HHsearch alignment for GI: 254781099 and conserved domain: pfam02875

>pfam02875 Mur_ligase_C Mur ligase family, glutamate ligase domain. This family contains a number of related ligase enzymes which have EC numbers 6.3.2.*. This family includes: MurC, MurD, MurE, MurF, Mpl and FolC. MurC, MurD, Mure and MurF catalyse consecutive steps in the synthesis of peptidoglycan. Peptidoglycan consists of a sheet of two sugar derivatives, with one of these N-acetylmuramic acid attaching to a small pentapeptide. The pentapeptide is is made of L-alanine, D-glutamic acid, Meso-diaminopimelic acid and D-alanyl alanine. The peptide moiety is synthesized by successively adding these amino acids to UDP-N-acetylmuramic acid. MurC transfers the L-alanine, MurD transfers the D-glutamate, MurE transfers the diaminopimelic acid, and MurF transfers the D-alanyl alanine. This family also includes Folylpolyglutamate synthase that transfers glutamate to folylpolyglutamate.
Probab=98.51  E-value=8.5e-08  Score=72.91  Aligned_cols=70  Identities=20%  Similarity=0.321  Sum_probs=52.4

Q ss_pred             HHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHCC----CCCCEEEEC-CCCCCCCHHH-HHHHHCCCCEEEEECCC
Q ss_conf             45443321003430000023556755555532013----332001203-2101220689-89984278689998899
Q gi|254781099|r  312 LTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE----KRRIYWIAG-GLSKSDDFST-LFPFISKIAKAYFIGNS  382 (468)
Q Consensus       312 v~~R~E~i~~~~gv~iIDDS~atnp~a~~~Al~~~----~~~i~lI~G-G~~K~~d~~~-L~~~~~~~~~~~liG~~  382 (468)
T Consensus         1 vpGR~e~i~~~~~~~vi~D-yaHnp~~~~a~l~~~~~~~~~r~i~V~G~~g~r~~~~r~~~g~~a~~~ad~viit~~   76 (87)
T pfam02875         1 VPGRLEVVGENNGVLVIDD-YAHNPDALEAALQALKELFDGRLILVFGAGGDRDAEFHALLGALAAALADVVILTGD   76 (87)
T ss_pred             CCCCCEEEECCCCCEEEEE-CCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             9997389865899789996-789969999999999862688789999998888678999999999971999999998