmann fold superfamily and are found in glutamate, leucine, and phenylalanine DHs (DHs), methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclohydrolase, Shikimate DH-like proteins, malate oxidoreductases, and glutamyl tRNA reductase. Amino acid DHs catalyze the deamination of amino acids to keto acids with NAD(P)+ as a cofactor. The NAD(P)-binding Rossmann fold superfamily includes a wide variety of protein families including NAD(P)- binding domains of alcohol DHs, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate DH, lactate/malate DHs, formate/glycerate DHs, siroheme synthases, 6-phosphogluconate DH, amino acid DHs, repressor rex, NAD-binding potassium channel  domain, CoA-binding, and ornithine cyclodeaminase-like domains. These domains have an al
Probab=94.20  E-value=0.23  Score=28.47  Aligned_cols=36  Identities=31%  Similarity=0.507  Sum_probs=32.2

Q ss_pred             HHHCCCEEEEECCCHHHHHHHHHHHHC-CCEEEEEEC
Q ss_conf             321898799983685489999999985-986999818
Q gi|254781099|r    4 SSFRNHSIAVFGLGRSGLSAACALKDS-GVHVIAWDD   39 (468)
Q Consensus         4 ~~~~~k~v~i~G~G~sG~s~A~~l~~~-G~~V~~~D~   39 (468)
                      .+++++++.|.|.|.-|.++|.+|... +.+|..+|.
T Consensus        19 ~~l~~~~v~v~G~G~vg~~ia~ll~~~~~k~V~~~d~   55 (86)
T cd05191          19 KSLKGKTVVVLGAGEVGKGIAKLLADEGGKKVVLCDR   55 (86)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEECCC
T ss_conf             7756758999778604289999999817970787155


No 388
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity. The LDH-like MDH proteins have a lactate dehyhydrogenase-like (LDH-like) structure and malate dehydrogenase (MDH) enzymatic activity. This subgroup is composed of some archaeal LDH-like MDHs that prefer NADP(H) rather than NAD(H) as a cofactor. One member, MJ0490 from Methanococcus jannaschii, has been observed to form dimers and tetramers during crystalization, although it is believed to exist primarilly as a tetramer in solution. In addition to its MDH activity, MJ0490 also possesses fructose-1,6-bisphosphate-activated LDH activity. Members of this subgroup have a higher sequence similarity to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carbox
Probab=94.18  E-value=0.23  Score=28.53  Aligned_cols=70  Identities=16%  Similarity=0.204  Sum_probs=44.5

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCC--EEEEEECCCHH--H----HHHHH----CC--CEEECCC-CCCCCCCCEEEECCC
Q ss_conf             7999836-8548999999998598--69998189647--8----89997----89--8996453-157225888998888
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGV--HVIAWDDHPCA--V----KQAKD----MG--IEVIDFR-EIPWSIISFLVLSPG   73 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~--~V~~~D~~~~~--~----~~l~~----~g--~~~~~~~-~~~~~~~d~vv~Spg   73 (468)
                      ||.|+|. |.-|.++|-.|..++.  ++..+|.++..  .    ..+..    .+  ..+.... .....+.|.||++.|
T Consensus         2 KV~IiGAaG~VG~~~a~~l~~~~~~~el~LiD~~~~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~~~daDivVitAG   81 (309)
T cd05294           2 KVSIIGASGRVGSATALLLAKEDVVKEINLISRPKSLEKLKGLRLDIYDALAAAGIDAEIKISSDLSDVAGSDIVIITAG   81 (309)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCEEEHHHHCCCCCCCCCCEEEECCCHHHHCCCCEEEECCC
T ss_conf             89999999769999999998379987599960556434231123554503433688767982798899689999998789


Q ss_pred             CCCCCC
Q ss_conf             685675
Q gi|254781099|r   74 IALTGE   79 (468)
Q Consensus        74 i~~~~~   79 (468)
                      +|....
T Consensus        82 ~~rk~g   87 (309)
T cd05294          82 VPRKEG   87 (309)
T ss_pred             CCCCCC
T ss_conf             889959


No 389
>PRK08643 acetoin reductase; Validated
Probab=94.12  E-value=0.47  Score=26.38  Aligned_cols=72  Identities=19%  Similarity=0.196  Sum_probs=46.1

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH----HHHHHCCCEEEC----CCC------------CCCCCCC
Q ss_conf             987999836-8548999999998598699981896478----899978989964----531------------5722588
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEVID----FRE------------IPWSIIS   66 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~----~~l~~~g~~~~~----~~~------------~~~~~~d   66 (468)
                      +|-++|-|- ++-|+++|+.|.+.|++|...|.+....    +++...+.+...    ..+            ..+..+|
T Consensus         2 nKvalVTGg~~GIG~aia~~la~~Ga~V~i~d~~~~~~~~~~~~~~~~~~~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iD   81 (256)
T PRK08643          2 SKVALVTGAGQGIGFAIAKRLVEDGFKVAIVDYNEETAKAAADKLSSDGGKAIAVKADVSNRDQVFDAVQQVVDTFGDLN   81 (256)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             84999957578899999999998799999996988999999999985399099998058999999999999999829987


Q ss_pred             EEEECCCCCCCCC
Q ss_conf             8998888685675
Q gi|254781099|r   67 FLVLSPGIALTGE   79 (468)
Q Consensus        67 ~vv~Spgi~~~~~   79 (468)
                      .+|-.-|+....+
T Consensus        82 iLVNnAG~~~~~~   94 (256)
T PRK08643         82 VVVNNAGLAPTTP   94 (256)
T ss_pred             EEEECCCCCCCCC
T ss_conf             9998998899988


No 390
>pfam00899 ThiF ThiF family. This family contains a repeated domain in ubiquitin activating enzyme E1 and members of the bacterial ThiF/MoeB/HesA family.
Probab=94.12  E-value=0.3  Score=27.73  Aligned_cols=31  Identities=32%  Similarity=0.335  Sum_probs=27.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-EEEEEEC
Q ss_conf             879998368548999999998598-6999818
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV-HVIAWDD   39 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~   39 (468)
                      .||+|+|+|+.|-.+|+.|...|. ++...|.
T Consensus         2 skVlivG~GglG~~~~~~La~~Gvg~i~lvD~   33 (134)
T pfam00899         2 SRVLVVGAGGLGSPAAEYLARAGVGKLTLVDF   33 (134)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             88999898889999999999938974999989


No 391
>PRK06180 short chain dehydrogenase; Provisional
Probab=94.10  E-value=0.35  Score=27.29  Aligned_cols=43  Identities=16%  Similarity=0.122  Sum_probs=34.2

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             8987999836-854899999999859869998189647889997
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      ..|.|+|-|. .+-|+++|+.|.++|++|.++++++..++.+..
T Consensus         3 ~~KvvlITGassGIG~aiA~~l~~~G~~Vi~~~R~~~~l~~l~~   46 (277)
T PRK06180          3 SMKTWLITGVSSGFGRALAQAALAAGHRVVGTVRSAAARRDFEA   46 (277)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             99889991787399999999999879999999899999999998


No 392
>PRK12416 protoporphyrinogen oxidase; Provisional
Probab=94.09  E-value=0.1  Score=30.91  Aligned_cols=32  Identities=25%  Similarity=0.414  Sum_probs=26.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHC------CCEEEEEECC
Q ss_conf             8799983685489999999985------9869998189
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDS------GVHVIAWDDH   40 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~------G~~V~~~D~~   40 (468)
                      |+|.|+|-|.||+++|-+|++.      +++|+.++..
T Consensus         2 k~vaVIGgGISGLsaA~~L~~~~~~~~~~~~vtl~Eas   39 (466)
T PRK12416          2 KTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILVEKE   39 (466)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCCCCCEEEEECC
T ss_conf             75999899789999999998725555899867999779


No 393
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism]
Probab=94.09  E-value=0.09  Score=31.35  Aligned_cols=11  Identities=27%  Similarity=0.498  Sum_probs=4.5

Q ss_pred             EEECCCCCCHH
Q ss_conf             96034575215
Q gi|254781099|r  117 AVTGTNGKSST  127 (468)
Q Consensus       117 ~VTGT~GKTTt  127 (468)
                      -||-+.|.+.+
T Consensus       120 ~V~~~~~~~~~  130 (443)
T COG2072         120 TVTTSDGGTGE  130 (443)
T ss_pred             EEEECCCCCCE
T ss_conf             99964887522


No 394
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=94.08  E-value=0.16  Score=29.53  Aligned_cols=40  Identities=18%  Similarity=0.168  Sum_probs=33.1

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             13218987999836-85489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      |-+|+||.++|-|. ++-|.++|+.|.+.|++|...+.+..
T Consensus         1 m~~L~gK~alVTGas~GIG~aia~~la~~Ga~V~i~~~~~~   41 (254)
T PRK08642          1 MMDISEQIVLVTGGSRGLGAAIARAFAREGARVVVNYHRSE   41 (254)
T ss_pred             CCCCCCCEEEEECHHHHHHHHHHHHHHHCCCEEEEECCCCH
T ss_conf             98989899999781119999999999987999999618988


No 395
>PRK05225 ketol-acid reductoisomerase; Validated
Probab=94.07  E-value=0.23  Score=28.49  Aligned_cols=78  Identities=21%  Similarity=0.296  Sum_probs=53.4

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC------HHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             2189879998368548999999998598699981896------4788999789899645315722588899888868567
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP------CAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~------~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      -+|+|+|.|+|.|--|++-|.=|++.|.+|+.-=+..      .+-......|..+....+.. ..+|+|+.=   -|+ 
T Consensus        34 ~LKgKkI~IiG~GsQG~aqaLNlRDSGldV~~~LR~~si~~k~~Sw~~A~~~Gf~V~t~eeai-~~ADvV~~L---tPD-  108 (489)
T PRK05225         34 YLKGKKIVIVGCGAQGLNQGLNMRDSGLDISYALRKEAIAEKRASWRKATENGFKVGTYEELI-PQADLVVNL---TPD-  108 (489)
T ss_pred             HHCCCEEEEECCCHHHHHHHCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCHHHHH-HCCCEEEEE---CCC-
T ss_conf             752885999803658777652441058856999555303341667999997799646789973-235878870---885-


Q ss_pred             CCCCHHHHHH
Q ss_conf             5578889999
Q gi|254781099|r   79 ENAHWCVKLA   88 (468)
Q Consensus        79 ~~~~~~~~~a   88 (468)
                       +.|+.+...
T Consensus       109 -~q~~~v~~~  117 (489)
T PRK05225        109 -KQHSDVVRA  117 (489)
T ss_pred             -CCHHHHHHH
T ss_conf             -514899999


No 396
>KOG0022 consensus
Probab=94.04  E-value=0.17  Score=29.35  Aligned_cols=99  Identities=10%  Similarity=0.053  Sum_probs=51.7

Q ss_pred             CCCCEEECCCCCCCHHHHHHHHHCCC---CCCEEEECCC--CCCCCHHHHHHHHCCCCEEEEECC-----CHHHHHHH-H
Q ss_conf             34300000235567555555320133---3200120321--012206898998427868999889-----98998886-3
Q gi|254781099|r  322 LGHVIFINDSKATNLHSVIHAFLNEK---RRIYWIAGGL--SKSDDFSTLFPFISKIAKAYFIGN-----SAMLFFHH-F  390 (468)
Q Consensus       322 ~~gv~iIDDS~atnp~a~~~Al~~~~---~~i~lI~GG~--~K~~d~~~L~~~~~~~~~~~liG~-----~~~~i~~~-~  390 (468)
                      .+|+.|=-+-. -|++.+.+|+++-.   +..+ ++|=.  .+....+++--.-.|..+--++|-     +.+.+.+. +
T Consensus       260 dgGvDysfEc~-G~~~~m~~al~s~h~GwG~sv-~iGv~~a~~~i~~~p~~l~~GR~~~Gs~FGG~K~~~~iP~lV~~y~  337 (375)
T KOG0022         260 DGGVDYSFECI-GNVSTMRAALESCHKGWGKSV-VIGVAAAGQEISTRPFQLVTGRTWKGSAFGGFKSKSDIPKLVKDYM  337 (375)
T ss_pred             CCCCEEEEEEC-CCHHHHHHHHHHHHCCCCEEE-EEEECCCCCCCCCCHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             68720899955-898999999997305877599-9975478862211666622243798873256461444569999997


Q ss_pred             HCCCCEEEECCHHHHHHHHHHHHHHCCCCCEE
Q ss_conf             16898899879999999999999844898599
Q gi|254781099|r  391 GGKINSTLSKTLDQALKSVVRDVENVQLPSIV  422 (468)
Q Consensus       391 ~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiV  422 (468)
                      +++.+...+.+.+--.+.|.++.+.+.+|..+
T Consensus       338 ~~~l~ld~~ITh~l~f~~In~AF~ll~~Gk~i  369 (375)
T KOG0022         338 KKKLNLDEFITHELPFEEINKAFDLLHEGKSI  369 (375)
T ss_pred             HCCCCHHHHHHCCCCHHHHHHHHHHHHCCCEE
T ss_conf             37555325533466789989999998579667


No 397
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]
Probab=94.03  E-value=0.12  Score=30.53  Aligned_cols=91  Identities=25%  Similarity=0.383  Sum_probs=58.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHH
Q ss_conf             98799983685489999999985986999818964788999789899645315722588899888868567557888999
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKL   87 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~   87 (468)
                      .+.++|+|=|.+|+.+|.-|.+.|++|.....+|..--+.....      .-+|..++...+.+|-+..          -
T Consensus       124 ~~svLVIGGGvAGitAAl~La~~G~~v~LVEKepsiGGrmak~~------k~FP~~dcs~C~LaP~m~~----------v  187 (622)
T COG1148         124 SKSVLVIGGGVAGITAALELADMGFKVYLVEKEPSIGGRMAKLN------KTFPTNDCSICILAPKMVE----------V  187 (622)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHH------CCCCCCCCCHHHCCCHHHH----------H
T ss_conf             05359986848989999999975980899941786450477652------3078755323213302333----------1


Q ss_pred             HHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHH
Q ss_conf             99769809983034223343015688689960345752157
Q gi|254781099|r   88 ANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTV  128 (468)
Q Consensus        88 a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~  128 (468)
                      ...-++++++..              .|--|.|+.|+=|++
T Consensus       188 ~~hp~i~l~Tya--------------eV~ev~G~vGnF~vk  214 (622)
T COG1148         188 SNHPNIELITYA--------------EVEEVSGSVGNFTVK  214 (622)
T ss_pred             CCCCCEEEEEEE--------------EEEEECCCCCCEEEE
T ss_conf             258861465422--------------465303543534788


No 398
>PRK12921 2-dehydropantoate 2-reductase; Provisional
Probab=94.02  E-value=0.29  Score=27.79  Aligned_cols=46  Identities=22%  Similarity=0.337  Sum_probs=37.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC
Q ss_conf             79998368548999999998598699981896478899978989964
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID   56 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~   56 (468)
                      ||+|+|.|--|.-.|-+|.+.|++|+..- ++...+.+...|+.+..
T Consensus         2 kI~I~GaGAiG~~~a~~L~~~g~~V~lv~-r~~~~~~i~~~Gl~i~~   47 (306)
T PRK12921          2 KIAVVGAGAVGGTFGARLLEAGRDVTFLG-RSARAEALREKGLVIRS   47 (306)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEEE-ECCHHHHHHHCCEEEEE
T ss_conf             89999924999999999983699889997-00099999978969997


No 399
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional
Probab=93.99  E-value=0.1  Score=30.94  Aligned_cols=32  Identities=28%  Similarity=0.350  Sum_probs=29.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             87999836854899999999859869998189
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      --|.|+|.|..|+.+|..|.++|++|.+.|.+
T Consensus         4 ~DV~IvGaG~vGl~lAl~La~~G~~V~iiE~~   35 (384)
T PRK08849          4 YDIAVVGGGMVGAATAIGFAKQGRSVAVIEGF   35 (384)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             89999992499999999999579959999689


No 400
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed
Probab=93.95  E-value=0.49  Score=26.28  Aligned_cols=69  Identities=14%  Similarity=0.185  Sum_probs=46.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCC----EEEEEECCC-HHHHHHHH-CCCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             89879998368548999999998598----699981896-47889997-8989964531572258889988886856
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGV----HVIAWDDHP-CAVKQAKD-MGIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~----~V~~~D~~~-~~~~~l~~-~g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      +++||+|+|.|.=|.++++-|.+.+.    ++..+++.. ...+.+.. .++..........+.+|+|++.  ++|.
T Consensus         3 ~~~kI~fIG~GnMg~Aii~gll~~~~~~~~~i~v~~~~~~~~~~~l~~~~~i~~~~~~~~~~~~~d~Iila--vKP~   77 (245)
T PRK07634          3 TKHRILFIGAGRMAEAIFSGLLKTSKEYIEEIIVSNRSNVEKLDQLQARYNVSTTTDWKQHVTSVDTIVLA--MPPS   77 (245)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHCCCEECCCHHHHHHHCCEEEEE--ECCH
T ss_conf             99919998758999999999997799996059996999999999999971974227779998559999999--8917


