BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781099|ref|YP_003065512.1|
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus
Liberibacter asiaticus str. psy62]
         (468 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781099|ref|YP_003065512.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040776|gb|ACT57572.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 468

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/468 (100%), Positives = 468/468 (100%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI
Sbjct: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG
Sbjct: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID
Sbjct: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI
Sbjct: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
           SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE
Sbjct: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS
Sbjct: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420
           DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS
Sbjct: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420

Query: 421 IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW 468
           IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW
Sbjct: 421 IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW 468


>gi|315122417|ref|YP_004062906.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495819|gb|ADR52418.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 468

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/468 (72%), Positives = 389/468 (83%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           M L +FRN  IAV GLGRSGLS   ALK+SG HVIAWDDH  ++ QAKDMGIE++DFR I
Sbjct: 1   MNLKNFRNRLIAVLGLGRSGLSVVGALKNSGAHVIAWDDHSHSLTQAKDMGIEIVDFRTI 60

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS IS L++SP I LTG+ AHWCVKLANQFNVEIIGDIELFVRERRFS+  SPFIAVTG
Sbjct: 61  QWSKISSLIVSPSIPLTGDKAHWCVKLANQFNVEIIGDIELFVRERRFSTFHSPFIAVTG 120

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKSSTV LISH+L +NGYDVQLGGNIG PILNL  FS +RFYVIECSSYQI+LTPTID
Sbjct: 121 TNGKSSTVMLISHILNQNGYDVQLGGNIGNPILNLADFSSHRFYVIECSSYQIDLTPTID 180

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PSIGVLLN+S DHLDRH+TLENY  IKKK+V  S+HA+IC+ND  C+ +A DM   GHS+
Sbjct: 181 PSIGVLLNVSIDHLDRHNTLENYARIKKKLVAKSQHAVICMNDDLCKTVASDMATAGHSM 240

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
           +RISSQ + SDSD YID S +KCS+TS+ IF  SQE +++N+ N+  S  VCM+LGLK++
Sbjct: 241 TRISSQPMPSDSDFYIDGSHIKCSSTSKTIFALSQEDRRYNMHNVAASIAVCMRLGLKID 300

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EIKRA+ S  GLTHRLQ IA+LG VIFINDSKATNLHSV+HAFLNEKR IYWI GGLSKS
Sbjct: 301 EIKRAISSFNGLTHRLQKIAQLGQVIFINDSKATNLHSVMHAFLNEKRVIYWIGGGLSKS 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420
           DDFS +FPF+SK+AKAYFIG+SA +F HH   K+   + +TLDQAL SVVRDV N  +PS
Sbjct: 361 DDFSIIFPFLSKVAKAYFIGDSATIFAHHLREKVECDVFQTLDQALTSVVRDVVNTTIPS 420

Query: 421 IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDIEEERKSLW 468
           +VLFSPGCASFDQY NF+ERGFSFMSQVSEI  I+MLVDIEEERK  W
Sbjct: 421 VVLFSPGCASFDQYKNFKERGFSFMSQVSEIKNIQMLVDIEEERKFPW 468


>gi|222149138|ref|YP_002550095.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Agrobacterium
           vitis S4]
 gi|221736123|gb|ACM37086.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Agrobacterium
           vitis S4]
          Length = 471

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 293/465 (63%), Gaps = 9/465 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +SSF + S+A+FGLG SGL+ A AL   G  V  WDD+P +V++A+  G+E  D R+I
Sbjct: 2   IPVSSFSDRSVALFGLGGSGLATARALVAGGAAVTVWDDNPDSVEKARAEGLEARDLRQI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS +S  VLSPG+ LT    HW V LA    VEIIGDIELFVRER+  +   PFIA+TG
Sbjct: 62  DWSGLSAFVLSPGVPLTHPKPHWTVDLARAAGVEIIGDIELFVRERQAKAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI H+LR NGYDVQ+GGNIG  +L LE  +P+R+YV+ECSSYQI+L P ID
Sbjct: 122 TNGKSTTTALIGHILRHNGYDVQIGGNIGTAVLTLEPPAPDRYYVVECSSYQIDLAPGID 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  +K+++V+ S  AII ++D  C +IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAVKERLVSGSDVAIIGVDDDYCLEIAKRLEEAGKEV 241

