HHsearch alignment for GI: 254781099 and conserved domain: pfam05221

>pfam05221 AdoHcyase S-adenosyl-L-homocysteine hydrolase.
Probab=95.23  E-value=0.057  Score=32.71  Aligned_cols=52  Identities=15%  Similarity=0.080  Sum_probs=34.9

Q ss_pred             HHCCCEEEEECCCHHHH-H-HHHHHHHCCCEEEEEECCCHHH-----HHHHHCCCEEECC
Q ss_conf             21898799983685489-9-9999998598699981896478-----8999789899645
Q gi|254781099|r    5 SFRNHSIAVFGLGRSGL-S-AACALKDSGVHVIAWDDHPCAV-----KQAKDMGIEVIDF   57 (468)
Q Consensus         5 ~~~~k~v~i~G~G~sG~-s-~A~~l~~~G~~V~~~D~~~~~~-----~~l~~~g~~~~~~   57 (468)
T Consensus        40 Pl~G~rI~~~-lHle~kTA~L~~tL~~~GA~V~~~~~NplSTQDdvaAaL~~~Gi~VfA~   98 (430)
T pfam05221        40 PLKGARIAGC-LHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAW   98 (430)
T ss_pred             CCCCCEEEEE-EECHHHHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHCCCEEEEE
T ss_conf             9999889999-8317999999999998598799965897532379999999679769993