No 401
>PRK08132 hypothetical protein; Provisional
Probab=93.92  E-value=0.1  Score=30.90  Aligned_cols=32  Identities=38%  Similarity=0.584  Sum_probs=29.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|+|+|.|.+|+.+|.+|..+|..|.+.|+.+
T Consensus        25 pVlIVGaGPvGL~lA~~L~~~Gv~~~vvEr~~   56 (549)
T PRK08132         25 PVVVVGAGPVGLALAIDLAQQGVPVVLLDDDD   56 (549)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             99999925799999999998799999995999


No 402
>PRK13869 plasmid-partitioning protein RepA; Provisional
Probab=93.92  E-value=0.045  Score=33.39  Aligned_cols=34  Identities=38%  Similarity=0.490  Sum_probs=30.6

Q ss_pred             CCCEEEEE---CCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             88689960---34575215789999998731000000
Q gi|254781099|r  112 QSPFIAVT---GTNGKSSTVALISHVLRKNGYDVQLG  145 (468)
Q Consensus       112 ~~~vI~VT---GT~GKTTt~~ll~~iL~~~g~~~~~~  145 (468)
                      +.+||+|.   |=.|||||+--|++.|...|++|.++
T Consensus       120 ~~kVIaVaN~KGGVGKTTtav~LA~~LA~~G~RVLlI  156 (405)
T PRK13869        120 HLQVIAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAV  156 (405)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9828999788877659999999999999779988999


No 403
>PRK09422 alcohol dehydrogenase; Provisional
Probab=93.92  E-value=0.27  Score=28.00  Aligned_cols=12  Identities=0%  Similarity=-0.000  Sum_probs=7.5

Q ss_pred             HHHHHHCCCCCC
Q ss_conf             111000011221
Q gi|254781099|r  197 HHTLENYVNIKK  208 (468)
Q Consensus       197 ~~s~e~y~~aK~  208 (468)
                      .|++.+|.....
T Consensus       115 ~G~~AEy~~v~~  126 (338)
T PRK09422        115 DGGMAEQCIVTA  126 (338)
T ss_pred             CCCCEEEEECCH
T ss_conf             875544411253


No 404
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins. This family includes classical ubiquitin-activating enzymes E1, ubiquitin-like (ubl) activating enzymes and other mechanistic homologes, like MoeB, Thif1 and others. The common reaction mechanism catalyzed by MoeB, ThiF and the E1 enzymes begins with a nucleophilic attack of the C-terminal carboxylate of MoaD, ThiS and ubiquitin, respectively, on the alpha-phosphate of an ATP molecule bound at the active site of the activating enzymes, leading to the formation of a high-energy acyladenylate intermediate and subsequently to the formation of a thiocarboxylate at the C termini of MoaD and ThiS.
Probab=93.91  E-value=0.25  Score=28.24  Aligned_cols=31  Identities=32%  Similarity=0.414  Sum_probs=26.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC-EEEEEECC
Q ss_conf             79998368548999999998598-69998189
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV-HVIAWDDH   40 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~   40 (468)
                      ||+|+|+|+.|-.+|+.|...|. ++...|..
T Consensus         1 kVlivG~GglG~~va~~L~~~Gv~~i~ivD~D   32 (143)
T cd01483           1 RVLLVGLGGLGSEIALNLARSGVGKITLIDFD   32 (143)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             99999979899999999999379719999789


No 405
>PRK07102 short chain dehydrogenase; Provisional
Probab=93.87  E-value=0.19  Score=29.03  Aligned_cols=39  Identities=10%  Similarity=0.129  Sum_probs=32.5

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             87999836-8548999999998598699981896478899
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      |+|+|-|. ++-|.++|+.|.++|++|..++++...++++
T Consensus         2 K~vlITGassGIG~a~A~~la~~G~~v~l~~R~~~~l~~~   41 (243)
T PRK07102          2 KKILIIGATSDIARACARRYAAAGARLYLAARDTERLERI   41 (243)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             9799915745999999999998799899998988999999


No 406
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=93.86  E-value=0.17  Score=29.49  Aligned_cols=40  Identities=25%  Similarity=0.204  Sum_probs=33.1

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             13218987999836-85489999999985986999818964
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      +-+|+||.++|-|- ++-|+++|+.|.+.|++|.++|.++.
T Consensus         4 ~~~L~gKvalVTGgs~GIG~aia~~la~~Ga~V~~~d~~~~   44 (266)
T PRK06171          4 WLNLQGKIIIVTGGSSGIGLAIVEELLAQGANVQMVDIHGG   44 (266)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             63899997999477878999999999987999999978853


No 407
>PRK11259 solA N-methyltryptophan oxidase; Provisional
Probab=93.86  E-value=0.1  Score=30.89  Aligned_cols=32  Identities=31%  Similarity=0.509  Sum_probs=29.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|.|+|-|..|+|+|-.|.++|.+|.+.|+..
T Consensus         5 DVvVIGaGi~G~s~A~~La~~G~~V~vle~~~   36 (377)
T PRK11259          5 DVIVIGLGSMGSAAGYYLARAGLRVLGIDRFM   36 (377)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCEEEECCCC
T ss_conf             89999952999999999997899599992899


No 408
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.85  E-value=0.23  Score=28.56  Aligned_cols=38  Identities=11%  Similarity=0.080  Sum_probs=31.3

Q ss_pred             HHCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEECCCH
Q ss_conf             2189879998368---5489999999985986999818964
Q gi|254781099|r    5 SFRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDDHPC   42 (468)
Q Consensus         5 ~~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~~~~   42 (468)
                      -|+||+++|-|.|   +-|.++|+.|.+.|++|..++++..
T Consensus         4 ~L~GK~alITGaa~~~GIG~aiA~~La~~GA~V~i~~~~e~   44 (271)
T PRK06505          4 LMQGKRGLIMGVANDHSIAWGIAKQLAAQGAELAFTYQGDA   44 (271)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             57999799979999854999999999986999999818668


No 409
>PRK08774 consensus
Probab=93.83  E-value=0.12  Score=30.58  Aligned_cols=32  Identities=31%  Similarity=0.380  Sum_probs=29.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|.|+|-|..|+++|..|.+.|.+|...|..|
T Consensus         6 DVlIVGgGpvGl~lA~~La~~G~~v~liE~~~   37 (402)
T PRK08774          6 DVLIVGGGLVGSSLAIALDRIGLDVGLVEATP   37 (402)
T ss_pred             CEEEECCCHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             78999916999999999966899789993799


No 410
>PRK07791 short chain dehydrogenase; Provisional
Probab=93.83  E-value=0.53  Score=26.02  Aligned_cols=37  Identities=24%  Similarity=0.328  Sum_probs=31.8

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             13218987999836-85489999999985986999818
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~   39 (468)
                      |..|+||.++|-|- ++-|+++|+.|.+.|++|...|.
T Consensus         1 Mg~L~GKvalVTGas~GIG~aiA~~lA~~GA~Vvi~D~   38 (285)
T PRK07791          1 MGLLDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDI   38 (285)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             99889987999286768999999999986999999837


No 411
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223   This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum. In Escherichia coli, the cell division site is determined by the cooperative activity of min operon products MinC, MinD, and MinE . MinD is a membrane-associated ATPase and is a septum site-determining factor through the activation and regulation of MinC and MinE. MinD is also known to undergo a rapid pole-to-pole oscillation movement in vivo as observed by fluorescent microscopy. In plants, chloroplast division requires the dimerisation of stromal MinD . The homologous archaeal MinD proteins, with many archaeal genomes having two or more forms, are described by a separate model.; GO: 0016887 ATPase activity, 0000918 selection of site for barrier septum formation.
Probab=93.78  E-value=0.057  Score=32.74  Aligned_cols=36  Identities=36%  Similarity=0.489  Sum_probs=25.8

Q ss_pred             CEEEEE---CCCCCCHHHHHHHHHHHHHHHHCCCC-CCCC
Q ss_conf             689960---34575215789999998731000000-0124
Q gi|254781099|r  114 PFIAVT---GTNGKSSTVALISHVLRKNGYDVQLG-GNIG  149 (468)
Q Consensus       114 ~vI~VT---GT~GKTTt~~ll~~iL~~~g~~~~~~-GNiG  149 (468)
                      ++|-||   |=.||||||+=|+.-|-..|++|.+. ..||
T Consensus         2 ~viViTSGKGGVGKTTtTANlG~aLA~lG~kVvliD~DiG   41 (272)
T TIGR01968         2 RVIVITSGKGGVGKTTTTANLGTALARLGKKVVLIDADIG   41 (272)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             5899981788977358989999999961982899954757


No 412
>PRK10206 putative dehydrogenase; Provisional
Probab=93.78  E-value=0.32  Score=27.52  Aligned_cols=87  Identities=15%  Similarity=0.100  Sum_probs=51.5

Q ss_pred             CEEEEECCCHHHHHH-HHHHHH-C-CCEEEEEECCCHHH-HHHHHCC-CEEEC-CCCCC-CCCCCEEEECCCCCCCCCCC
Q ss_conf             879998368548999-999998-5-98699981896478-8999789-89964-53157-22588899888868567557
Q gi|254781099|r    9 HSIAVFGLGRSGLSA-ACALKD-S-GVHVIAWDDHPCAV-KQAKDMG-IEVID-FREIP-WSIISFLVLSPGIALTGENA   81 (468)
Q Consensus         9 k~v~i~G~G~sG~s~-A~~l~~-~-G~~V~~~D~~~~~~-~~l~~~g-~~~~~-~~~~~-~~~~d~vv~Spgi~~~~~~~   81 (468)
                      -||+|+|.|++|.-. +-++.+ . .+.|.+++++.+.. ...+..+ +.+.. +.+.. ..++|+|+++-  | + ...
T Consensus         3 irvaiiG~G~~~~~fH~P~i~~~~~~~~v~~v~~~~~~~~~~a~~~~~~~~~~~~~~ll~~~~id~V~i~t--P-~-~~H   78 (345)
T PRK10206          3 INCAFIGFGKSTTRYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIYSHIHFTSDLDEVLNDPDVKLVVVCT--H-A-DSH   78 (345)
T ss_pred             EEEEEECCCHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHCCCCCEECCHHHHHCCCCCCEEEECC--C-C-HHH
T ss_conf             47999926499999989999638995799999788761888887769981228999995499999999879--9-5-789


Q ss_pred             CHHHHHHHHCCCEEEEEH
Q ss_conf             888999997698099830
Q gi|254781099|r   82 HWCVKLANQFNVEIIGDI   99 (468)
Q Consensus        82 ~~~~~~a~~~gi~v~s~~   99 (468)
                      .+...+|.+.|+.|+.|-
T Consensus        79 ~~~a~~al~aGkhV~~EK   96 (345)
T PRK10206         79 FEYAKRALEAGKNVLVEK   96 (345)
T ss_pred             HHHHHHHHHCCCCEEEEC
T ss_conf             999999997899289803


No 413
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a member of the SIS (Sugar ISomerase domain) superfamily. In the ribulose monophosphate pathway of formaldehyde fixation, hexulose-6-phosphate synthase catalyzes the condensation of ribulose-5-phosphate with formadelhyde to become hexulose-6-phosphate, which is then isomerized to fructose-6-phosphate by PHI.
Probab=93.77  E-value=0.31  Score=27.59  Aligned_cols=72  Identities=22%  Similarity=0.277  Sum_probs=38.6

Q ss_pred             CCCEEEEECCCHHHHHH---HHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             89879998368548999---999998598699981896478899978989964531572258889988886856755788
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSA---ACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHW   83 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~---A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~   83 (468)
                      +.++|.++|+|.||+.+   +.-|...|..+....+-.                 ......-|++|.-.+ +=..++...
T Consensus        32 ~a~~I~~~G~G~Sg~va~~~a~rl~~lG~~~~~~~d~~-----------------~~~i~~~Dv~I~iS~-SG~T~~~~~   93 (179)
T cd05005          32 NAKRIFVYGAGRSGLVAKAFAMRLMHLGLNVYVVGETT-----------------TPAIGPGDLLIAISG-SGETSSVVN   93 (179)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEECCCC-----------------CCCCCCCCEEEEECC-CCCCHHHHH
T ss_conf             49948999856258779999999973598012435655-----------------577999999999819-999568999


Q ss_pred             HHHHHHHCCCEEE
Q ss_conf             8999997698099
Q gi|254781099|r   84 CVKLANQFNVEII   96 (468)
Q Consensus        84 ~~~~a~~~gi~v~   96 (468)
                      .++.|+++|.+|+
T Consensus        94 ~~~~aK~~ga~iI  106 (179)
T cd05005          94 AAEKAKKAGAKVV  106 (179)
T ss_pred             HHHHHHHCCCEEE
T ss_conf             9999998799199


No 414
>TIGR00936 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-adenosyl-L-homocysteine hydrolase (3.3.1.1 from EC) (AdoHcyase) is an enzyme of the activated methyl cycle, responsible for the reversible hydration of S-adenosyl-L-homocysteine into adenosine and homocysteine. AdoHcyase is an ubiquitous enzyme which binds and requires NAD^+ as a cofactor. AdoHcyase is a highly conserved protein  of about 430 to 470 amino acids. The family contains a glycine-rich region in the central part of AdoHcyase; a region thought to be involved in NAD-binding.; GO: 0004013 adenosylhomocysteinase activity, 0006730 one-carbon compound metabolic process.
Probab=93.74  E-value=0.23  Score=28.55  Aligned_cols=53  Identities=23%  Similarity=0.246  Sum_probs=31.4

Q ss_pred             HCCCEEEE-ECCCHHHHHHHHHHHHCCCEEEEEECCCHHH-----HHHHH-CCCEEECCC
Q ss_conf             18987999-8368548999999998598699981896478-----89997-898996453
Q gi|254781099|r    6 FRNHSIAV-FGLGRSGLSAACALKDSGVHVIAWDDHPCAV-----KQAKD-MGIEVIDFR   58 (468)
Q Consensus         6 ~~~k~v~i-~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~-----~~l~~-~g~~~~~~~   58 (468)
                      |+|.+|.- +=+-..---+++-|.+.|++|..+--||-+.     ..+.. .|+.++..+
T Consensus        39 l~G~~i~~cLH~~~~Ta~L~~TL~~~GAEv~~~~cNplSTQDdvaAA~~~~~G~~vyA~r   98 (422)
T TIGR00936        39 LKGVRIAACLHLTVKTAVLIETLKAGGAEVALTACNPLSTQDDVAAALAKAAGIPVYAWR   98 (422)
T ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEE
T ss_conf             775276424321488999999998519748874478877456899999862695288851


No 415
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism]
Probab=93.72  E-value=0.38  Score=27.01  Aligned_cols=50  Identities=20%  Similarity=0.241  Sum_probs=38.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCC
Q ss_conf             879998368548999999998598699981896478899978989964531
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFRE   59 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~   59 (468)
                      .||+|+|.|--|--.+-.|.+.|+.|+..-+. .....+.+.|+.+.+...
T Consensus         1 mkI~IlGaGAvG~l~g~~L~~~g~~V~~~~R~-~~~~~l~~~GL~i~~~~~   50 (307)
T COG1893           1 MKILILGAGAIGSLLGARLAKAGHDVTLLVRS-RRLEALKKKGLRIEDEGG   50 (307)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEECH-HHHHHHHHCCEEEEECCC
T ss_conf             95999878789999999998589957998108-999999878979981688


No 416
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.71  E-value=0.22  Score=28.72  Aligned_cols=39  Identities=18%  Similarity=0.106  Sum_probs=32.1

Q ss_pred             CHHHCCCEEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             13218987999836-8--548999999998598699981896
Q gi|254781099|r    3 LSSFRNHSIAVFGL-G--RSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G--~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |..|+||+++|-|. +  +-|.++|+.|.++|++|..++...
T Consensus         1 Mg~L~GK~~lVTG~a~~~GIG~aiA~~la~~Ga~V~~~~~~~   42 (260)
T PRK06997          1 MGFLAGKRILLTGLLSNRSIAYGIAKACKREGAELAFTYVGD   42 (260)
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCH
T ss_conf             998999889998998872899999999998599999980880


No 417
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=93.70  E-value=0.56  Score=25.87  Aligned_cols=51  Identities=20%  Similarity=0.250  Sum_probs=38.7

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH-HHHHHHHCCCEE
Q ss_conf             3218987999836-85489999999985986999818964-788999789899
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC-AVKQAKDMGIEV   54 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~-~~~~l~~~g~~~   54 (468)
                      ..|+||.+.|-|- ++-|+++|+.|.+.|++|...+.+.. ..+.++..+...
T Consensus         3 grL~gKvalVTGas~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~   55 (254)
T PRK06463          3 GKFKGKVALITGGSRGIGRAIAEKFLKEGAKVAILYNSSEDKAKELKEKGVET   55 (254)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHCCCEE
T ss_conf             75698989994847789999999999889999996499789999998669889


No 418
>PRK06947 glucose-1-dehydrogenase; Provisional
Probab=93.67  E-value=0.28  Score=27.93  Aligned_cols=52  Identities=13%  Similarity=0.095  Sum_probs=37.9

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC-HH----HHHHHHCCCEE
Q ss_conf             13218987999836-8548999999998598699981896-47----88999789899
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP-CA----VKQAKDMGIEV   54 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~-~~----~~~l~~~g~~~   54 (468)
                      |+++.+|.+.|-|. ++-|+++|+.|.++|++|...+.+. ..    ...++..+.+.
T Consensus         1 m~~~~~KvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~   58 (252)
T PRK06947          1 MTNSDRKVVLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRA   58 (252)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCE
T ss_conf             9999990899938835899999999998799899980898789999999999649928