Query: 241 SRISSQSLQSDSDLYIDESFL--KCSATSEVIFDF---SQETKKHNIQNLVTSAVVCMQL 295
            RIS     +D  LY D   +       +EVI D    +     HN QN   +   CM +
Sbjct: 242 VRISKGQPLTDG-LYNDGQRIVRGSGGAAEVIADLNGIATLRGSHNAQNAAAAIAACMAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL  ++I+  L S  GL HR+Q + R GHV+F+NDSKATN  +   A L+   RIYWIAG
Sbjct: 301 GLSKDQIQAGLSSFAGLKHRMQPVGRRGHVVFVNDSKATNAEASAPA-LSSYERIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           GL K    ++L P   +IAKAY IG +A  F    G  +   +S TLD+AL     D ++
Sbjct: 360 GLPKQGGIASLSPLFPRIAKAYLIGEAASGFAATLGNAVAYEISGTLDRALAHASADAQD 419

Query: 416 VQLPS--IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
                   V+ SP CASFDQY NF  RG +F+S V+ +  + ML+
Sbjct: 420 DGNGGEVAVMLSPACASFDQYKNFEVRGEAFVSLVAGLDDVTMLI 464


>gi|153009072|ref|YP_001370287.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560960|gb|ABS14458.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 467

 Score =  405 bits (1040), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/463 (44%), Positives = 287/463 (61%), Gaps = 7/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAILAGGAKIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA+   VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAAFVLSPGVPLTHPKPHWTVDLAHAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++ +G D+QLGGNIG  IL LE    NRFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKASGRDMQLGGNIGTAILTLEPPQANRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AI+ ++D  CE IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASDTAIVGVDDDYCEAIADRLYRDGVHV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +        + D + L  S   E+    S E        HN QN + + V C+ +
Sbjct: 242 VRISKER-HLGKGYFADGAKLLWSQDGEIDEIASLEGIGSLRGAHNAQNALAAVVACLSV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ +   G V+F+NDSKATN  +   A  +  + IYWIAG
Sbjct: 301 GLSLEEIDAGLKSFPGLAHRMEQVGHRGKVLFVNDSKATNAEATAPALSSFLQNIYWIAG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  +IAKAY IG +A  F    G      +S TL  A++   RD  N
Sbjct: 361 GVPKAGGIASLAGFFPRIAKAYLIGEAAAQFAATLGDAAPFEISDTLAVAVEHAARDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
              P  +VL SP CASFDQ+ NF +RG +F S V  +PG+E +
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRSAVLALPGVEPI 463


>gi|225627884|ref|ZP_03785920.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella ceti str.
           Cudo]
 gi|254708105|ref|ZP_05169933.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           pinnipedialis M163/99/10]
 gi|254710474|ref|ZP_05172285.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           pinnipedialis B2/94]
 gi|254714467|ref|ZP_05176278.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella ceti
           M644/93/1]
 gi|254717365|ref|ZP_05179176.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella ceti
           M13/05/1]
 gi|256031968|ref|ZP_05445582.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           pinnipedialis M292/94/1]
 gi|260169105|ref|ZP_05755916.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella sp.
           F5/99]
 gi|261219196|ref|ZP_05933477.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           M13/05/1]
 gi|261315608|ref|ZP_05954805.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella
           pinnipedialis M163/99/10]
 gi|261318046|ref|ZP_05957243.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella
           pinnipedialis B2/94]
 gi|261322257|ref|ZP_05961454.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           M644/93/1]
 gi|261758612|ref|ZP_06002321.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella sp. F5/99]
 gi|265989077|ref|ZP_06101634.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella
           pinnipedialis M292/94/1]
 gi|225617047|gb|EEH14093.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella ceti str.
           Cudo]
 gi|260924285|gb|EEX90853.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           M13/05/1]
 gi|261294947|gb|EEX98443.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           M644/93/1]
 gi|261297269|gb|EEY00766.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella
           pinnipedialis B2/94]
 gi|261304634|gb|EEY08131.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella
           pinnipedialis M163/99/10]
 gi|261738596|gb|EEY26592.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella sp. F5/99]
 gi|264661274|gb|EEZ31535.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella
           pinnipedialis M292/94/1]
          Length = 467

