HHsearch alignment for GI: 254781099 and conserved domain: pfam00070

>pfam00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase. This family includes both class I and class II oxidoreductases and also NADH oxidases and peroxidases. This domain is actually a small NADH binding domain within a larger FAD binding domain.
Probab=93.65  E-value=0.26  Score=28.13  Aligned_cols=32  Identities=31%  Similarity=0.375  Sum_probs=29.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEECCC
Q ss_conf             79998368548999999998598699981896
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKDSGVHVIAWDDHP   41 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~~G~~V~~~D~~~   41 (468)
T Consensus         1 rv~iiGgG~ig~E~A~~l~~~G~~Vtiie~~~   32 (82)
T pfam00070         1 RVVVVGGGYIGLEFASALAKLGSKVTVVERRD   32 (82)
T ss_pred             CEEEECCCHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             99999988999999999986392789981257