No 419
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed
Probab=93.65  E-value=0.28  Score=27.98  Aligned_cols=66  Identities=11%  Similarity=0.059  Sum_probs=47.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC---EEEEEECCCHHHHHHHHCC--CEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             79998368548999999998598---6999818964788999789--89964531572258889988886856
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV---HVIAWDDHPCAVKQAKDMG--IEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~---~V~~~D~~~~~~~~l~~~g--~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      ||+|+|.|.=|.++++-|.+.|+   ++.++|+++.....+....  +.+........+..|+||++  |.|.
T Consensus         2 kIgfIG~GnMg~Aii~Gl~~~~~~~~~i~v~~r~~~~~~~l~~~~~~v~~~~~n~~~~~~~dvi~La--VKP~   72 (255)
T PRK06476          2 RIGFIGTGAITEAMVTGLLSSPADVSEIIVSPRNAQIAARLAARFAKVRIAKDNQAVVDRSDVVFLA--VRPQ   72 (255)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHCCCEEEECCHHHHHHHCCEEEEE--ECHH
T ss_conf             8999864699999999999788992508898989899999998769559857889998518878886--1788


No 420
>PRK11579 putative oxidoreductase; Provisional
Probab=93.65  E-value=0.42  Score=26.70  Aligned_cols=88  Identities=15%  Similarity=0.131  Sum_probs=51.9

Q ss_pred             CCCEEEEECCCHHHHH-HHHHHHH-CCCEEEE-EECCCHHHHHHHHCCCEEECCCCCC--CCCCCEEEECCCCCCCCCCC
Q ss_conf             8987999836854899-9999998-5986999-8189647889997898996453157--22588899888868567557
Q gi|254781099|r    7 RNHSIAVFGLGRSGLS-AACALKD-SGVHVIA-WDDHPCAVKQAKDMGIEVIDFREIP--WSIISFLVLSPGIALTGENA   81 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s-~A~~l~~-~G~~V~~-~D~~~~~~~~l~~~g~~~~~~~~~~--~~~~d~vv~Spgi~~~~~~~   81 (468)
                      +.-||+|+|.|..|.. -+..+.. .|.+|.+ +|.++... +....++..+.-.+..  ...+|.|++.-  |+  ..-
T Consensus         3 ~~irvgiiG~G~~~~~~h~~~~~~~~~~~l~av~d~~~~~~-~a~~~~~~~~~~~~~ll~~~~id~V~i~t--p~--~~H   77 (346)
T PRK11579          3 DKIRVGLIGYGYASKTFHAPLIAGTPGLELAAVSSSDETKV-KADWPTVTVVSEPKHLFNDPNIDLIVIPT--PN--DTH   77 (346)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCHHHH-HCCCCCCCEECCHHHHHCCCCCCEEEECC--CC--HHH
T ss_conf             88759999362999999999996299919999979899999-50258995389999994599999999979--96--789


Q ss_pred             CHHHHHHHHCCCEEEEEH
Q ss_conf             888999997698099830
Q gi|254781099|r   82 HWCVKLANQFNVEIIGDI   99 (468)
Q Consensus        82 ~~~~~~a~~~gi~v~s~~   99 (468)
                      .+...+|.+.|+.|+-|-
T Consensus        78 ~~~~~~al~aGkhv~~EK   95 (346)
T PRK11579         78 FPLAKAALEAGKHVVVDK   95 (346)
T ss_pred             HHHHHHHHHCCCCEEECC
T ss_conf             999999998799489538


No 421
>pfam00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.
Probab=93.65  E-value=0.26  Score=28.13  Aligned_cols=32  Identities=31%  Similarity=0.375  Sum_probs=29.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ||.|+|-|-.|+-+|.+|.+.|.+|+..+..+
T Consensus         1 rv~iiGgG~ig~E~A~~l~~~G~~Vtiie~~~   32 (82)
T pfam00070         1 RVVVVGGGYIGLEFASALAKLGSKVTVVERRD   32 (82)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             99999988999999999986392789981257


No 422
>PRK00048 dihydrodipicolinate reductase; Provisional
Probab=93.65  E-value=0.38  Score=27.01  Aligned_cols=83  Identities=18%  Similarity=0.222  Sum_probs=44.3

Q ss_pred             CEEEEECC-CHHHHHHHHHHHH-CCCEEEE-EECCCHH--------HHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             87999836-8548999999998-5986999-8189647--------8899978989964531572258889988886856
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKD-SGVHVIA-WDDHPCA--------VKQAKDMGIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~-~G~~V~~-~D~~~~~--------~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      -||+|.|. |+-|..+++.+.+ .++++++ +|.....        ....+..++.+.+.-+.....+|+||=     ..
T Consensus         3 ikI~i~Ga~GrMG~~i~~~i~~~~~~~l~~~i~~~~~~~~g~~~~~~~~~~~~~~~~~~~l~~~~~~~DVvID-----FS   77 (265)
T PRK00048          3 IKVGVAGASGRMGRELIEAVEAAEDLELVAALDRPGSPLVGQDAGELAGLGKLGVPITDDLEAVLDDFDVLID-----FT   77 (265)
T ss_pred             EEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHCCCCCCCCEECCCHHHHHCCCCEEEE-----CC
T ss_conf             5999988888779999999986899799999946897233653566527676784311789886055998998-----99


Q ss_pred             CCCC-CHHHHHHHHCCCEEE
Q ss_conf             7557-888999997698099
Q gi|254781099|r   78 GENA-HWCVKLANQFNVEII   96 (468)
Q Consensus        78 ~~~~-~~~~~~a~~~gi~v~   96 (468)
                      .|+. ...+..+.+.++|++
T Consensus        78 ~p~~~~~~~~~~~~~~~~~V   97 (265)
T PRK00048         78 TPEATLENLEFALEHGKPLV   97 (265)
T ss_pred             CHHHHHHHHHHHHHCCCCEE
T ss_conf             88999999999997499779


No 423
>TIGR01035 hemA glutamyl-tRNA reductase; InterPro: IPR000343   Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway . The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin .   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.   The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.   Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) .   This entry represents glutamyl-tRNA reductase (1.2.1.70 from EC), which reduces glutamyl-tRNA to glutamate-1-semialdehyde during the first stage of tetrapyrrole biosynthesis by the C5 pathway , . This enzyme required NADPH as a coenzyme.; GO: 0008883 glutamyl-tRNA reductase activity, 0050661 NADP binding, 0033014 tetrapyrrole biosynthetic process.
Probab=93.63  E-value=0.29  Score=27.80  Aligned_cols=67  Identities=19%  Similarity=0.305  Sum_probs=37.7

Q ss_pred             HCCCEEEEECCCHHHHHHHHHHHHCC-CEEEEEECCCHHHH-HHHHCCC-EEECCCC-------CCCCCCCEEEECC
Q ss_conf             18987999836854899999999859-86999818964788-9997898-9964531-------5722588899888
Q gi|254781099|r    6 FRNHSIAVFGLGRSGLSAACALKDSG-VHVIAWDDHPCAVK-QAKDMGI-EVIDFRE-------IPWSIISFLVLSP   72 (468)
Q Consensus         6 ~~~k~v~i~G~G~sG~s~A~~l~~~G-~~V~~~D~~~~~~~-~l~~~g~-~~~~~~~-------~~~~~~d~vv~Sp   72 (468)
                      +++++++|+|+|.-|-=+|+.|+.+| .+|.+.-+.-...+ -.+..+- ....+.+       .-+..+|.||-|-
T Consensus       183 L~~~~~LliGAGeMg~Lva~~L~~~~v~~~~i~NRt~~rA~~LA~e~~~P~~~~f~~La~~~L~~~L~~~DivissT  259 (436)
T TIGR01035       183 LKGKKVLLIGAGEMGELVAKHLREKGVGKVLIANRTYERAEKLAKELGGPEAVKFEALALEKLEEALAEADIVISST  259 (436)
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEC
T ss_conf             16641899827457999999996489528988556778999999870786645444554899999974288999855


No 424
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.57  E-value=0.59  Score=25.72  Aligned_cols=49  Identities=16%  Similarity=0.191  Sum_probs=35.7

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC-H----HHHHHHHCCCEE
Q ss_conf             18987999836-8548999999998598699981896-4----788999789899
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP-C----AVKQAKDMGIEV   54 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~-~----~~~~l~~~g~~~   54 (468)
                      |+||.+.|-|- ++-|.++|+.|.+.|++|...+.+. .    ..++++..|.+.
T Consensus         2 L~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~~~~~~~~~~~~~g~~~   56 (250)
T PRK08063          2 FSGKVALVTGSSRGIGKAIALRLAKEGYDIAINYARSRKAAEETANEIEQLGRKA   56 (250)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHCCCCE
T ss_conf             8949899958766999999999998899899975999899999999999549958


No 425
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]
Probab=93.53  E-value=0.18  Score=29.26  Aligned_cols=35  Identities=29%  Similarity=0.399  Sum_probs=31.5

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ...+|.|+|-|.+|.++|-+|.+.|.+|+..|...
T Consensus         3 ~~~~vvIIGgGi~Gls~A~~La~~G~~V~vie~~~   37 (387)
T COG0665           3 MKMDVVIIGGGIVGLSAAYYLAERGADVTVLEAGE   37 (387)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             76439998986999999999997699199991798


No 426
>PRK11557 putative DNA-binding transcriptional regulator; Provisional
Probab=93.51  E-value=0.6  Score=25.65  Aligned_cols=13  Identities=23%  Similarity=0.069  Sum_probs=5.4

Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999863
Q gi|254781099|r  439 ERGFSFMSQVSEI  451 (468)
Q Consensus       439 ~RG~~F~~~v~~l  451 (468)
                      ||=++-+++|++|
T Consensus       269 e~l~~~~~~i~~l  281 (282)
T PRK11557        269 ERIRHSEALVKKL  281 (282)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999974


No 427
>PRK07190 hypothetical protein; Provisional
Probab=93.40  E-value=0.14  Score=29.95  Aligned_cols=32  Identities=22%  Similarity=0.410  Sum_probs=29.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      -|+|+|.|..|+.+|..|..+|.+|.+.|+.+
T Consensus         7 DVlIVGaGPvGL~lA~~La~~Gv~v~VlEr~~   38 (480)
T PRK07190          7 DVVIVGAGPVGLMCAYLGQRCGINTVIVDKSD   38 (480)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             48999938899999999988799999996999


No 428
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated
Probab=93.36  E-value=0.18  Score=29.31  Aligned_cols=33  Identities=33%  Similarity=0.527  Sum_probs=29.8

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             987999836854899999999859869998189
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      +--|.|+|.|.+|+.+|..|.+.|++|.+.|.+
T Consensus         4 ~~DV~IvGaGp~Gl~lA~~La~~G~~v~viE~~   36 (405)
T PRK08850          4 SVDVAIIGGGMVGLALAAALKDSDLRIAVIEGQ   36 (405)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             876899991589999999998589978999379


No 429
>PRK08013 hypothetical protein; Provisional
Probab=93.36  E-value=0.15  Score=29.78  Aligned_cols=34  Identities=32%  Similarity=0.600  Sum_probs=30.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9879998368548999999998598699981896
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      +--|.|+|.|..|+.+|..|.+.|++|.+.|.++
T Consensus         3 ~~DV~IvGaGpvGl~lA~~La~~G~~v~viE~~~   36 (400)
T PRK08013          3 SVDVAIVGGGMVGLAVACGLQGSGLRVAVLEHRV   36 (400)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             6788999935999999999971899589991899


No 430
>PRK10262 thioredoxin reductase; Provisional
Probab=93.27  E-value=0.15  Score=29.75  Aligned_cols=38  Identities=13%  Similarity=0.306  Sum_probs=33.3

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             13218987999836854899999999859869998189
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |++-|+-.|.|+|-|-.|+++|-++..+|.++...|..
T Consensus         1 m~~~k~~dviIIG~GPAGLsAA~~a~r~g~~~~lie~~   38 (321)
T PRK10262          1 MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGM   38 (321)
T ss_pred             CCCCEEEEEEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             99860600999997689999999999869967999605


No 431
>PRK08264 short chain dehydrogenase; Validated
Probab=93.21  E-value=0.29  Score=27.85  Aligned_cols=37  Identities=22%  Similarity=0.231  Sum_probs=28.6

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCE-EEEEECCC
Q ss_conf             218987999836-85489999999985986-99981896
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVH-VIAWDDHP   41 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~-V~~~D~~~   41 (468)
                      +|+||.+.|-|. .+-|.++|+.|.++|+. |....+++
T Consensus         2 ~l~gK~alITGassGIG~aiA~~la~~Ga~~V~~~~r~~   40 (235)
T PRK08264          2 DIKGKVVLVTGANRGIGRAFVEELLARGAAKVYAAARDP   40 (235)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCH
T ss_conf             279988999267549999999999986997799972784


No 432
>PRK08040 putative semialdehyde dehydrogenase; Provisional
Probab=93.19  E-value=0.25  Score=28.32  Aligned_cols=87  Identities=18%  Similarity=0.222  Sum_probs=55.0

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCC---EEEEEECCCHHHHHHHH--CCCEEECCCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             8987999836-8548999999998598---69998189647889997--8989964531572258889988886856755
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDSGV---HVIAWDDHPCAVKQAKD--MGIEVIDFREIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~G~---~V~~~D~~~~~~~~l~~--~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      ++-+|+|+|. |+-|+.+.++|.++.+   ++.........-+..+-  ..+.+.+..+..+...|+++.+-|-..    
T Consensus         3 ~~~~VaivGATG~VGq~~l~lL~e~~fp~~~l~~laS~~SaGk~i~~~~~~~~v~~~~~~~~~~~di~ff~a~~~~----   78 (337)
T PRK08040          3 EGWNIALLGATGAVGEALLETLAERQFPVGEIYALAREESAGETLRFGGKSITVQDAAEFDWTQAQLAFFVAGKEA----   78 (337)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCEEEECCCEEEEEECCCCCCCCCCEEEECCCCHH----
T ss_conf             9987999888508899999999717998135999988888997777899188999777033246988999177178----


Q ss_pred             CCHHHHHHHHCCCEEEE
Q ss_conf             78889999976980998
Q gi|254781099|r   81 AHWCVKLANQFNVEIIG   97 (468)
Q Consensus        81 ~~~~~~~a~~~gi~v~s   97 (468)
                      ...+...+.+.|..|++
T Consensus        79 s~~~~~~a~~aG~~VID   95 (337)
T PRK08040         79 SAAYAEEATNAGCLVID   95 (337)
T ss_pred             HHHHHHHHHHCCCEEEE
T ss_conf             88889999848959997


No 433
>PRK06482 short chain dehydrogenase; Provisional
Probab=93.19  E-value=0.67  Score=25.31  Aligned_cols=42  Identities=21%  Similarity=0.130  Sum_probs=34.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC
Q ss_conf             87999836-8548999999998598699981896478899978
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM   50 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~   50 (468)
                      |.++|-|. ++-|+++|+.|.++|++|.++++++..+..+...
T Consensus         3 Kv~lITGaSsGiG~ala~~l~~~G~~Vi~t~R~~~~l~~l~~~   45 (276)
T PRK06482          3 KTWFITGASSGFGRGLTERLLARGDRVAATVRRPDALDDLKAR   45 (276)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH
T ss_conf             7899915865999999999998899899997898999999986


No 434
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=93.14  E-value=0.45  Score=26.51  Aligned_cols=67  Identities=16%  Similarity=0.193  Sum_probs=47.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCE---EECCCC--CCCCCCCEEEECCCCC
Q ss_conf             87999836-8548999999998598699981896478899978989---964531--5722588899888868
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE---VIDFRE--IPWSIISFLVLSPGIA   75 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~---~~~~~~--~~~~~~d~vv~Spgi~   75 (468)
                      .||+|+|. |..|--+++-+..+||+|++.-+++..+...+...+.   +++...  ..+.+.|.||-+=|-+
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~~RGHeVTAivRn~~K~~~~~~~~i~q~Difd~~~~a~~l~g~DaVIsA~~~~   73 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEALKRGHEVTAIVRNASKLAARQGVTILQKDIFDLTSLASDLAGHDAVISAFGAG   73 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEECHHHCCCCCCCEEECCCCCCHHHHHHHHCCCCEEEEECCCC
T ss_conf             9078995374567999999986798048998076766522353020002227456676635876699721578


No 435
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion]
Probab=93.13  E-value=0.18  Score=29.24  Aligned_cols=31  Identities=29%  Similarity=0.530  Sum_probs=29.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             7999836854899999999859869998189
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      -|.|+|.|.+|.++|..|.+.|++|.+.|+.
T Consensus         5 DVvIVGaGPAGs~aA~~la~~G~~VlvlEk~   35 (396)
T COG0644           5 DVVIVGAGPAGSSAARRLAKAGLDVLVLEKG   35 (396)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             8999897889999999998579929999657


No 436
>TIGR02352 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727   This family consists of the homotetrameric, FAD-dependent glycine oxidase ThiO, from species such as Bacillus subtilis that use glycine in thiamine biosynthesis. In general, members of this family will not be found in species such as Escherichia coli that instead use tyrosine and the ThiH protein .; GO: 0016491 oxidoreductase activity, 0050660 FAD binding.
Probab=93.13  E-value=0.12  Score=30.38  Aligned_cols=50  Identities=26%  Similarity=0.280  Sum_probs=35.5