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 201/460 (43%), Positives = 283/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHATGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|256160167|ref|ZP_05457861.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella ceti
           M490/95/1]
 gi|256255373|ref|ZP_05460909.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella ceti
           B1/94]
 gi|261222575|ref|ZP_05936856.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           B1/94]
 gi|265998540|ref|ZP_06111097.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           M490/95/1]
 gi|260921159|gb|EEX87812.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           B1/94]
 gi|262553164|gb|EEZ08998.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella ceti
           M490/95/1]
          Length = 467

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 282/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    G  +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGSAVPFEISDTLAAAVAHATGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|239832311|ref|ZP_04680640.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824578|gb|EEQ96146.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ochrobactrum
           intermedium LMG 3301]
          Length = 467

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/463 (44%), Positives = 286/463 (61%), Gaps = 7/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAILGGGAKIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAAFVLSPGVPLTHPKPHWTVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++ +G D+QLGGNIG  IL LE    NRFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKASGRDMQLGGNIGTAILTLEPPQANRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AI+ ++D  CE IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASDTAIVGVDDQYCEAIADRLYRDGVHV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +  Q     + D + L  +   EV    S E        HN QN + +   C+ +
Sbjct: 242 VRISKEK-QLGKGYFADGAKLLWAQDGEVDEIASLEGIGSLRGAHNAQNALAAIAACLSV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ +   G V+F+NDSKATN  +   A  +  + IYWIAG
Sbjct: 301 GLSLEEIHAGLNSFPGLAHRMEQVGHRGKVLFVNDSKATNAEATAPALSSFPQNIYWIAG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  +IAKAY IG +A  F    G      +S TL  A++   RD  N
Sbjct: 361 GVPKAGGIASLAAFFPRIAKAYLIGEAAAQFAATLGDAAPFEISDTLAVAVEHAARDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
              P  +VL SP CASFDQ+ NF +RG +F S V  +PG+E +
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRSAVLALPGVERI 463


>gi|163760792|ref|ZP_02167872.1| putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hoeflea
           phototrophica DFL-43]
 gi|162282114|gb|EDQ32405.1| putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hoeflea
           phototrophica DFL-43]
          Length = 473

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 288/464 (62%), Gaps = 10/464 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           S+F+   +A+FGLG SGL+ A +L   G  +IAWDD+P  V+ A   GI V D REI W+
Sbjct: 5   STFKGRRVALFGLGGSGLATARSLVAGGAELIAWDDNPAQVEAAAKAGIAVGDLREIDWA 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
            I  LVL+PG+ LT    HW   LAN + VEIIGD+E+F RERR  +  + FIA+TGTNG
Sbjct: 65  RIQTLVLAPGVPLTHPKPHWTADLANMYAVEIIGDVEIFARERRAHAPDAAFIAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T ALI+H++  +G D QLGGNIG  +L LE  + +R YVIECSSYQI+L P++DPS 
Sbjct: 125 KSTTTALIAHLIEHSGRDAQLGGNIGTAVLTLEPLTDDRVYVIECSSYQIDLAPSLDPSA 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH ++++Y  +K ++V  S  AII ++D  C  IA  +   G  + RI
Sbjct: 185 GLLLNLTPDHLDRHGSMQHYAEVKTRLVAQSDMAIIGVDDDWCRDIATQIEADGRKVERI 244

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEV--IFDFS---QETKKHNIQNLVTSAVVCMQLGLK 298
            S+SL     ++ D   ++ +A   V  I D S       +HN QN   +   C   GL 
Sbjct: 245 -SKSLPLSRGIFADGGKIRQAADGAVQEIADLSGIPTLRGQHNAQNAAAAIAACRVTGLS 303

