HHsearch alignment for GI: 254781099 and conserved domain: pfam01408

>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
Probab=95.72  E-value=0.093  Score=31.23  Aligned_cols=86  Identities=13%  Similarity=0.195  Sum_probs=54.0

Q ss_pred             EEEEECCCHHHHHHHHHHHH--CCCEEE-EEECCCHHHHHHH-HCCCEEECC-CCC-CCCCCCEEEECCCCCCCCCCCCH
Q ss_conf             79998368548999999998--598699-9818964788999-789899645-315-72258889988886856755788
Q gi|254781099|r   10 SIAVFGLGRSGLSAACALKD--SGVHVI-AWDDHPCAVKQAK-DMGIEVIDF-REI-PWSIISFLVLSPGIALTGENAHW   83 (468)
Q Consensus        10 ~v~i~G~G~sG~s~A~~l~~--~G~~V~-~~D~~~~~~~~l~-~~g~~~~~~-~~~-~~~~~d~vv~Spgi~~~~~~~~~   83 (468)
T Consensus         2 ki~iiG~G~~g~~~~~~~~~~~~~~~i~ai~d~~~~~~~~~~~~~~~~~~~~~~~~l~~~~iD~v~I~t--p~--~~H~~   77 (120)
T pfam01408         2 RVGIVGAGKIGRRHLRALNESQDGAELVGVLDPDPARAEAVAESFGVPAYSDLEELLADPDVDAVSVAT--PP--GLHFE   77 (120)
T ss_pred             EEEEEECHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCEECCHHHHHHCCCCCEEEECC--CH--HHHHH
T ss_conf             899990779999999999855999789999829999999999983996788699997377889899908--74--61899


Q ss_pred             HHHHHHHCCCEEEEEH
Q ss_conf             8999997698099830
Q gi|254781099|r   84 CVKLANQFNVEIIGDI   99 (468)
Q Consensus        84 ~~~~a~~~gi~v~s~~   99 (468)
T Consensus        78 ~~~~~l~~g~~v~~EK   93 (120)
T pfam01408        78 LALAALEAGKHVLVEK   93 (120)
T ss_pred             HHHHHHHHCCEEEEEC
T ss_conf             9999998199899968