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHH-HHHCCCEEECCCCC
Q ss_conf             999836854899999999859869998189647889-99789899645315
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQ-AKDMGIEVIDFREI   60 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~-l~~~g~~~~~~~~~   60 (468)
                      |+|+|-|.-|+|+|-.|..+|+.|...|..+..-.. -...|.-+.++.|.
T Consensus         1 ~~ViGGGvIGL~~A~~L~~~G~~V~l~~~~~~~g~~AS~~AaGMLAP~aE~   51 (357)
T TIGR02352         1 VLVIGGGVIGLSVAVELAERGHSVTLLDRDPTVGGGASWAAAGMLAPVAEV   51 (357)
T ss_pred             CEEECCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             978453187899999999749938999658604567788664332432667


No 437
>PRK06128 oxidoreductase; Provisional
Probab=93.11  E-value=0.69  Score=25.24  Aligned_cols=50  Identities=14%  Similarity=0.149  Sum_probs=34.5

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCH------HHHHHHHCCCEE
Q ss_conf             218987999836-85489999999985986999818964------788999789899
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPC------AVKQAKDMGIEV   54 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~------~~~~l~~~g~~~   54 (468)
                      .|+||.++|-|- .+-|+++|+.|.+.|++|...|....      ..+.++..|...
T Consensus        52 rL~GKvAlVTGgssGIG~AiA~~lA~eGA~Vvi~~~~~~~~~a~~~~~~i~~~G~~a  108 (300)
T PRK06128         52 RLQGRKALITGADSGIGRATAIAFAREGADIVLNYLPEEEQDAAEVVQLIQAEGRKA  108 (300)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHCCCEE
T ss_conf             789995899173669999999999986999999429955678999999999659818


No 438
>PRK05439 pantothenate kinase; Provisional
Probab=93.08  E-value=0.07  Score=32.10  Aligned_cols=27  Identities=33%  Similarity=0.613  Sum_probs=22.6

Q ss_pred             CCC-EEEEECC--CCCCHHHHHHHHHHHHH
Q ss_conf             886-8996034--57521578999999873
Q gi|254781099|r  112 QSP-FIAVTGT--NGKSSTVALISHVLRKN  138 (468)
Q Consensus       112 ~~~-vI~VTGT--~GKTTt~~ll~~iL~~~  138 (468)
                      +.| |||||||  .||+||+.+|..+|..-
T Consensus        84 ~~PfIIGIaGSVAVGKSTtARlLq~LL~r~  113 (312)
T PRK05439         84 KVPFIIGIAGSVAVGKSTTARLLQALLSRW  113 (312)
T ss_pred             CCCEEEEEEEEEECCHHHHHHHHHHHHHCC
T ss_conf             999899976201026288999999999507


No 439
>PRK06181 short chain dehydrogenase; Provisional
Probab=93.05  E-value=0.35  Score=27.26  Aligned_cols=40  Identities=13%  Similarity=0.167  Sum_probs=32.9

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHH
Q ss_conf             987999836-8548999999998598699981896478899
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQA   47 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l   47 (468)
                      ||.+.|-|. .+-|.++|+.|.++|++|..+|.++..++++
T Consensus         1 GKv~lITGassGIG~a~A~~la~~Ga~vvl~~r~~~~l~~~   41 (263)
T PRK06181          1 GKVVIITGASEGIGRALAVRLARAGARLVLAARNEERLASL   41 (263)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHH
T ss_conf             99999958101999999999998799899998899999999


No 440
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional
Probab=93.04  E-value=0.35  Score=27.23  Aligned_cols=41  Identities=15%  Similarity=0.162  Sum_probs=32.1

Q ss_pred             HHHCCCEEEEECC-C--HHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             3218987999836-8--548999999998598699981896478
Q gi|254781099|r    4 SSFRNHSIAVFGL-G--RSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G--~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      .-|+||+++|-|. |  +-|.++|+.|.++|++|..+|.+...+
T Consensus         3 g~L~GK~~lVTG~~~~~GIG~a~A~~la~~GA~Vvi~~~~~~~~   46 (256)
T PRK07889          3 GLLEGKRILVTGVITDSSIAFHIARVAQEQGAEVVLTGFRRLRL   46 (256)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCHHH
T ss_conf             71499979998998856899999999998799999983893589


No 441
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=93.04  E-value=0.71  Score=25.17  Aligned_cols=43  Identities=26%  Similarity=0.291  Sum_probs=34.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCC
Q ss_conf             7999836854899999999859869998189647889997898
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGI   52 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~   52 (468)
                      ||.|+|.|=-|+..+-.|.+.||+|++.|..+..++.+..-..
T Consensus         2 kI~viGtGYVGLv~g~~lA~~GHeVv~vDid~~KV~~ln~g~~   44 (414)
T COG1004           2 KITVIGTGYVGLVTGACLAELGHEVVCVDIDESKVELLNKGIS   44 (414)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHCCCC
T ss_conf             1589888556887899998709848999578899999867999


No 442
>PRK08219 short chain dehydrogenase; Provisional
Probab=93.02  E-value=0.69  Score=25.26  Aligned_cols=71  Identities=18%  Similarity=0.233  Sum_probs=40.6

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH-CCCEEE--CCCC--------CCCCCCCEEEECCCCC
Q ss_conf             987999836-854899999999859869998189647889997-898996--4531--------5722588899888868
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD-MGIEVI--DFRE--------IPWSIISFLVLSPGIA   75 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~-~g~~~~--~~~~--------~~~~~~d~vv~Spgi~   75 (468)
                      -|.++|-|. ++-|.++|+.|.+.| .|...+++...++++.. .+...+  +..+        ..+...|.+|...|+.
T Consensus         3 mKvalITGas~GIG~aia~~la~~g-~vv~~~r~~~~l~~l~~~~~~~~~~~Dlt~~~~i~~~~~~~~~iD~lVnnAG~~   81 (226)
T PRK08219          3 MPTALITGASRGIGAAIARALARTH-TLLLAGRPSERLDAVAARLGATTWPADLTDPEAIAAAVEPLDRLDVLVHNAGVA   81 (226)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             8999992846499999999999699-899998988999999997099378605799999999999659988999899689


Q ss_pred             CCCC
Q ss_conf             5675
Q gi|254781099|r   76 LTGE   79 (468)
Q Consensus        76 ~~~~   79 (468)
                      ...+
T Consensus        82 ~~~~   85 (226)
T PRK08219         82 ELGP   85 (226)
T ss_pred             CCCC
T ss_conf             9987


No 443
>PRK10537 voltage-gated potassium channel; Provisional
Probab=93.02  E-value=0.43  Score=26.67  Aligned_cols=50  Identities=16%  Similarity=0.238  Sum_probs=21.9

Q ss_pred             CCCEEEE-ECCCHHHHH-----HHHHCCCCEEEECCHHHHHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             7868999-889989988-----8631689889987999999999999984489859994522
Q gi|254781099|r  372 KIAKAYF-IGNSAMLFF-----HHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPG  427 (468)
Q Consensus       372 ~~~~~~l-iG~~~~~i~-----~~~~~~~~~~~~~~~~~a~~~i~~~~~~~~~gDiVLlSPa  427 (468)
                      +...+++ .+.|++...     +.+.+.+......+-++.++.+.+      .|--.++||.
T Consensus       266 ~Ak~VI~~~~~Da~NvfivLTAR~LnP~v~IVA~a~~~en~~Klrr------AGAD~VISP~  321 (356)
T PRK10537        266 RARAILALRDNDADNAFVVLAAKEMSSDVKTVAAVNDSKNLEKIKR------VHPDMIFSPQ  321 (356)
T ss_pred             HHCEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHH------HCCCEEECHH
T ss_conf             5079888078777899999849986899769999676757999986------2899998688


No 444
>PRK06223 malate dehydrogenase; Reviewed
Probab=93.02  E-value=0.71  Score=25.15  Aligned_cols=70  Identities=13%  Similarity=0.163  Sum_probs=45.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHHC------CCEEE-CCCCCCCCCCCEEEECCCCCC
Q ss_conf             79998368548999999998598--699981896478----899978------98996-453157225888998888685
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKDM------GIEVI-DFREIPWSIISFLVLSPGIAL   76 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~~------g~~~~-~~~~~~~~~~d~vv~Spgi~~   76 (468)
                      ||.|+|.|.-|.++|-.|..+|.  ++..+|.++...    ..+...      ...+. ...-....+.|+||++.|+|.
T Consensus         2 KI~IiGaG~VG~~~a~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~~~~~~~~~~i~~~~d~~~~~daDiVVitag~~r   81 (312)
T PRK06223          2 KISIIGAGNVGATLAHLLALKELGKDVVLFDIPEGIPQGKALDIAESSAVDGFDAKITGTNDYADIAGSDVVIITAGVPR   81 (312)
T ss_pred             EEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCEEEECCCHHHHCCCCEEEEECCCCC
T ss_conf             79999969899999999985799874899769997336798887651433688847983788899579999999067789


Q ss_pred             CCC
Q ss_conf             675
Q gi|254781099|r   77 TGE   79 (468)
Q Consensus        77 ~~~   79 (468)
                      ...
T Consensus        82 k~g   84 (312)
T PRK06223         82 KPG   84 (312)
T ss_pred             CCC
T ss_conf             999


No 445
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase. Methylene Tetrahydromethanopterin Dehydrogenase (H4MPT DH) NADP binding domain. NADP-dependent H4MPT DH catalyzes the dehydrogenation of methylene- H4MPT and methylene-tetrahydrofolate (H4F) with NADP+ as cofactor. H4F and H4MPT are both cofactors that carry the one-carbon units between the formyl and methyl oxidation level. H4F and H4MPT are structurally analogous to each other with respect to the pterin moiety, but each has distinct side chain. H4MPT is present only in anaerobic methanogenic archaea and aerobic methylotrophic proteobacteria. H4MPT seems to have evolved independently from H4F and functions as a distinct carrier in C1 metabolism. Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH/cyclo
Probab=92.99  E-value=0.39  Score=26.96  Aligned_cols=42  Identities=21%  Similarity=0.297  Sum_probs=35.7

Q ss_pred             HHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHH
Q ss_conf             3218987999836-85489999999985986999818964788
Q gi|254781099|r    4 SSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVK   45 (468)
Q Consensus         4 ~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~   45 (468)
                      .++++|++.|+|- |.-|..+|++|...|.+|....++....+
T Consensus        24 ~dl~g~~~~V~G~tG~vG~~~A~~lA~~Ga~v~lv~R~~ek~~   66 (194)
T cd01078          24 KDLKGKTAVVLGGTGPVGQRAAVLLAREGARVVLVGRDLERAQ   66 (194)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHH
T ss_conf             9867988999858857899999999983997999958788899


No 446
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase; InterPro: IPR005982    Reactive oxygen species (ROS) are known mediators of intracellular signaling cascades. Excessive production of ROS may, however, lead to oxidative stress, loss of cell function, and ultimately apoptosis or necrosis. A balance between oxidant and antioxidant intracellular systems is hence vital for cell function, regulation, and adaptation to diverse growth conditions. Thioredoxin reductase in conjunction with thioredoxin is a ubiquitous oxidoreductase system with antioxidant and redox regulatory roles. Thioredoxin reductase (1.8.1.9 from EC) reduces oxidised thioredoxin in the presence of NADPH. Reduced thioredoxin serves as an electron donor for thioredoxin peroxidase which consequently reduces H_2O_2 to H_2O. In mammals, extracellular forms of Trx also have cytokine-like effects. Mammalian TrxR has a highly reactive active site selenocysteine residue resulting in a profound reductive capacity, reducing several substrates in addition to Trx .; GO: 0004791 thioredoxin-disulfide reductase activity, 0019430 removal of superoxide radicals, 0005737 cytoplasm.
Probab=92.97  E-value=0.44  Score=26.61  Aligned_cols=75  Identities=17%  Similarity=0.139  Sum_probs=47.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH---HHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             7999836854899999999859869998189647---8899978989964531572258889988886856755788899
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA---VKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~---~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
                      .|.|+|.|-.|+++|-|..+.+.+....+...+-   =+-....-++.++.-+..+...+|.             ..+-+
T Consensus         2 DviIIGaGPAGlTAAIYa~Ra~l~~l~~eg~~~G~aGGql~~T~~vENYPGf~e~i~G~~L~-------------~~M~~   68 (321)
T TIGR01292         2 DVIIIGAGPAGLTAAIYAARANLKTLLIEGMEPGIAGGQLTTTTEVENYPGFPEGISGPELM-------------EKMKE   68 (321)
T ss_pred             CEEEECCCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCEEECCCCCCCCCCHHHHH-------------HHHHH
T ss_conf             28998478678889999887467278983577774555333220651368688876628899-------------99999


Q ss_pred             HHHHCCCEEEE
Q ss_conf             99976980998
Q gi|254781099|r   87 LANQFNVEIIG   97 (468)
Q Consensus        87 ~a~~~gi~v~s   97 (468)
                      .|.+.|.++..
T Consensus        69 Qa~~fG~~~~~   79 (321)
T TIGR01292        69 QAKKFGAEIIY   79 (321)
T ss_pred             HHHHCCCCEEE
T ss_conf             99870673662


No 447
>pfam07755 DUF1611 Protein of unknown function (DUF1611). This region is found in a number of hypothetical bacterial and archaeal proteins. The region is approximately 350 residues long. A member of this family is thought to associate with another subunit to form an H+-transporting ATPase, but no evidence has been found to support this.
Probab=92.96  E-value=0.35  Score=27.25  Aligned_cols=84  Identities=25%  Similarity=0.373  Sum_probs=48.9

Q ss_pred             HHHHHHCCCEEEE--EH--HHHHHHHHHCCCCCCEEEEECC---CCCCHHHHHHHHHHHHHHHHCCCC--CC-------C
Q ss_conf             9999976980998--30--3422334301568868996034---575215789999998731000000--01-------2
Q gi|254781099|r   85 VKLANQFNVEIIG--DI--ELFVRERRFSSLQSPFIAVTGT---NGKSSTVALISHVLRKNGYDVQLG--GN-------I  148 (468)
Q Consensus        85 ~~~a~~~gi~v~s--~~--el~~~~~~~~~~~~~vI~VTGT---~GKTTt~~ll~~iL~~~g~~~~~~--GN-------i  148 (468)
                      ...|++.|..++-  .+  ++-....+....++|.|.+-||   .||-||+-.|...|++.|.++...  |.       -
T Consensus        81 ~~~A~~~g~~i~DvR~p~~~~~~~~g~~~~~~~~rvl~vGTDcavGK~tTal~l~~~l~~~Gi~a~fiaTGQTGili~g~  160 (302)
T pfam07755        81 AAAAKKHGVQIIDVRKPPVDLPVATGKAREVKAKRVLTVGTDCAVGKMTTALELERALRERGLNAAFVATGQTGILIAGY  160 (302)
T ss_pred             HHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCEEEEECC
T ss_conf             99999869979991589998865768401479878999605733407899999999999779984799727613688152


Q ss_pred             CCCCC--------------CCCCCCCCCEEEEEC
Q ss_conf             44322--------------110168883799921
Q gi|254781099|r  149 GLPIL--------------NLEYFSPNRFYVIEC  168 (468)
Q Consensus       149 G~p~~--------------~~~~~~~~~~~V~E~  168 (468)
                      |.|+=              ......+.|+.++|=
T Consensus       161 Gv~iDav~~DFvaGavE~~v~~~~~~~d~iiIEG  194 (302)
T pfam07755       161 GVPLDAVPADFVAGAVEALVLDAAEEDDWIVIEG  194 (302)
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEC
T ss_conf             4784322476676789999986454678799916


No 448
>PRK08267 short chain dehydrogenase; Provisional
Probab=92.89  E-value=0.36  Score=27.20  Aligned_cols=41  Identities=22%  Similarity=0.187  Sum_probs=33.1

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             87999836-854899999999859869998189647889997
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |.|+|-|. .+-|.++|+.|.++|++|.++|.++..++.+..
T Consensus         2 K~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~   43 (258)
T PRK08267          2 KSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAA   43 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             989990722689999999999879999999888999999999


No 449
>TIGR02734 crtI_fam phytoene desaturase; InterPro: IPR014105   Phytoene is converted to lycopene by desaturation at four (two symmetrical pairs of) sites. This is achieved by two enzymes (crtP and crtQ) in cyanobacteria (Gloeobacter being an exception) and plants, but by a single enzyme in most other bacteria and in fungi. This single enzyme is called the bacterial-type phytoene desaturase, or CrtI. Most members of this family are CrtI and are part of flavin containing amine oxidoreductase family. It is likely that all members act on either phytoene or on related compounds such as dehydrosqualene, for carotenoid biosynthesis..
Probab=92.84  E-value=0.15  Score=29.81  Aligned_cols=31  Identities=29%  Similarity=0.475  Sum_probs=28.2

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9998368548999999998598699981896
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      +.|||.|..|+|+|-.|...|+.|++.+++.
T Consensus         1 a~VIGAG~gGLA~A~rL~~~G~~vtv~E~~d   31 (526)
T TIGR02734         1 AVVIGAGFGGLALAIRLQAAGIRVTVVEKRD   31 (526)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             9685777689999999973795289986068