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLS 358
             EI+  L +  GL HR+Q + R G V+F+NDSKATN        L   + IYWIAGGL+
Sbjct: 304 DAEIRTGLATFPGLKHRMQPVGRQGRVVFVNDSKATNA-EAAAPALQSFKPIYWIAGGLA 362

Query: 359 KSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENV 416
           K    + L P+  +IAKAY IG +A  F    G +    +S TLD+A+ +  RD   +  
Sbjct: 363 KEGGIAALEPYFPRIAKAYLIGEAAAEFAASIGERAPFEISGTLDRAVANAARDAGQDAA 422

Query: 417 QLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLVDI 460
           ++P+ VL SP CASFDQY NF  RG +F+S V+ +  IEMLV++
Sbjct: 423 EMPA-VLLSPACASFDQYRNFEVRGDAFVSLVAALDDIEMLVEV 465


>gi|306844332|ref|ZP_07476924.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. BO1]
 gi|306275404|gb|EFM57145.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. BO1]
          Length = 467

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 284/463 (61%), Gaps = 7/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII ++D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGVDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  S   E+    S E        HN QN + + V C+  
Sbjct: 242 MRISKEK-HLDRGYFADGAKLLWSQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+  +
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGVTPM 463


>gi|17986860|ref|NP_539494.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           melitensis bv. 1 str. 16M]
 gi|256045063|ref|ZP_05447964.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|260565338|ref|ZP_05835822.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 1 str. 16M]
 gi|265991490|ref|ZP_06104047.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|30316086|sp|Q8YI68|MURD_BRUME RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|17982497|gb|AAL51758.1| udp-n-acetylmuramoylalanine--d-glutamate ligase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260151406|gb|EEW86500.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 1 str. 16M]
 gi|263002274|gb|EEZ14849.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 1 str. Rev.1]
          Length = 467

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/460 (43%), Positives = 283/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLELPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|254719464|ref|ZP_05181275.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella sp.
           83/13]
 gi|265984470|ref|ZP_06097205.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella sp. 83/13]
 gi|306839243|ref|ZP_07472060.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. NF
           2653]
 gi|264663062|gb|EEZ33323.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella sp. 83/13]
 gi|306405790|gb|EFM62052.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. NF
           2653]
          Length = 467

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 284/463 (61%), Gaps = 7/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII ++D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGVDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  S   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWSQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGVVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+  +
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGVTPM 463


>gi|23502304|ref|NP_698431.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella suis
           1330]
 gi|148559574|ref|YP_001259326.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella ovis
           ATCC 25840]
 gi|161619381|ref|YP_001593268.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           canis ATCC 23365]
 gi|225852915|ref|YP_002733148.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           melitensis ATCC 23457]
 gi|254694117|ref|ZP_05155945.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus bv. 3 str. Tulya]
 gi|254702154|ref|ZP_05163982.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella suis
           bv. 5 str. 513]
 gi|254704691|ref|ZP_05166519.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella suis
           bv. 3 str. 686]
 gi|256061490|ref|ZP_05451634.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           neotomae 5K33]
 gi|256113986|ref|ZP_05454769.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256263604|ref|ZP_05466136.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260566062|ref|ZP_05836532.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella suis bv. 4
           str. 40]
 gi|261214417|ref|ZP_05928698.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 3 str. Tulya]
 gi|261325497|ref|ZP_05964694.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella neotomae
           5K33]
 gi|261752724|ref|ZP_05996433.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella suis bv. 5
           str. 513]
 gi|261755384|ref|ZP_05999093.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella suis bv. 3
           str. 686]
 gi|265995328|ref|ZP_06107885.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 3 str. Ether]
 gi|30316052|sp|Q8FZP2|MURD_BRUSU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|23348281|gb|AAN30346.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella suis
           1330]
 gi|148370831|gb|ABQ60810.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella ovis ATCC
           25840]
 gi|161336192|gb|ABX62497.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella canis
           ATCC 23365]
 gi|225641280|gb|ACO01194.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella
           melitensis ATCC 23457]
 gi|260155580|gb|EEW90660.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella suis bv. 4
           str. 40]
 gi|260916024|gb|EEX82885.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 3 str. Tulya]
 gi|261301477|gb|EEY04974.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella neotomae
           5K33]
 gi|261742477|gb|EEY30403.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella suis bv. 5
           str. 513]
 gi|261745137|gb|EEY33063.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella suis bv. 3
           str. 686]
 gi|262766441|gb|EEZ12230.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 3 str. Ether]
 gi|263093655|gb|EEZ17660.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella melitensis
           bv. 2 str. 63/9]
 gi|326409457|gb|ADZ66522.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           melitensis M28]
 gi|326539163|gb|ADZ87378.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella
           melitensis M5-90]
          Length = 467

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/460 (43%), Positives = 283/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|306843220|ref|ZP_07475831.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. BO2]
 gi|306286585|gb|EFM58162.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella sp. BO2]
          Length = 467

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 284/463 (61%), Gaps = 7/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII ++D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGVDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+  +
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGVTPM 463


>gi|62290326|ref|YP_222119.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700250|ref|YP_414824.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           melitensis biovar Abortus 2308]
 gi|189024559|ref|YP_001935327.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus S19]
 gi|237815833|ref|ZP_04594830.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella abortus
           str. 2308 A]
 gi|254689627|ref|ZP_05152881.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus bv. 6 str. 870]
 gi|254697769|ref|ZP_05159597.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|254730658|ref|ZP_05189236.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus bv. 4 str. 292]
 gi|256257877|ref|ZP_05463413.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus bv. 9 str. C68]
 gi|260546868|ref|ZP_05822607.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella abortus
           NCTC 8038]
 gi|260755155|ref|ZP_05867503.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 6 str. 870]
 gi|260758374|ref|ZP_05870722.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 4 str. 292]
 gi|260762200|ref|ZP_05874543.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884168|ref|ZP_05895782.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella abortus
           bv. 9 str. C68]
 gi|297248713|ref|ZP_06932431.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella abortus
           bv. 5 str. B3196]
 gi|75496533|sp|Q57C76|MURD_BRUAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|118595643|sp|Q2YM69|MURD_BRUA2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|62196458|gb|AAX74758.1| MurD, UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616351|emb|CAJ11408.1| Cytoplasmic peptidoglycan synthetases, N-terminal:Pyridine
           nucleotide-disulphide oxidoreductase, class
           I:Folylpolyglutamate s [Brucella melitensis biovar
           Abortus 2308]
 gi|189020131|gb|ACD72853.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           abortus S19]
 gi|237789131|gb|EEP63342.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella abortus
           str. 2308 A]
 gi|260095918|gb|EEW79795.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella abortus
           NCTC 8038]
 gi|260668692|gb|EEX55632.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 4 str. 292]
 gi|260672632|gb|EEX59453.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675263|gb|EEX62084.1| D-glutamic acid-adding enzyme [Brucella abortus bv. 6 str. 870]
 gi|260873696|gb|EEX80765.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella abortus
           bv. 9 str. C68]
 gi|297175882|gb|EFH35229.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella abortus
           bv. 5 str. B3196]
          Length = 467

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/460 (43%), Positives = 283/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|256369849|ref|YP_003107360.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           microti CCM 4915]
 gi|256000012|gb|ACU48411.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella
           microti CCM 4915]
          Length = 467

 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/460 (43%), Positives = 283/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQVIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|294852759|ref|ZP_06793432.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella sp. NVSL
           07-0026]
 gi|294821348|gb|EFG38347.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Brucella sp. NVSL
           07-0026]
          Length = 467

 Score =  393 bits (1010), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 283/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   + R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGNLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL +EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSLEEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ NF +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQNFEKRGDAFRDAVLALPGV 460


>gi|163843689|ref|YP_001628093.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Brucella suis
           ATCC 23445]
 gi|163674412|gb|ABY38523.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brucella suis ATCC
           23445]
          Length = 467