No 450
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional
Probab=92.82  E-value=0.16  Score=29.63  Aligned_cols=38  Identities=32%  Similarity=0.566  Sum_probs=32.5

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             13218987999836854899999999859869998189
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |.++-..-|.|+|.|-||+++|.+|.+.|.+|..++++
T Consensus        20 l~~~~e~DVvIVGaGpsGLtAAy~LAk~g~Kv~i~E~~   57 (257)
T PRK04176         20 LLDYLEVDVAIVGAGPSGLTAAYYLAKAGLKVAVFERK   57 (257)
T ss_pred             HHHHHHCCEEEECCCCHHHHHHHHHHHCCCEEEEEECC
T ss_conf             98764068899888827999999998689659999713


No 451
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only]
Probab=92.81  E-value=0.16  Score=29.67  Aligned_cols=36  Identities=33%  Similarity=0.481  Sum_probs=29.2

Q ss_pred             HHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             218987999836854899999999859869998189
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      .+.+++|+|+|.|-.|+++|..|...|+.|++++..
T Consensus       120 ~~tg~~VaviGaGPAGl~~a~~L~~~G~~Vtv~e~~  155 (457)
T COG0493         120 SRTGKKVAVIGAGPAGLAAADDLSRAGHDVTVFERV  155 (457)
T ss_pred             CCCCCEEEEECCCCHHHHCHHHHHHCCCEEEECCCC
T ss_conf             876767999888951555889998689879982666


No 452
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed
Probab=92.77  E-value=0.55  Score=25.92  Aligned_cols=85  Identities=12%  Similarity=0.072  Sum_probs=51.4

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCC---EEEEEECCCHHHHHHH--HCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCC
Q ss_conf             87999836-8548999999998598---6999818964788999--7898996453157225888998888685675578
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGV---HVIAWDDHPCAVKQAK--DMGIEVIDFREIPWSIISFLVLSPGIALTGENAH   82 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~---~V~~~D~~~~~~~~l~--~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~   82 (468)
                      .||+|+|. |..|.-+.++|.++.+   ++.........-+.+.  .....+.......+.++|+++.+++-    ....
T Consensus         3 ~kVaIvGATG~vG~eli~lL~~~~~p~~~i~~~aS~~s~G~~~~~~~~~~~~~~~~~~~~~~~Di~f~a~~~----~~s~   78 (348)
T PRK06598          3 YNVGVVGATGMVGSVLLQMLEERDFPVIEPVFFASSRSGGKAPSFGGKTLLVDALDIEDLKGLDIALFSAGG----DYSK   78 (348)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCEECCCEEEEEECCHHHHHCCCEEEECCCC----HHHH
T ss_conf             479998984599999999998679996249999875668987506895547862785576079999986882----3568


Q ss_pred             HHHHHHHHCCCEEEE
Q ss_conf             889999976980998
Q gi|254781099|r   83 WCVKLANQFNVEIIG   97 (468)
Q Consensus        83 ~~~~~a~~~gi~v~s   97 (468)
                      .+...+.+.|+.|+.
T Consensus        79 ~~~~~~~~~g~~VID   93 (348)
T PRK06598         79 EVAPKLRAAGGVVID   93 (348)
T ss_pred             HHHHHHHHCCCEEEE
T ss_conf             888999758989998


No 453
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed
Probab=92.72  E-value=0.73  Score=25.06  Aligned_cols=67  Identities=16%  Similarity=0.161  Sum_probs=45.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC----EEEEEECCC-HHHHHHHHC-CCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             879998368548999999998598----699981896-478899978-989964531572258889988886856
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV----HVIAWDDHP-CAVKQAKDM-GIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~----~V~~~D~~~-~~~~~l~~~-g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      ++|+|+|.|.=|.++++-|.+.|.    ++++++.++ ...+.+... +.......+.....+|+||++  |+|.
T Consensus         2 ~kI~fIG~GnMg~Aii~Gll~~~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dvIila--VKP~   74 (275)
T PRK06928          2 EKIGFIGYGSMADMIATKLLETEVITPEEIILYSRSENEHFKQLYDKYPTVALASNEELFTKCDHSFIC--VPPL   74 (275)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHCCCEEECCHHHHHHHCCEEEEE--ECHH
T ss_conf             889998678999999999997899996369997899389999999874953637779998549989999--7858


No 454
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional
Probab=92.71  E-value=0.37  Score=27.09  Aligned_cols=38  Identities=13%  Similarity=0.154  Sum_probs=30.8

Q ss_pred             CHHHCCCEEEEECC-C--HHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             13218987999836-8--54899999999859869998189
Q gi|254781099|r    3 LSSFRNHSIAVFGL-G--RSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G--~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |.-|+||+++|-|. |  +-|.++|+.|.++|++|..++..
T Consensus         1 Mg~L~gK~~lVTGa~~~~GIG~aia~~la~~Ga~v~~~~~~   41 (261)
T PRK08690          1 MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVV   41 (261)
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             99999988999898786389999999999859999997376


No 455
>TIGR03466 HpnA hopanoid-associated sugar epimerase. The sequences in this family are members of the pfam01370 superfamily of NAD-dependent epimerases and dehydratases typically acting on nucleotide-sugar substrates. The genes of the family modeled here are generally in the same locus with genes involved in the biosynthesis and elaboration of hopene, the cyclization product of the polyisoprenoid squalene.
Probab=92.68  E-value=0.75  Score=24.99  Aligned_cols=62  Identities=16%  Similarity=0.176  Sum_probs=43.2

Q ss_pred             EEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECC--CCC-----CCCCCCEEEEC
Q ss_conf             7999836-85489999999985986999818964788999789899645--315-----72258889988
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF--REI-----PWSIISFLVLS   71 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~--~~~-----~~~~~d~vv~S   71 (468)
                      ||+|-|. |--|..+++.|.++|++|.+.+..+.....+...+++++..  .+.     ..+++|.|+..
T Consensus         2 riLVTGgtGfiG~~l~~~L~~~G~~V~~l~r~~~~~~~~~~~~~~~~~gDl~d~~~~~~~~~~~d~ViH~   71 (328)
T TIGR03466         2 KVLVTGATGFVGSAVVRLLLERGEEVRVLVRPTSDRRNLEGLDVEIVEGDLRDPASLRKALAGCRALFHV   71 (328)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCHHHHCCCCCEEEEEECCCHHHHHHHHHCCCEEEEE
T ss_conf             4999867779999999999978498999989998655652179779982079999999997178589761


No 456
>PRK06953 short chain dehydrogenase; Provisional
Probab=92.63  E-value=0.47  Score=26.40  Aligned_cols=46  Identities=20%  Similarity=0.325  Sum_probs=37.2

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEE
Q ss_conf             87999836-85489999999985986999818964788999789899
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEV   54 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~   54 (468)
                      |.|+|-|. .+-|+++|+.|.+.|++|....+++..++.+...+.+.
T Consensus         2 K~~LVTGas~GIG~a~a~~la~~G~~V~~~~R~~~~l~~l~~~~~~~   48 (222)
T PRK06953          2 KTVLIVGASRGIGLEFVRQYRADGWRVIATARDAAGLAALRALGAEA   48 (222)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCE
T ss_conf             99999475729999999999988899999968888899988421517


No 457
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional
Probab=92.62  E-value=0.8  Score=24.79  Aligned_cols=113  Identities=13%  Similarity=0.096  Sum_probs=62.2

Q ss_pred             CHHHCCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH----HCCC--EEE--CCCC---CCCCCCCEEEEC
Q ss_conf             1321898799983685489999999985986999818964788999----7898--996--4531---572258889988
Q gi|254781099|r    3 LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAK----DMGI--EVI--DFRE---IPWSIISFLVLS   71 (468)
Q Consensus         3 ~~~~~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~----~~g~--~~~--~~~~---~~~~~~d~vv~S   71 (468)
                      +..++|++|+=+|=|. | -+++.|.+.|++|+|.|..+..++..+    ..+.  .+.  +..+   ...+.+|+|+.+
T Consensus        44 ~~~l~G~~ILDVGCGg-G-~lse~LAr~Ga~VtGID~S~~~I~~Ar~ha~~~~l~i~y~~~~~e~l~~~~~~~FDvV~~~  121 (233)
T PRK05134         44 AGGLFGKRVLDVGCGG-G-ILSESMARLGATVTGIDASEENIEVARLHALESGLKIDYRQITAEELAAEHPGQFDVVTCM  121 (233)
T ss_pred             CCCCCCCEEEEECCCC-C-HHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHCCCCEEEEEEE
T ss_conf             1466899899975589-7-1128999679979998799899999999856443451167514766543057863477442


Q ss_pred             CCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             886856755788899999769809983034223343015688689960345752157899999987
Q gi|254781099|r   72 PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRK  137 (468)
Q Consensus        72 pgi~~~~~~~~~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~  137 (468)
                      - +=.+.                  .+++-+.........+.-.+ +=-|-.||..+-+++-++.+
T Consensus       122 E-VlEHV------------------~d~~~~l~~~~rlLKPGG~l-~lsTiNrt~~S~l~~i~~AE  167 (233)
T PRK05134        122 E-MLEHV------------------PDPASFIRACAKLVKPGGLV-FFSTLNRNLKSYLLAIVGAE  167 (233)
T ss_pred             H-HHHHC------------------CCHHHHHHHHHHHHCCCCEE-EEECCCCCHHHHHHHHHHHH
T ss_conf             1-47753------------------89999999999973899149-99726789899999999998


No 458
>PRK10083 putative dehydrogenase; Provisional
Probab=92.61  E-value=0.43  Score=26.69  Aligned_cols=19  Identities=11%  Similarity=0.097  Sum_probs=10.0

Q ss_pred             EEEECCHHHHHHHHHHHHHH
Q ss_conf             89987999999999999984
Q gi|254781099|r  396 STLSKTLDQALKSVVRDVEN  415 (468)
Q Consensus       396 ~~~~~~~~~a~~~i~~~~~~  415 (468)
                      ++....++++ ..+++..++
T Consensus       307 It~~f~L~~~-~~A~~~~~~  325 (339)
T PRK10083        307 ITHTFDFQHV-ADAIELFEK  325 (339)
T ss_pred             EEEEEEHHHH-HHHHHHHHC
T ss_conf             8999898999-999999865


No 459
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes. Members of this subfamily are tetrameric NAD-dependent 2-hydroxycarboxylate dehydrogenases including LDHs, L-2-hydroxyisocaproate dehydrogenases (L-HicDH), and LDH-like malate dehydrogenases (MDH). Dehydrogenases catalyze the conversion of carbonyl compounds to alcohols or amino acids. LDHs catalyze the last step of glycolysis in which pyruvate is converted to L-lactate. Vertebrate LDHs are non-allosteric, but some bacterial LDHs are activated by an allosteric effector such as fructose-1,6-bisphosphate. L-HicDH catalyzes the conversion of a variety of 2-oxo carboxylic acids with medium-sized aliphatic or aromatic side chains. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like subfamily is part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of prot
Probab=92.59  E-value=0.56  Score=25.87  Aligned_cols=68  Identities=16%  Similarity=0.187  Sum_probs=44.1

Q ss_pred             EEEECCCHHHHHHHHHHHHCCC--EEEEEECCCHHH----HHHHHCC-----CEEE-CCCCCCCCCCCEEEECCCCCCCC
Q ss_conf             9998368548999999998598--699981896478----8999789-----8996-45315722588899888868567
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKDMG-----IEVI-DFREIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~--~V~~~D~~~~~~----~~l~~~g-----~~~~-~~~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      |.|+|.|.-|.++|..|..+|.  ++..+|.++...    ..+....     ..+. ........+.|+||++-|+|...
T Consensus         1 V~IIGaG~VG~~~A~~l~~~~l~~el~L~Di~~~~a~g~a~Dl~~~~~~~~~~~~~~~~~~~~~~daDvvVitaG~~rkp   80 (300)
T cd00300           1 ITIIGAGNVGAAVAFALIAKGLASELVLVDVNEEKAKGDALDLSHASAFLATGTIVRGGDYADAADADIVVITAGAPRKP   80 (300)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCEEECCCCHHHHCCCCEEEECCCCCCCC
T ss_conf             98989688999999999867998879998189981156888877256346885398279889967999999878989997


No 460
>PRK08177 short chain dehydrogenase; Provisional
Probab=92.56  E-value=0.41  Score=26.79  Aligned_cols=43  Identities=19%  Similarity=0.187  Sum_probs=33.4

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHC
Q ss_conf             987999836-8548999999998598699981896478899978
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM   50 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~   50 (468)
                      +|+++|-|. .+-|.++|+.|.++|++|.++++++.....+...
T Consensus         1 KK~~lITGas~GIG~aia~~l~~~G~~V~~~~R~~~~~~~~~~~   44 (225)
T PRK08177          1 KRTALIIGASRGLGLGLVDRLLERGWQVTATVRGPQQDTALQAL   44 (225)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHC
T ss_conf             99899927342999999999998869999997988778998725


No 461
>PRK06249 2-dehydropantoate 2-reductase; Provisional
Probab=92.55  E-value=0.77  Score=24.93  Aligned_cols=48  Identities=21%  Similarity=0.252  Sum_probs=38.4

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEEC
Q ss_conf             89879998368548999999998598699981896478899978989964
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID   56 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~   56 (468)
                      ++.||+|+|.|--|.-.|-+|.+.|++|+...+..  .+.+...|+.+..
T Consensus         4 ~~~kI~IiGaGAiG~~~a~~L~~aG~~V~li~r~~--~~ai~~~Gl~i~~   51 (313)
T PRK06249          4 ETPRIAIIGTGAIGGFYGAMLARAGFDVHFLLRSD--YEAVRENGLQVDS   51 (313)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCH--HHHHHHCCEEEEE
T ss_conf             98889999914999999999996699569996755--9999868859996


No 462
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism]
Probab=92.55  E-value=0.29  Score=27.80  Aligned_cols=113  Identities=21%  Similarity=0.271  Sum_probs=63.9

Q ss_pred             CCCCCCEEEEECC--CCCCHHHHHHHHHHHHHHHHCCC----------CCCC-CC----------------CC-------
Q ss_conf             1568868996034--57521578999999873100000----------0012-44----------------32-------
Q gi|254781099|r  109 SSLQSPFIAVTGT--NGKSSTVALISHVLRKNGYDVQL----------GGNI-GL----------------PI-------  152 (468)
Q Consensus       109 ~~~~~~vI~VTGT--~GKTTt~~ll~~iL~~~g~~~~~----------~GNi-G~----------------p~-------  152 (468)
                      ...++.+|||||+  .||+|...-|...|...|.+|.+          +|-| |-                |.       
T Consensus        47 ~tG~a~viGITG~PGaGKSTli~~L~~~l~~~G~rVaVlAVDPSSp~TGGsiLGDRiRM~~~~~~~~vFiRs~~srG~lG  126 (323)
T COG1703          47 RTGNAHVIGITGVPGAGKSTLIEALGRELRERGHRVAVLAVDPSSPFTGGSILGDRIRMQRLAVDPGVFIRSSPSRGTLG  126 (323)
T ss_pred             CCCCCCEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCH
T ss_conf             17998378731799886688999999999977967899998899998785301207667764469981784268776510


Q ss_pred             ---------CCCCCCCCCCEEEEECCC-CCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCC
Q ss_conf             ---------211016888379992177-5432122333221011100210122211100001122100010134432247
Q gi|254781099|r  153 ---------LNLEYFSPNRFYVIECSS-YQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIN  222 (468)
Q Consensus       153 ---------~~~~~~~~~~~~V~E~SS-fQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~d  222 (468)
                               ..+.....+|+.++|.+- =|-|.--.-..|+.+++-+.       +.=++....|.-+.+-.+..++|..
T Consensus       127 GlS~at~~~i~~ldAaG~DvIIVETVGvGQsev~I~~~aDt~~~v~~p-------g~GD~~Q~iK~GimEiaDi~vINKa  199 (323)
T COG1703         127 GLSRATREAIKLLDAAGYDVIIVETVGVGQSEVDIANMADTFLVVMIP-------GAGDDLQGIKAGIMEIADIIVINKA  199 (323)
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHCCEEEEEECC-------CCCCHHHHHHHHHHHHHHEEEEECC
T ss_conf             166889999999986189889998147884155776521668999657-------8882788887414654033567256


Q ss_pred             CHHHHH
Q ss_conf             867899
Q gi|254781099|r  223 DHQCEK  228 (468)
Q Consensus       223 d~~~~~  228 (468)
                      |.....
T Consensus       200 D~~~A~  205 (323)
T COG1703         200 DRKGAE  205 (323)
T ss_pred             CHHHHH
T ss_conf             726589


No 463
>PRK08263 short chain dehydrogenase; Provisional
Probab=92.49  E-value=0.48  Score=26.35  Aligned_cols=43  Identities=14%  Similarity=0.080  Sum_probs=35.1

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             8987999836-854899999999859869998189647889997
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      .||.++|-|. .+-|+++|+.|.++|++|.+++++...+..+..
T Consensus         2 ~gKv~lITGassGIG~a~A~~la~~G~~Vv~~~R~~~~l~~l~~   45 (275)
T PRK08263          2 MGKVWFITGASRGFGREWTEAALERGDRVVATARDTATLADLAE   45 (275)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             89989994674399999999999879989999798999999999


No 464
>PRK06484 short chain dehydrogenase; Validated
Probab=92.49  E-value=0.52  Score=26.06  Aligned_cols=70  Identities=23%  Similarity=0.339  Sum_probs=48.3

Q ss_pred             CCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH-HHHCCCEEE----CCCC------------CCCCCCCEE
Q ss_conf             8987999836-854899999999859869998189647889-997898996----4531------------572258889
Q gi|254781099|r    7 RNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ-AKDMGIEVI----DFRE------------IPWSIISFL   68 (468)
Q Consensus         7 ~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~-l~~~g~~~~----~~~~------------~~~~~~d~v   68 (468)
                      +||.++|-|- ++-|+++|+.|.+.|++|.++|.+.....+ .+.++....    +..+            ..+...|.+
T Consensus         4 eGKvalVTGas~GIG~aiA~~la~~Ga~V~~~dr~~~~~~~~~~~~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~iDiL   83 (530)
T PRK06484          4 QARVVLVTGAAGGIGRACCQRFARAGDRVVMADRDLAACTEEAERLGSRHVALQLDVSDEAQVEHAMDGLLQQFGRIDVL   83 (530)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHCCCCCEE
T ss_conf             99899997836689999999999879999999688899999999709971799984899999999999999972999899


Q ss_pred             EECCCCCC
Q ss_conf             98888685
Q gi|254781099|r   69 VLSPGIAL   76 (468)
Q Consensus        69 v~Spgi~~   76 (468)
                      |-..|+..
T Consensus        84 VNNAGi~~   91 (530)
T PRK06484         84 VNNAGIGP   91 (530)
T ss_pred             EECCCCCC
T ss_conf             98998998


No 465
>pfam07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.
Probab=92.45  E-value=0.24  Score=28.38  Aligned_cols=30  Identities=30%  Similarity=0.478  Sum_probs=28.3

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             999836854899999999859869998189
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |.|+|-|-.|+++|..|.+.|++|...|..
T Consensus         2 VvIIGgG~AGl~aA~~l~~~g~~v~lid~~   31 (277)
T pfam07992         2 VVIIGGGPAGLAAAIYLARLGLKVALIEKE   31 (277)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             999997699999999998499979999379


No 466
>PRK07707 consensus
Probab=92.41  E-value=0.58  Score=25.77  Aligned_cols=42  Identities=19%  Similarity=0.222  Sum_probs=29.2

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEE-CCCHHHHHHHH
Q ss_conf             987999836-8548999999998598699981-89647889997
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWD-DHPCAVKQAKD   49 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D-~~~~~~~~l~~   49 (468)
                      +|.++|-|- ++-|+++|+.|.+.|++|.... .++.....+.+
T Consensus         2 ~KvalVTG~s~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~   45 (239)
T PRK07707          2 KKYALVTGASGGIGQAISKQLAQDGYTVYLHYNNNEEKVNELQE   45 (239)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHH
T ss_conf             98999966887899999999998799899983999899999999


No 467
>PRK12938 acetyacetyl-CoA reductase; Provisional
Probab=92.39  E-value=0.72  Score=25.12  Aligned_cols=73  Identities=23%  Similarity=0.260  Sum_probs=42.7

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEE-ECCCHH----HHHHHHCCCEEECC----CC------------CCCC
Q ss_conf             18987999836-854899999999859869998-189647----88999789899645----31------------5722
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAW-DDHPCA----VKQAKDMGIEVIDF----RE------------IPWS   63 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~-D~~~~~----~~~l~~~g~~~~~~----~~------------~~~~   63 (468)
                      +++|.++|-|- ++-|.++|+.|.+.|++|... ..+...    ..+....|.++...    .+            ..+.
T Consensus         1 L~~KvalVTGgs~GIG~aia~~la~~Ga~Vv~~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dv~~~~~~~~~~~~i~~~~g   80 (246)
T PRK12938          1 MSQRIAYVTGGMGGIGTSICQRLHKDGFKVVAGCGPNSPRRVKWLEDQKALGFDFIASEGNVGDWDSTKAAFDKVKAEVG   80 (246)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             95098999185869999999999987998999479981789999999984599789996787999999999999999759


Q ss_pred             CCCEEEECCCCCCCC
Q ss_conf             588899888868567
Q gi|254781099|r   64 IISFLVLSPGIALTG   78 (468)
Q Consensus        64 ~~d~vv~Spgi~~~~   78 (468)
                      ..|.+|-..|+....
T Consensus        81 ~idiLVNNAG~~~~~   95 (246)
T PRK12938         81 EIDVLVNNAGITRDV   95 (246)
T ss_pred             CCCEEEECCCCCCCC
T ss_conf             998999898889998


No 468
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Probab=92.38  E-value=0.86  Score=24.58  Aligned_cols=36  Identities=14%  Similarity=0.112  Sum_probs=30.2

Q ss_pred             HHCCCEEEEECCC---HHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             2189879998368---54899999999859869998189
Q gi|254781099|r    5 SFRNHSIAVFGLG---RSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         5 ~~~~k~v~i~G~G---~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      +|+||.++|-|..   +-|.++|+.|.++|++|...+.+
T Consensus         2 ~L~gKvalVTGasr~~GIG~aiA~~la~~Ga~V~~~~~~   40 (257)
T PRK12748          2 PLMKKIAIVTGASRLNGIGAAICRVLAQKGIDIFFTYWS   40 (257)
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCC
T ss_conf             999988999288999854999999999879999997075


No 469
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism]
Probab=92.37  E-value=0.35  Score=27.31  Aligned_cols=36  Identities=31%  Similarity=0.358  Sum_probs=31.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHH
Q ss_conf             987999836854899999999859869998189647
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA   43 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~   43 (468)
                      -++|+|+|.|.-|..+|..+...|+.|..+|.++..
T Consensus         3 i~kv~ViGaG~MG~gIA~~~A~~G~~V~l~D~~~~~   38 (307)
T COG1250           3 IKKVAVIGAGVMGAGIAAVFALAGYDVVLKDISPEA   38 (307)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             407999724602099999997349956999589899


No 470
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed
Probab=92.35  E-value=0.81  Score=24.75  Aligned_cols=67  Identities=10%  Similarity=0.154  Sum_probs=47.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCC----CEEEEEECCCH-HHHHH-HHCCCEEECCCCCCCCCCCEEEECCCCCCC
Q ss_conf             87999836854899999999859----86999818964-78899-978989964531572258889988886856
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSG----VHVIAWDDHPC-AVKQA-KDMGIEVIDFREIPWSIISFLVLSPGIALT   77 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G----~~V~~~D~~~~-~~~~l-~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~   77 (468)
                      ++|+|+|.|.=|.++++-|.+.+    .++..+++.+. ..+.+ +..++.............|+||++  |.|.
T Consensus         4 m~I~fIG~GnMg~Aii~gl~~~~~~~~~~i~v~~r~~~~~~~~l~~~~~v~~~~~~~~~~~~~diI~La--VKP~   76 (279)
T PRK07679          4 QNISFLGAGSIAEAIIGGLLHANVVKGEQITVSNRSNETRLQELHQKYGVKGTHNKKELLTDANILFLA--MKPK   76 (279)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHHHHHHHHCCEEECCHHHHHHHCCEEEEE--CCHH
T ss_conf             889998768999999999997879997579997898499999999971966637779998449999995--2789


No 471
>PRK03839 putative kinase; Provisional
Probab=92.34  E-value=0.18  Score=29.30  Aligned_cols=26  Identities=42%  Similarity=0.715  Sum_probs=20.1

Q ss_pred             EEEEECC--CCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             8996034--5752157899999987310000
Q gi|254781099|r  115 FIAVTGT--NGKSSTVALISHVLRKNGYDVQ  143 (468)
Q Consensus       115 vI~VTGT--~GKTTt~~ll~~iL~~~g~~~~  143 (468)
                      +|+||||  .||||.+.+|+.-|   |++..
T Consensus         2 ~I~ITGTPGtGKTTva~~La~~l---g~~~i   29 (180)
T PRK03839          2 IIAITGTPGVGKTTISKLLAEKL---GYEYV   29 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHH---CCEEE
T ss_conf             89997899999899999999976---98798


No 472
>PRK07024 short chain dehydrogenase; Provisional
Probab=92.34  E-value=0.49  Score=26.28  Aligned_cols=41  Identities=12%  Similarity=0.058  Sum_probs=33.9

Q ss_pred             CEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             87999836-854899999999859869998189647889997
Q gi|254781099|r    9 HSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         9 k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      |+|+|-|. .+-|.++|+.|.++|++|..++++...++++..
T Consensus         3 ~~VlITGassGIG~a~A~~la~~G~~v~l~~R~~~~L~~~~~   44 (256)
T PRK07024          3 LKVFITGASSGIGQALAREYARQGATLGLVARRTDALQAFAA   44 (256)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             989998460299999999999889989999898899999999


No 473
>PRK07775 short chain dehydrogenase; Provisional
Probab=92.34  E-value=0.49  Score=26.29  Aligned_cols=50  Identities=18%  Similarity=0.108  Sum_probs=36.6

Q ss_pred             HHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHH----HHHCCCEE
Q ss_conf             218987999836-854899999999859869998189647889----99789899
Q gi|254781099|r    5 SFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQ----AKDMGIEV   54 (468)
Q Consensus         5 ~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~----l~~~g~~~   54 (468)
                      ++.+|.++|-|. ++-|.++|+.|.+.|++|...+++...+++    +...|.+.
T Consensus         7 ~~~~KtAlVTGAssGIG~aiA~~la~~G~~V~l~~R~~e~l~~~~~~l~~~g~~~   61 (275)
T PRK07775          7 HPARRPAIVAGASSGIGAATAIELAAHGFPVALGARRVEKCEEIVDKIRADGGEA   61 (275)
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCE
T ss_conf             9999979994623599999999999879989999898999999999999649948


No 474
>PRK12824 acetoacetyl-CoA reductase; Provisional
Probab=92.33  E-value=0.87  Score=24.54  Aligned_cols=72  Identities=22%  Similarity=0.098  Sum_probs=42.7

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHH-H----HHHHCCCEEE----CCCC------------CCCCCC
Q ss_conf             987999836-8548999999998598699981896478-8----9997898996----4531------------572258
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAV-K----QAKDMGIEVI----DFRE------------IPWSII   65 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~-~----~l~~~g~~~~----~~~~------------~~~~~~   65 (468)
                      +|.++|-|. ++-|.++|+.|.++|++|.++|.+.... +    .....+..+.    +..+            ..+..+
T Consensus         2 ~KvalITGas~GIG~a~a~~la~~G~~Vv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~d~~~~~~~v~~~~~~~g~i   81 (245)
T PRK12824          2 KKIALVTGAKRGIGSAIARELLADGYRVIATYFGNYDAAKDWFEEYGFTEDQVRLKSLDVTDTEECQEALARIEEEEGPV   81 (245)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             85999947888899999999998799899995880778999999874049938999913899999999999999974999


Q ss_pred             CEEEECCCCCCCCC
Q ss_conf             88998888685675
Q gi|254781099|r   66 SFLVLSPGIALTGE   79 (468)
Q Consensus        66 d~vv~Spgi~~~~~   79 (468)
                      |.+|-..|+....+
T Consensus        82 DiLVnnAG~~~~~~   95 (245)
T PRK12824         82 DILVNNAGITRDSG   95 (245)
T ss_pred             CEEEECCCCCCCCC
T ss_conf             89998988899999


No 475
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=92.31  E-value=0.072  Score=32.02  Aligned_cols=29  Identities=28%  Similarity=0.415  Sum_probs=22.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             899603457521578999999873100000
Q gi|254781099|r  115 FIAVTGTNGKSSTVALISHVLRKNGYDVQL  144 (468)
Q Consensus       115 vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~  144 (468)
                      +||.||+ |||||.+=|++-|+..|+++.+
T Consensus        80 lvG~~G~-GKTTT~AKLA~~~~~~~~kV~l  108 (270)
T PRK06731         80 LIGPTGV-GKTTTLAKMAWQFHGKKKTVGF  108 (270)
T ss_pred             EECCCCC-CHHHHHHHHHHHHHHCCCEEEE
T ss_conf             9888989-8899999999999867990899


No 476
>PRK08303 short chain dehydrogenase; Provisional
Probab=92.27  E-value=0.77  Score=24.91  Aligned_cols=38  Identities=21%  Similarity=0.256  Sum_probs=33.3

Q ss_pred             CHHHCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECC
Q ss_conf             13218987999836-854899999999859869998189
Q gi|254781099|r    3 LSSFRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDH   40 (468)
Q Consensus         3 ~~~~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~   40 (468)
                      |.+|+||.++|-|. .+-|+++|+.|.+.|++|..++++
T Consensus         3 m~~L~GKvAlVTGasrGIGraiA~~LA~~GA~V~i~~r~   41 (305)
T PRK08303          3 MKPLRGKVALVAGATRGAGRGIAVELGAAGATVYVTGRS   41 (305)
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             998799989990887589999999999879989998276


No 477
>cd01424 MGS_CPS_II Methylglyoxal synthase-like domain from type II glutamine-dependent carbamoyl phosphate synthetase (CSP). CSP, a CarA and CarB heterodimer, catalyzes the production of carbamoyl phosphate which is subsequently employed in the metabolic pathways responsible for the synthesis of pyrimidine nucleotides or arginine. The MGS-like domain is the C-terminal domain of CarB and appears to play a regulatory role in CPS function by binding allosteric effector molecules, including UMP and ornithine.
Probab=92.26  E-value=0.8  Score=24.80  Aligned_cols=81  Identities=15%  Similarity=0.136  Sum_probs=54.7

Q ss_pred             HHHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECC----CCC-------CCCCCCEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             9999999985986999818964788999789899645----315-------72258889988886856755788899999
Q gi|254781099|r   21 LSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF----REI-------PWSIISFLVLSPGIALTGENAHWCVKLAN   89 (468)
Q Consensus        21 ~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~----~~~-------~~~~~d~vv~Spgi~~~~~~~~~~~~~a~   89 (468)
                      +++|+.|.+.|+++.++-   -+.+.|++.|+.....    ...       ....+|+||-+|.-.....+...+-..|.
T Consensus        16 l~~ak~l~~lGf~i~AT~---GTa~~L~~~Gi~~~~v~k~~e~~p~i~d~i~~~~i~lVINt~~~~~~~~dg~~IRr~Av   92 (110)
T cd01424          16 VEIAKRLAELGFKLVATE---GTAKYLQEAGIPVEVVNKVSEGRPNIVDLIKNGEIQLVINTPSGKRAIRDGFSIRRAAL   92 (110)
T ss_pred             HHHHHHHHHCCCEEEECC---HHHHHHHHCCCCCEEEECCCCCCCCHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHH
T ss_conf             999999998899999871---69999986498640330056799768999977935899977889865742999999999


Q ss_pred             HCCCEEEEEHHHHHH
Q ss_conf             769809983034223
Q gi|254781099|r   90 QFNVEIIGDIELFVR  104 (468)
Q Consensus        90 ~~gi~v~s~~el~~~  104 (468)
                      +.+||+++-++.+..
T Consensus        93 ~~~Ip~~Tsi~~A~a  107 (110)
T cd01424          93 EYKVPYFTTLDTARA  107 (110)
T ss_pred             HCCCCEEECHHHHHH
T ss_conf             769999966999998


No 478
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed
Probab=92.24  E-value=0.43  Score=26.65  Aligned_cols=37  Identities=32%  Similarity=0.279  Sum_probs=27.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHH
Q ss_conf             9879998368548999999998598699981896478
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV   44 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~   44 (468)
                      =++|+|+|.|.-|-.+|..+...|+.|...|.++..+
T Consensus       313 i~~v~ViGaG~MG~GIA~~~a~aG~~V~l~D~~~e~l  349 (715)
T PRK11730        313 VKQAAVLGAGIMGGGIAYQSASKGVPVIMKDINQKAL  349 (715)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCEEEEEECCHHHH
T ss_conf             6279997877107999999995799579997899999


No 479
>PRK07577 short chain dehydrogenase; Provisional
Probab=92.23  E-value=0.35  Score=27.29  Aligned_cols=36  Identities=22%  Similarity=0.313  Sum_probs=31.1

Q ss_pred             HCCCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             18987999836-8548999999998598699981896
Q gi|254781099|r    6 FRNHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         6 ~~~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ++||++.|-|- ++-|+++|+.|.+.|++|...++++
T Consensus         1 L~~K~alITGas~GIG~aia~~la~~G~~Vv~~~r~~   37 (234)
T PRK07577          1 MSSRTVLVTGATKGIGLALSLRLANLGHQVIGIARSA   37 (234)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             9419899937788899999999998799999963475


No 480
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed
Probab=92.18  E-value=0.28  Score=27.89  Aligned_cols=32  Identities=22%  Similarity=0.433  Sum_probs=29.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      =|.|+|.|.+|+++|....+.|.+|.+.++.+
T Consensus        13 DVvVVG~G~AGl~AA~~Aae~Ga~VivlEK~~   44 (584)
T PRK12835         13 DVLVVGSGGGGMTAALTAAARGLDTLVVEKSA   44 (584)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             87998967899999999998899589996999