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 282/460 (61%), Gaps = 7/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++ ++A+FGLG SG++ A A+   G  +IAWDD+P +V +A+  GI   D R+ 
Sbjct: 2   IPITALKDKTVALFGLGGSGIATAKAIVAGGARIIAWDDNPDSVARAQSAGIATGDLRQA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    VEIIGD+ELFVRER   +   PFIA+TG
Sbjct: 62  DWSQFAVFVLSPGVPLTHPQPHWSVDLARAAGVEIIGDVELFVRERNHIAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  G D+QLGGNIG  IL LE    +RFYV+ECSSYQI+L P+++
Sbjct: 122 TNGKSTTTALIAHIIKATGRDMQLGGNIGTAILTLEPPCADRFYVVECSSYQIDLAPSLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH ++ENY  IK+++V  S  AII I+D  C+ IA  ++  G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGSMENYAAIKERLVAASGTAIIGIDDAYCQAIADRLHGAGIRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQL 295
            RIS +    D   + D + L  +   E+    S E        HN QN + + V C+  
Sbjct: 242 VRISKEK-HLDRGYFADGAKLLWAQDGEIDEIASLEGIGSLRGAHNAQNALAAIVACLSA 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL  EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A  +  + IYWI G
Sbjct: 301 GLSREEIHAGLKSFPGLAHRMEQVGRRGKVLFVNDSKATNAEATAPALSSFPQNIYWIVG 360

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G+ K+   ++L  F  ++AKAY IG +A  F    GG +   +S TL  A+     D  N
Sbjct: 361 GVPKAGGINSLTAFFPRVAKAYLIGEAAAQFAATLGGAVPFEISDTLAAAVAHAAGDAGN 420

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
              P  +VL SP CASFDQ+ +F +RG +F   V  +PG+
Sbjct: 421 DAAPEPVVLLSPACASFDQFQSFEKRGDAFRDAVLALPGV 460


>gi|325293467|ref|YP_004279331.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Agrobacterium sp.
           H13-3]
 gi|325061320|gb|ADY65011.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Agrobacterium sp.
           H13-3]
          Length = 469

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 211/464 (45%), Positives = 292/464 (62%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +SSFR   +A+FGLG SGL  A AL   G  V+A+DD+P +V +A+  GI   D R I
Sbjct: 2   IPVSSFRGKKVALFGLGGSGLVTARALVAGGADVVAFDDNPDSVAKAQAEGIPTADLRTI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W   S  VL+PG+ LT    HW V LA    VEIIGDIELF+RERR  +   PFIA+TG
Sbjct: 62  DWHSFSSFVLAPGVPLTHPKPHWSVDLARAAGVEIIGDIELFIRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+ +G D QLGGNIG  +L+L+     RFYV+ECSSYQI+L PTI+
Sbjct: 122 TNGKSTTTALIAHILKASGRDTQLGGNIGTAVLSLDPPKAQRFYVVECSSYQIDLAPTIN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH T+++Y ++K+++V  S  AI+ ++D     IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGTMQHYADVKERLVAGSGTAIVGVDDSYSTLIADRIERAGVKV 241

Query: 241 SRISSQSLQSDSDLYIDES-FLKC-SATSEVIFDFS--QETK-KHNIQNLVTSAVVCMQL 295
            RIS +++ S+  LY + S  L+     S ++ D    Q  +  HN QN   +   C+ +
Sbjct: 242 ERISKRNVVSEG-LYAEGSRILRAHGGKSSLLVDLDGIQTLRGSHNAQNAAAAIAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  E+++  L S  GL HR+Q + R G+V F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GVSEEDVRAGLKSFPGLKHRMQPVGRRGNVTFVNDSKATNA-DAAAPALSSYERIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE- 414
           GL K+   ++L P   +IAKAY IG +A  F    G  +   +S TLD+A++    D E 
Sbjct: 360 GLPKAGGIASLAPLFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLDKAVQHAAADAEK 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           +    SIV+ SP CASFDQY NF  RG SF++QV+ + G+ MLV
Sbjct: 420 DATAGSIVMLSPACASFDQYKNFEIRGDSFVAQVAALDGMTMLV 463


>gi|110634359|ref|YP_674567.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Mesorhizobium
           sp. BNC1]
 gi|118595664|sp|Q11GS3|MURD_MESSB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|110285343|gb|ABG63402.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Chelativorans sp.
           BNC1]
          Length = 467