No 481
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihydrodipicolinate reductase (DapB) reduces the alpha,beta-unsaturated cyclic imine, dihydro-dipicolinate. This reaction is the second committed step in the biosynthesis of L-lysine and its precursor meso-diaminopimelate, which are critical for both protein and cell wall biosynthesis. The N-terminal domain of DapB binds the dinucleotide NADPH.
Probab=92.17  E-value=0.68  Score=25.27  Aligned_cols=82  Identities=22%  Similarity=0.251  Sum_probs=42.1

Q ss_pred             EEEEECC-CHHHHHHHHHHHH-CCCEEEE-EECCCHHH--H---HHH-HCCCEEECCCCCCCCCCCEEEECCCCCCCCCC
Q ss_conf             7999836-8548999999998-5986999-81896478--8---999-78989964531572258889988886856755
Q gi|254781099|r   10 SIAVFGL-GRSGLSAACALKD-SGVHVIA-WDDHPCAV--K---QAK-DMGIEVIDFREIPWSIISFLVLSPGIALTGEN   80 (468)
Q Consensus        10 ~v~i~G~-G~sG~s~A~~l~~-~G~~V~~-~D~~~~~~--~---~l~-~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~   80 (468)
                      ||+|.|. |+=|+.+++...+ .++++++ .|.+....  .   .+. ..++.+....+.....+|++|=     .+.|+
T Consensus         2 kV~i~Ga~GrMG~~i~~~i~~~~~~~lv~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~DVvID-----FS~p~   76 (122)
T pfam01113         2 KVAVVGASGRMGRELIKAILEAPDFELVAAVDRPGSSLLGSDAGELAGPLGVPVTDDLEEVLADADVLID-----FTTPE   76 (122)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCEECCCHHHHCCCCCEEEE-----ECCHH
T ss_conf             8999889887899999999858996899999438961225431001467871112447775157888999-----06878


Q ss_pred             C-CHHHHHHHHCCCEEE
Q ss_conf             7-888999997698099
Q gi|254781099|r   81 A-HWCVKLANQFNVEII   96 (468)
Q Consensus        81 ~-~~~~~~a~~~gi~v~   96 (468)
                      . ...++.+.+.++|++
T Consensus        77 ~~~~~~~~~~~~~~~~V   93 (122)
T pfam01113        77 ATLENLELALKHGKPLV   93 (122)
T ss_pred             HHHHHHHHHHHCCCCEE
T ss_conf             99999999996799889


No 482
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems. Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems that share homology with a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily, which consists of two domains connected by a three-stranded hinge. The substrate specificity of this group is not known, but it is predicted to be involved in the transport of sugar-containing molecules and chemotaxis.
Probab=92.15  E-value=0.91  Score=24.39  Aligned_cols=66  Identities=21%  Similarity=0.198  Sum_probs=44.5

Q ss_pred             HHHHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCEEEE
Q ss_conf             9999999859869998189647889997898996453157225888998888685675578889999976980998
Q gi|254781099|r   22 SAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIG   97 (468)
Q Consensus        22 s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~~a~~~gi~v~s   97 (468)
                      ++-....+.|++|...|.+....++...       ......+..|.+|++|.   +.....+.+++|++.||||+.
T Consensus        20 g~~~~a~~~G~~v~~~~~~~d~~~Q~~~-------i~~~i~~~vd~iii~~~---d~~~~~~~~~~a~~aGIPVv~   85 (282)
T cd06318          20 AAKAHAKALGYELISTDAQGDLTKQIAD-------VEDLLTRGVNVLIINPV---DPEGLVPAVAAAKAAGVPVVV   85 (282)
T ss_pred             HHHHHHHHCCCEEEEECCCCCHHHHHHH-------HHHHHHCCCCEEEEECC---CHHHHHHHHHHHHHCCCCEEE
T ss_conf             9999999729999997699999999999-------99999769987998116---805669999999977998899


No 483
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins. Members of this subfamily have an LDH-like structure and an MDH enzymatic activity. Some members, like MJ0490 from Methanococcus jannaschii, exhibit both MDH and LDH activities. Tetrameric MDHs, including those from phototrophic bacteria, are more similar to LDHs than to other MDHs. LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH-like MDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenas
Probab=92.12  E-value=0.92  Score=24.37  Aligned_cols=68  Identities=19%  Similarity=0.188  Sum_probs=43.8

Q ss_pred             EEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHH----HHHHH----CC--CEEECC-CCCCCCCCCEEEECCCCCCCC
Q ss_conf             9998368548999999998598-699981896478----89997----89--899645-315722588899888868567
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAV----KQAKD----MG--IEVIDF-REIPWSIISFLVLSPGIALTG   78 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~----~~l~~----~g--~~~~~~-~~~~~~~~d~vv~Spgi~~~~   78 (468)
                      |.|+|.|.-|.++|-.|..+|. ++..+|.++...    ..|..    .+  ..+... ......+.|+||++.|+|...
T Consensus         1 V~IIGaG~VG~~~a~~l~~~~~~el~L~D~~~~~a~g~a~DL~~~~~~~~~~~~v~~~~d~~~~~daDvvVitaG~~~k~   80 (300)
T cd01339           1 ISIIGAGNVGATLAQLLALKELGDVVLLDIVEGLPQGKALDISQAAPILGSDTKVTGTNDYEDIAGSDVVVITAGIPRKP   80 (300)
T ss_pred             CEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCHHHHCCCCEEEEECCCCCCC
T ss_conf             98989688899999999857996799980999800579887761320158985899478879947998999906778998


No 484
>PRK07074 short chain dehydrogenase; Provisional
Probab=92.10  E-value=0.6  Score=25.64  Aligned_cols=42  Identities=26%  Similarity=0.272  Sum_probs=33.8

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHH
Q ss_conf             987999836-854899999999859869998189647889997
Q gi|254781099|r    8 NHSIAVFGL-GRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD   49 (468)
Q Consensus         8 ~k~v~i~G~-G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~   49 (468)
                      ||.++|-|- ++-|+++|+.|.+.|++|..+|.+...++++..
T Consensus         2 nKvalITGgs~GIG~aia~~la~~Ga~V~~~~r~~~~~~~~~~   44 (256)
T PRK07074          2 SRTALVTGAAGGIGQALARRFLAAGDRVLALDIDRAALAAFVD   44 (256)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHH
T ss_conf             9889998846899999999999869999999798899999999


No 485
>PRK05708 2-dehydropantoate 2-reductase; Provisional
Probab=92.09  E-value=0.65  Score=25.43  Aligned_cols=44  Identities=20%  Similarity=0.223  Sum_probs=37.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHCCC
Q ss_conf             87999836854899999999859869998189647889997898
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGI   52 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~~~g~   52 (468)
                      -||+|+|.|--|--.|-.|.+.|++|+..+..+.....+...|.
T Consensus         3 MkI~IiGaGAiG~~~a~~L~~ag~dV~lv~r~~~~~~~~~~~g~   46 (305)
T PRK05708          3 MTWHILGAGSLGSLWACRLARAGLPVRLILRDRQRLAAYQQAGG   46 (305)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHCCC
T ss_conf             88999882399999999998489973999947899999997899


No 486
>COG1231 Monoamine oxidase [Amino acid transport and metabolism]
Probab=92.08  E-value=0.31  Score=27.66  Aligned_cols=35  Identities=31%  Similarity=0.517  Sum_probs=0.0

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             89879998368548999999998598699981896
Q gi|254781099|r    7 RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus         7 ~~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      ++..|.|+|.|.+|+++|..|.+.|++|..-..++
T Consensus         6 ~~~~viivGaGlaGL~AA~eL~kaG~~v~ilEar~   40 (450)
T COG1231           6 KTADVIIVGAGLAGLSAAYELKKAGYQVQILEARD   40 (450)
T ss_pred             CCCCEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             88868998972688899998764681899986467


No 487
>PRK08674 bifunctional phosphoglucose/phosphomannose isomerase; Validated
Probab=92.07  E-value=0.9  Score=24.45  Aligned_cols=80  Identities=24%  Similarity=0.249  Sum_probs=0.0

Q ss_pred             CEEEEECCCHHHHHH--HHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEECCCCCCCCCCCCHHHH
Q ss_conf             879998368548999--999998598699981896478899978989964531572258889988886856755788899
Q gi|254781099|r    9 HSIAVFGLGRSGLSA--ACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVK   86 (468)
Q Consensus         9 k~v~i~G~G~sG~s~--A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~Spgi~~~~~~~~~~~~   86 (468)
                      .+|.|.|+|+||.+-  ++.+.....+|-+.=               ..++.-..+-+.+-+|+.-..+=+-.+.-..++
T Consensus        35 ~~Ivi~GmGGS~i~Gdv~~~l~~~~~~iPv~v---------------~~~y~lP~~v~~~tLVIavSySGnTeETL~a~~   99 (328)
T PRK08674         35 DNIVISGMGGSGIGGDLLRSLLLDEWKKPVFV---------------VRDYFLPAFVDRKTLVIAVSYSGNTEETLSAVE   99 (328)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHCCCCCCEEE---------------ECCCCCCCCCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             72999957564899999999984479986798---------------558879986588857999828999779999999


Q ss_pred             HHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCC
Q ss_conf             99976980998303422334301568868996034575
Q gi|254781099|r   87 LANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK  124 (468)
Q Consensus        87 ~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GK  124 (468)
                      +|+++|.++                    |+|| |.||
T Consensus       100 ~A~~rga~v--------------------i~It-sGG~  116 (328)
T PRK08674        100 QAKKRGAKI--------------------IAIT-SGGK  116 (328)
T ss_pred             HHHHCCCCE--------------------EEEE-CCCC
T ss_conf             999759958--------------------9994-8970


No 488
>PRK08294 phenol 2-monooxygenase; Provisional
Probab=91.97  E-value=0.096  Score=31.16  Aligned_cols=43  Identities=21%  Similarity=0.370  Sum_probs=0.0

Q ss_pred             EEEECCCHHHHHHHHHHHH-CCCEEEEEECCCHHHHHHHHCCCE
Q ss_conf             9998368548999999998-598699981896478899978989
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKD-SGVHVIAWDDHPCAVKQAKDMGIE   53 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~-~G~~V~~~D~~~~~~~~l~~~g~~   53 (468)
                      |+|+|.|-+|+.+|..|.+ +|..+.+.|+++.....-+..|+.
T Consensus        35 VLIVGAGP~GL~lA~~Lar~~Gv~~~IIDk~~~~~~~~rA~gl~   78 (634)
T PRK08294         35 VLIVGCGPAGLILAAQLSQFPEITTRIVERKPGRLELGQADGIA   78 (634)
T ss_pred             EEEECCCHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEC
T ss_conf             89999658999999998713799889992799999998837777


No 489
>KOG0023 consensus
Probab=91.96  E-value=0.62  Score=25.58  Aligned_cols=48  Identities=23%  Similarity=0.315  Sum_probs=0.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHHCCCEEE
Q ss_conf             9879998368548999999998598699981896-47889997898996
Q gi|254781099|r    8 NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP-CAVKQAKDMGIEVI   55 (468)
Q Consensus         8 ~k~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~-~~~~~l~~~g~~~~   55 (468)
                      |++|+|.|+|+-|-=..+|....|++|++.|... ...+.++.+|.+.+
T Consensus       182 G~~vgI~GlGGLGh~aVq~AKAMG~rV~vis~~~~kkeea~~~LGAd~f  230 (360)
T KOG0023         182 GKWVGIVGLGGLGHMAVQYAKAMGMRVTVISTSSKKKEEAIKSLGADVF  230 (360)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHCCEEEEEECCCHHHHHHHHHCCCCEE
T ss_conf             8689885576401689999987086799992785348999985496215


No 490
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only]
Probab=91.95  E-value=0.28  Score=27.91  Aligned_cols=29  Identities=41%  Similarity=0.735  Sum_probs=0.0

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEC
Q ss_conf             99983685489999999985986999818
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDD   39 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~   39 (468)
                      |.|+|.|..|+++|..|.+.|.+|+++|+
T Consensus         4 iaIVGaGiAGl~aA~~L~~aG~~vtV~eK   32 (331)
T COG3380           4 IAIVGAGIAGLAAAYALREAGREVTVFEK   32 (331)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             79975636889999999866957999973


No 491
>KOG1201 consensus
Probab=91.94  E-value=0.96  Score=24.24  Aligned_cols=136  Identities=15%  Similarity=0.185  Sum_probs=0.0

Q ss_pred             CCHHHCCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCC----HHHHHHHHCCCEEECCCC---------------CC
Q ss_conf             8132189879998368-548999999998598699981896----478899978989964531---------------57
Q gi|254781099|r    2 KLSSFRNHSIAVFGLG-RSGLSAACALKDSGVHVIAWDDHP----CAVKQAKDMGIEVIDFRE---------------IP   61 (468)
Q Consensus         2 ~~~~~~~k~v~i~G~G-~sG~s~A~~l~~~G~~V~~~D~~~----~~~~~l~~~g~~~~~~~~---------------~~   61 (468)
                      +..+..|+.|+|=|-| +-|+.+|.-+.++|+++..+|.++    ++.++..+.|-....--+               ..
T Consensus        32 ~~k~v~g~~vLITGgg~GlGr~ialefa~rg~~~vl~Din~~~~~etv~~~~~~g~~~~y~cdis~~eei~~~a~~Vk~e  111 (300)
T KOG1201          32 PLKSVSGEIVLITGGGSGLGRLIALEFAKRGAKLVLWDINKQGNEETVKEIRKIGEAKAYTCDISDREEIYRLAKKVKKE  111 (300)
T ss_pred             CHHHCCCCEEEEECCCCHHHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             33440698899968986078999999997078489995565123999999984485258995589889999999999986


Q ss_pred             CCCCCEEEECCCCCCCCCCCCHHHHHHHHC-CCEEEEEH----HHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHH
Q ss_conf             225888998888685675578889999976-98099830----3422334301568868996034575215789999998
Q gi|254781099|r   62 WSIISFLVLSPGIALTGENAHWCVKLANQF-NVEIIGDI----ELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLR  136 (468)
Q Consensus        62 ~~~~d~vv~Spgi~~~~~~~~~~~~~a~~~-gi~v~s~~----el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~  136 (468)
                      ....|.+|=..||.+..+-.+.-=++.++- .+.+.+..    +|+..+.+..  +.-+|+|.-.-|+.++..+...--+
T Consensus       112 ~G~V~ILVNNAGI~~~~~ll~~~d~ei~k~~~vN~~~~f~t~kaFLP~M~~~~--~GHIV~IaS~aG~~g~~gl~~YcaS  189 (300)
T KOG1201         112 VGDVDILVNNAGIVTGKKLLDCSDEEIQKTFDVNTIAHFWTTKAFLPKMLENN--NGHIVTIASVAGLFGPAGLADYCAS  189 (300)
T ss_pred             CCCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCEEEEEHHHHCCCCCCCCHHHHHH
T ss_conf             19954998366424488756799899999998766899999998738887457--9639983553313577653235651


Q ss_pred             HHH
Q ss_conf             731
Q gi|254781099|r  137 KNG  139 (468)
Q Consensus       137 ~~g  139 (468)
                      +.+
T Consensus       190 K~a  192 (300)
T KOG1201         190 KFA  192 (300)
T ss_pred             HHH
T ss_conf             899


No 492
>KOG1209 consensus
Probab=91.92  E-value=0.97  Score=24.23  Aligned_cols=120  Identities=19%  Similarity=0.211  Sum_probs=0.0

Q ss_pred             CCCHHHCCCEEEEECC--CHHHHHHHHHHHHCCCEEEEEECCCHHHHHHH-HCCCEEEC---------------CCCCCC
Q ss_conf             9813218987999836--85489999999985986999818964788999-78989964---------------531572
Q gi|254781099|r    1 MKLSSFRNHSIAVFGL--GRSGLSAACALKDSGVHVIAWDDHPCAVKQAK-DMGIEVID---------------FREIPW   62 (468)
Q Consensus         1 m~~~~~~~k~v~i~G~--G~sG~s~A~~l~~~G~~V~~~D~~~~~~~~l~-~~g~~~~~---------------~~~~~~   62 (468)
                      |.+-+ ..|.|+|.|-  |+.|-++|+-+++.|+.|..+-++-+...+|. ..|+....               ..+.+.
T Consensus         1 ~e~~~-~~k~VlItgcs~GGIG~ala~ef~~~G~~V~AtaR~~e~M~~L~~~~gl~~~kLDV~~~~~V~~v~~evr~~~~   79 (289)
T KOG1209           1 SELQS-QPKKVLITGCSSGGIGYALAKEFARNGYLVYATARRLEPMAQLAIQFGLKPYKLDVSKPEEVVTVSGEVRANPD   79 (289)
T ss_pred             CCCCC-CCCEEEEEECCCCCHHHHHHHHHHHCCEEEEEECCCCCHHHHHHHHHCCEEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             97556-79759996057765349999999867819999702246076678860970587056872778998888861899