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/460 (44%), Positives = 283/460 (61%), Gaps = 8/460 (1%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SG++ A A+   G  V+AWDD+P +V +AK  GI+  D R+  W 
Sbjct: 5   TTFHGRQVALFGLGGSGIATAQAIMAGGGEVLAWDDNPESVAKAKAEGIKTGDLRDADWR 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
            I  L+L+PG+ LT  + HW V+LA    VEIIGDIELFVRERR  +  +P +A+TGTNG
Sbjct: 65  SIHTLLLAPGVPLTHPHPHWSVELARSAGVEIIGDIELFVRERRMHAAHAPLVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +HVL+  G D Q+GGNIG  ++ L+    +R YV+ECSSYQI+L+PT++P+ 
Sbjct: 125 KSTTTALTAHVLKAAGRDTQMGGNIGRAVMTLDPPVADRHYVLECSSYQIDLSPTLNPTA 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           GVLLNI+PDHLDRH T+ENY  IK+++V  S  AII ++D  C  +A  +   G  +SRI
Sbjct: 185 GVLLNITPDHLDRHGTMENYAAIKERLVAGSDTAIIGVDDEYCRAVADRLEKAGRKVSRI 244

Query: 244 SSQSLQSDSDLYIDES--FLKCSATSEVIFDF---SQETKKHNIQNLVTSAVVCMQLGLK 298
           S      D   + D +  F      +E +F          +HN QN + +A  C+  GL 
Sbjct: 245 SLTGTLEDG-FFADGTQLFRAGQGKAEPLFSLEGIGSLRGRHNAQNALAAAAACLACGLS 303

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLS 358
             EI+    S  GL HR++ + +LGHV+F+NDSKATN  +   A L+   RIYWIAGGL 
Sbjct: 304 PAEIQTGFRSFPGLAHRMEQVGKLGHVLFVNDSKATNADASAPA-LSSFPRIYWIAGGLP 362

Query: 359 KSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQL 418
           K+   ++L  +  +IAKAY IG +A  F    G   N  +S T+  A++   RD  +   
Sbjct: 363 KAGGIASLRQYFPRIAKAYLIGEAAPAFAATIGEATNYEISGTIAAAVQHAARDAADDPA 422

Query: 419 PS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
              +VL SP CASFDQ+ NF  RG +F   V  +PGIE++
Sbjct: 423 GDVVVLLSPACASFDQFRNFEVRGEAFRDAVRALPGIELI 462


>gi|15889380|ref|NP_355061.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Agrobacterium
           tumefaciens str. C58]
 gi|30316074|sp|Q8UDM6|MURD_AGRT5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|15157230|gb|AAK87846.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Agrobacterium
           tumefaciens str. C58]
          Length = 469

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 293/464 (63%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SFR   +A+FGLG SGL  A AL   G  V+A+DD+P +V +A+  GI   D   I
Sbjct: 2   IPVTSFRGKKVALFGLGGSGLVTARALVAGGAAVVAFDDNPDSVAKAQAEGIATADLHTI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  S  VL+PG+ LT    HW V LA    VE+IGDIELF+RERR  +   PFIA+TG
Sbjct: 62  DWSSFSSFVLAPGVPLTHPKPHWSVDLAKAAGVEVIGDIELFIRERRVHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+ +G D QLGGNIG  +L+L+     RFYV+ECSSYQI+L PTI+
Sbjct: 122 TNGKSTTTALIAHILQSSGRDTQLGGNIGTAVLSLDPPKAQRFYVVECSSYQIDLAPTIN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH T+++Y ++K+++V  S  AI+ ++D     IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGTMQHYADVKERLVAGSGTAIVGVDDSHSTLIADRIERAGVKV 241