Q ss_pred             CCCCEEEECCCCCCCCCCCCHHHHHHHHC-CCEEEEEHHHHHHHHHHCCCCCCEEEEECC
Q ss_conf             25888998888685675578889999976-980998303422334301568868996034
Q gi|254781099|r   63 SIISFLVLSPGIALTGENAHWCVKLANQF-NVEIIGDIELFVRERRFSSLQSPFIAVTGT  121 (468)
Q Consensus        63 ~~~d~vv~Spgi~~~~~~~~~~~~~a~~~-gi~v~s~~el~~~~~~~~~~~~~vI~VTGT  121 (468)
                      ...|+++-..|.+-..|-...-+.+-.+- +..+.+.|-.--..........-.|--+||
T Consensus        80 Gkld~L~NNAG~~C~~Pa~d~~i~ave~~f~vNvfG~irM~~a~~h~likaKGtIVnvgS  139 (289)
T KOG1209          80 GKLDLLYNNAGQSCTFPALDATIAAVEQCFKVNVFGHIRMCRALSHFLIKAKGTIVNVGS  139 (289)
T ss_pred             CCEEEEECCCCCCCCCCCCCCCHHHHHHHHCCCEEEEEHHHHHHHHHHHHCCCEEEEECC
T ss_conf             826888717998765523468789998640211234343889999999872664997445


No 493
>cd05014 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5-phosphate isomerase which contains SIS (Sugar ISomerase) domains. SIS domains are found in many phosphosugar isomerases and phosphosugar binding proteins. KpsF catalyzes the reversible reaction of ribulose 5-phosphate to arabinose 5-phosphate. This is the second step in the CMP-Kdo biosynthesis pathway.
Probab=91.89  E-value=0.77  Score=24.91  Aligned_cols=74  Identities=18%  Similarity=0.120  Sum_probs=0.0

Q ss_pred             EEEEECCCHHHHHH---HHHHHHCCCEEEEEECCCHHHHHHHHCCCEEECCCCCCCCCCCEEEE-CCCCCCCCCCCCHHH
Q ss_conf             79998368548999---99999859869998189647889997898996453157225888998-888685675578889
Q gi|254781099|r   10 SIAVFGLGRSGLSA---ACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL-SPGIALTGENAHWCV   85 (468)
Q Consensus        10 ~v~i~G~G~sG~s~---A~~l~~~G~~V~~~D~~~~~~~~l~~~g~~~~~~~~~~~~~~d~vv~-Spgi~~~~~~~~~~~   85 (468)
                      ||.|+|+|.||..+   +.-|.+.|......++.            ............-|++|. |  .+-..++.....
T Consensus         2 RI~~~GvG~S~~va~~~~~kl~r~G~~s~~~~~~------------~~~~~~~~~i~~~Dv~i~iS--~SG~T~e~~~~~   67 (128)
T cd05014           2 KVVVTGVGKSGHIARKIAATLSSTGTPAFFLHPT------------EALHGDLGMVTPGDVVIAIS--NSGETDELLNLL   67 (128)
T ss_pred             EEEEEECCHHHHHHHHHHHHHHHCCCCEEECCCH------------HHHHCCCCCCCCCCEEEEEE--CCCCCHHHHHHH
T ss_conf             4999942679999999999999579945754731------------55541134778999999997--999986799999


Q ss_pred             HHHHHCCCEEEE
Q ss_conf             999976980998
Q gi|254781099|r   86 KLANQFNVEIIG   97 (468)
Q Consensus        86 ~~a~~~gi~v~s   97 (468)
                      +.|++.|+++++
T Consensus        68 ~~ak~~g~~vI~   79 (128)
T cd05014          68 PHLKRRGAPIIA   79 (128)
T ss_pred             HHHHHCCCCEEE
T ss_conf             999863785899


No 494
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism]
Probab=91.86  E-value=0.98  Score=24.18  Aligned_cols=349  Identities=11%  Similarity=0.028  Sum_probs=0.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHCCC-EEEEEECCCHHHHHHHHCCCEEECCCCCC-----CCCCCEEEECCCCCCCCCCCC
Q ss_conf             879998368548999999998598-69998189647889997898996453157-----225888998888685675578
Q gi|254781099|r    9 HSIAVFGLGRSGLSAACALKDSGV-HVIAWDDHPCAVKQAKDMGIEVIDFREIP-----WSIISFLVLSPGIALTGENAH   82 (468)
Q Consensus         9 k~v~i~G~G~sG~s~A~~l~~~G~-~V~~~D~~~~~~~~l~~~g~~~~~~~~~~-----~~~~d~vv~Spgi~~~~~~~~   82 (468)
                      .+++|+|.|.+|..+++.++.... .+.++=+..+.....+-.|+.+....+..     ...-..++--|++...  +-.
T Consensus       117 ~r~lIiGAG~ag~~l~r~~~~~~~~~pV~fiDdd~~~~g~~i~Gv~V~g~~~i~~~v~~~~~~~iiiAips~~~~--~~~  194 (588)
T COG1086         117 IRLLIIGAGSAGDLLLRALRRDPEYTPVAFLDDDPDLTGMKIRGVPVLGRIEIERVVEELGIQLILIAIPSASQE--ERR  194 (588)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCCEEEEECCCHHHCCCEEECEEEECHHHHHHHHHHCCCCEEEEECCCCCHH--HHH
T ss_conf             866999376589999999974899615999888736518877022642314799999971876699964878899--999


Q ss_pred             HHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH----CCCCCCCCCCCCC-CCC
Q ss_conf             88999997698099830342233430156886899603457521578999999873100----0000012443221-101
Q gi|254781099|r   83 WCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYD----VQLGGNIGLPILN-LEY  157 (468)
Q Consensus        83 ~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~GKTTt~~ll~~iL~~~g~~----~~~~GNiG~p~~~-~~~  157 (468)
                      ..++...+.++.|..=+.+.-...  ...+.+=|.|.-==|...+.--.+.+.....-+    +..+|-||.-++. +..
T Consensus       195 ~i~~~l~~~~~~v~~lP~~~~l~~--~~~~lreI~ieDLLgR~pV~~d~~~i~~~~~gK~vLVTGagGSiGsel~~qil~  272 (588)
T COG1086         195 RILLRLARTGIAVRILPQLTDLKD--LNGQLREIEIEDLLGRPPVALDTELIGAMLTGKTVLVTGGGGSIGSELCRQILK  272 (588)
T ss_pred             HHHHHHHHCCCCEEECCCHHHHHH--HCCCCCCCCHHHHHCCCCCCCCHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
T ss_conf             999998755970785574899987--324654377989738999987879998670798899968987367999999985


Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCEEEECCCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             68883799921775432122333221011100210122211100001122100010134432247867899987401234
Q gi|254781099|r  158 FSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG  237 (468)
Q Consensus       158 ~~~~~~~V~E~SSfQL~~~~~~~PdiavITNI~~DHLd~~~s~e~y~~aK~~i~~~~~~~iln~dd~~~~~~~~~~~~~~  237 (468)
                      .++.++.+++-|    |+...                    .++...+.|..   ..+...+..|=.+...+..-.+...
T Consensus       273 ~~p~~i~l~~~~----E~~~~--------------------~i~~el~~~~~---~~~~~~~igdVrD~~~~~~~~~~~k  325 (588)
T COG1086         273 FNPKEIILFSRD----EYKLY--------------------LIDMELREKFP---ELKLRFYIGDVRDRDRVERAMEGHK  325 (588)
T ss_pred             CCCCEEEEECCC----HHHHH--------------------HHHHHHHHHCC---CCCEEEEECCCCCHHHHHHHHHCCC
T ss_conf             498789996176----37799--------------------99999986278---7516899635346899999986388


Q ss_pred             CEEECCCCCCCCCCCCEEECCCEEEECCCCCCCCCCCCCCCCHHHHHCCCHHHHHHCCCCCCCCCHHHCCCHHHHHHHHH
Q ss_conf             30110364432223411212413541467642123455885101110011012221022222110000000013454433
Q gi|254781099|r  238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQ  317 (468)
Q Consensus       238 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~G~HNi~NalaAia~a~~lGi~~~~i~~~L~~f~gv~~R~E  317 (468)
                      ..+.......           ..+..-..+.......++.|.-|+.++.....+....-+|.|+...-.+-+-..++=+|
T Consensus       326 vd~VfHAAA~-----------KHVPl~E~nP~Eai~tNV~GT~nv~~aa~~~~V~~~V~iSTDKAV~PtNvmGaTKr~aE  394 (588)
T COG1086         326 VDIVFHAAAL-----------KHVPLVEYNPEEAIKTNVLGTENVAEAAIKNGVKKFVLISTDKAVNPTNVMGATKRLAE  394 (588)
T ss_pred             CCEEEEHHHH-----------CCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             8668875555-----------36863101889999872173899999999839778999705866688417668899999


Q ss_pred             HHCCCCCCEEECCCCCCCHHHHHHHHHCCCCCCEEEECCCCCCCCHHHHHHHHCCCCEEEEECCCHHHHHHHHHCCCCEE
Q ss_conf             21003430000023556755555532013332001203210122068989984278689998899899888631689889
Q gi|254781099|r  318 TIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST  397 (468)
Q Consensus       318 ~i~~~~gv~iIDDS~atnp~a~~~Al~~~~~~i~lI~GG~~K~~d~~~L~~~~~~~~~~~liG~~~~~i~~~~~~~~~~~  397 (468)
                      .+...-+...       +...|.-+.-+|.+    ++|  ++|.=..-+.+.+.+-.-+-+.-.+            =..
T Consensus       395 ~~~~a~~~~~-------~~~~T~f~~VRFGN----VlG--SrGSViPlFk~QI~~GgplTvTdp~------------mtR  449 (588)
T COG1086         395 KLFQAANRNV-------SGTGTRFCVVRFGN----VLG--SRGSVIPLFKKQIAEGGPLTVTDPD------------MTR  449 (588)
T ss_pred             HHHHHHHHCC-------CCCCCEEEEEEECC----EEC--CCCCCHHHHHHHHHCCCCCCCCCCC------------CEE
T ss_conf             9999974104-------88885799998254----545--8877778899999759984546867------------056


Q ss_pred             EECCHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             987999999999999984489859994
Q gi|254781099|r  398 LSKTLDQALKSVVRDVENVQLPSIVLF  424 (468)
Q Consensus       398 ~~~~~~~a~~~i~~~~~~~~~gDiVLl  424 (468)
                      .+-+++||++.+.++.+..+.||+-.|
T Consensus       450 yfMTI~EAv~LVlqA~a~~~gGeifvl  476 (588)
T COG1086         450 FFMTIPEAVQLVLQAGAIAKGGEIFVL  476 (588)
T ss_pred             EEEEHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             788899999999998750689858998


No 495
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase. All of these enzymes contain three Pfam domains, pfam03721, pfam00984, and pfam03720 for the N-terminal, central, and C-terminal regions respectively.
Probab=91.84  E-value=0.29  Score=27.86  Aligned_cols=77  Identities=16%  Similarity=0.158  Sum_probs=34.6

Q ss_pred             HHCCCCCCEEEECCC-------CCCCCHHHHHHHHC-CCCEEEEECCCHHHHHHHHHCCCCEEEECCHHHHHHHHHHHHH
Q ss_conf             201333200120321-------01220689899842-7868999889989988863168988998799999999999998
Q gi|254781099|r  343 FLNEKRRIYWIAGGL-------SKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE  414 (468)
Q Consensus       343 l~~~~~~i~lI~GG~-------~K~~d~~~L~~~~~-~~~~~~liG~~~~~i~~~~~~~~~~~~~~~~~~a~~~i~~~~~  414 (468)
                      +....++.++|+|=-       -|+..-.++.+.+. +-..+.++-.-...  +....   .....++++++        
T Consensus       308 l~~~~~~~I~ilGlafK~~tdD~R~Sps~~ii~~L~~~g~~V~~~DP~v~~--~~~~~---~~~~~~~~~~~--------  374 (411)
T TIGR03026       308 LGPLKGKTVLILGLAFKPNTDDVRESPALDIIELLKEKGAKVKAYDPLVPE--EEVKG---LPLIDDLEEAL--------  374 (411)
T ss_pred             HHCCCCCEEEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCH--HHHHC---CCCCCCHHHHH--------
T ss_conf             631166613787411069998534582999999999788989999998998--99812---77779999998--------


Q ss_pred             HCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             44898599945221663134798
Q gi|254781099|r  415 NVQLPSIVLFSPGCASFDQYNNF  437 (468)
Q Consensus       415 ~~~~gDiVLlSPa~aS~d~f~~y  437 (468)
                        +.-|.|++.   .-+++|++.
T Consensus       375 --~~aD~iii~---t~h~ef~~l  392 (411)
T TIGR03026       375 --KGADALVIL---TDHDEFKDL  392 (411)
T ss_pred             --HCCCEEEEE---CCCHHHHCC
T ss_conf             --469889995---598667238


No 496
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed
Probab=91.83  E-value=0.32  Score=27.52  Aligned_cols=31  Identities=26%  Similarity=0.517  Sum_probs=0.0

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             9998368548999999998598699981896
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
                      |.|+|.|.+|+++|....++|.+|.+.++.+
T Consensus         8 VVVVGaG~AGl~AAi~Aae~Ga~VivlEK~~   38 (560)
T PRK07843          8 VVVVGSGAAGMVAALTAAHRGLSTVVVEKAP   38 (560)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             8998967899999999998899889996999


No 497
>PRK10416 cell division protein FtsY; Provisional
Probab=91.82  E-value=0.099  Score=31.05  Aligned_cols=30  Identities=27%  Similarity=0.578  Sum_probs=0.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8996034575215789999998731000000
Q gi|254781099|r  115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLG  145 (468)
Q Consensus       115 vI~VTGT~GKTTt~~ll~~iL~~~g~~~~~~  145 (468)
                      +|||-|+ |||||..=|++.|++.|+++.++
T Consensus       300 ~vGvNG~-GKTTTigKLA~~~~~~gkkVlla  329 (499)
T PRK10416        300 MVGVNGV-GKTTTIGKLARQFEQQGKSVMLA  329 (499)
T ss_pred             EECCCCC-CHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9747878-78989999999999779953788


No 498
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional
Probab=91.79  E-value=0.33  Score=27.43  Aligned_cols=31  Identities=39%  Similarity=0.558  Sum_probs=0.0

Q ss_pred             EEEECCCHHHHHHHHHHHHCC--CEEEEEECCC
Q ss_conf             999836854899999999859--8699981896
Q gi|254781099|r   11 IAVFGLGRSGLSAACALKDSG--VHVIAWDDHP   41 (468)
Q Consensus        11 v~i~G~G~sG~s~A~~l~~~G--~~V~~~D~~~   41 (468)
                      |.|+|.|..|+++|..|.+.|  .+|...|..+
T Consensus         4 V~IVGaGpvGl~lAl~L~~~G~~~~v~vie~~~   36 (403)
T PRK07333          4 VVIAGGGYVGLALAVALKQAAPHLPVIVVDAAP   36 (403)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             999994699999999998469996699982886


No 499
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=91.78  E-value=0.27  Score=28.03  Aligned_cols=54  Identities=19%  Similarity=0.162  Sum_probs=0.0

Q ss_pred             HHHHHHHHCCCEEEEEHHHHHHHHHHCCCCCCEEEEECCC--CCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8899999769809983034223343015688689960345--75215789999998731000000
Q gi|254781099|r   83 WCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN--GKSSTVALISHVLRKNGYDVQLG  145 (468)
Q Consensus        83 ~~~~~a~~~gi~v~s~~el~~~~~~~~~~~~~vI~VTGT~--GKTTt~~ll~~iL~~~g~~~~~~  145 (468)
                      +++......++++         .......+.+||+.-|-|  |||||..=|++-|...|+++.++
T Consensus       185 ~~~~~~~~~~~~~---------~~~~~l~~g~VIaLVGvnGvGKTTTiAKLA~~l~~~gkkV~LV  240 (407)
T PRK12726        185 DWFVPYLSGKLAV---------EDSFDLSNHRIISLIGQTGVGKTTTLVKLGWQLLKQNRTVGFI  240 (407)
T ss_pred             HHHHHHHCCCCCC---------CCEEEECCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8999975389770---------3202303690899989998978999999999999779917999


No 500
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase. Nitrogenase is responsible for the biological nitrogen fixation, i.e. reduction of molecular nitrogen to ammonia. NifH consists of two oxygen-sensitive metallosulfur proteins: the mollybdenum-iron (alternatively, vanadium-iron or iron-iron) protein (commonly referred to as component 1), and the iron protein (commonly referred to as component 2). The iron protein is a homodimer, with an Fe4S4 cluster bound between the subunits and two ATP-binding domains. It supplies energy by ATP hydrolysis, and transfers electrons from reduced ferredoxin or flavodoxin to component 1 for the reduction of molecular nitrogen to ammonia.
Probab=91.72  E-value=0.14  Score=29.92  Aligned_cols=31  Identities=35%  Similarity=0.394  Sum_probs=0.0

Q ss_pred             CEEEEE--CCCCCCHHHHHHHHHHHHHHHHCCC
Q ss_conf             689960--3457521578999999873100000
Q gi|254781099|r  114 PFIAVT--GTNGKSSTVALISHVLRKNGYDVQL  144 (468)
Q Consensus       114 ~vI~VT--GT~GKTTt~~ll~~iL~~~g~~~~~  144 (468)
                      ++|||+  |=.|||||+-=|+..|.+.|++|.+
T Consensus         2 r~Iai~GKGGVGKTTtavNLA~aLa~~GkkVll   34 (270)
T cd02040           2 RQIAIYGKGGIGKSTTTQNLSAALAEMGKKVMI   34 (270)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             589997998577899999999999987994999


Done!