Query: 241 SRISSQSLQSDSDLYIDES-FLKC-SATSEVIFDFS--QETK-KHNIQNLVTSAVVCMQL 295
            RIS +++ S+  LY + S  L+    TS ++ D    Q  +  HN QN   +   C+ +
Sbjct: 242 ERISKRNVVSEG-LYAEGSQILRAHGGTSSLLVDLDGIQTLRGSHNAQNAAAAIAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  EEI+  L S  GL HR+Q + R G+V F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GVSEEEIRAGLKSFPGLKHRMQPVGRRGNVTFVNDSKATNA-DAAAPALSSFDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE- 414
           GL K+   ++L P   +IAKAY IG +A  F    G  +   +S TLD+A++    D E 
Sbjct: 360 GLPKAGGITSLSPLFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLDKAVQHAAADAEK 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           +    ++V+ SP CASFDQY NF  RG SF++QV+ + G+ MLV
Sbjct: 420 DATAGNVVMLSPACASFDQYKNFEIRGDSFVAQVAALEGMTMLV 463


>gi|90418196|ref|ZP_01226108.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337868|gb|EAS51519.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 470

 Score =  379 bits (972), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 206/464 (44%), Positives = 281/464 (60%), Gaps = 13/464 (2%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
           +F   S+A+FGLG SG + A AL++ G  V AWDD+P +V+ A D GI  +D     W+ 
Sbjct: 6   AFSGKSVALFGLGGSGRATARALQEGGAEVAAWDDNPASVEAAIDEGIPTVDLASADWTR 65

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
            + LVLSPG+ LT    HW V LA    VE+IGDIELF RERR  + ++PF+A+TGTNGK
Sbjct: 66  FAALVLSPGVPLTHPRPHWTVALAYAAGVEVIGDIELFCRERRALAPEAPFVAITGTNGK 125

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+T ALI+H L   G DVQLGGNIG+ ++ L   +P R YV+ECSSYQI+L PTI+PSIG
Sbjct: 126 STTTALIAHCLAHAGRDVQLGGNIGVAVMTLAPPAPERHYVVECSSYQIDLAPTIEPSIG 185

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRIS 244
           +LLN++PDHLDRH ++ +Y  +K ++V  S+ AI+ ++D  C +IA ++   GH++ RI 
Sbjct: 186 LLLNLTPDHLDRHGSMSSYAAVKARLVAGSQLAIVGVDDPHCRQIADELESEGHTVVRI- 244

Query: 245 SQSLQSDSDLYIDESFL--KCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLKV 299
           SQ+   D+ +  D   L  +     E  FD S       +HN QN   +  V   LGL  
Sbjct: 245 SQTDGLDAGVGFDGRMLHRRMEGRPEASFDLSAIGSLRGRHNGQNAAAAVAVFTALGLSD 304

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK 359
           EEI   L S  GL HR++ + R G V+F+NDSKATN  +   A      RI+WIAGGL K
Sbjct: 305 EEIVAGLESFPGLAHRMEEVGRAGSVLFVNDSKATNAEAAAPALAAFP-RIHWIAGGLPK 363

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD------QALKSVVRDV 413
                +L PF  +IAKAY IG +A  F    G +I   +S TL+       A  +V    
Sbjct: 364 EGGIGSLSPFFPRIAKAYLIGEAAPSFAATLGKRIPYEISGTLEVAVERAAADAAVDAAA 423

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
           +     ++VL SP CASFDQ+ NF  RG +F   V ++P + M+
Sbjct: 424 QGEGAEAVVLLSPACASFDQFRNFEVRGDAFRDAVRKLPDVAMI 467


>gi|150397285|ref|YP_001327752.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Sinorhizobium
           medicae WSM419]
 gi|150028800|gb|ABR60917.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sinorhizobium
           medicae WSM419]
          Length = 463

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 281/463 (60%), Gaps = 6/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF+   +A+FGLG SGL+ A AL   G  V+AWDD+P +V +A   GI   D R  
Sbjct: 2   IPVTSFKGRKVALFGLGGSGLATAQALVAGGADVVAWDDNPDSVAKADQAGIATADLRGE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W   S LVLSPG+ LT    HW   LA+   VEIIGD+ELFVRERR  +   PFIA+TG
Sbjct: 62  EWHAFSALVLSPGVPLTHPKPHWSADLAHHAGVEIIGDVELFVRERRKHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR +G D QLGGNIG  +L LE    +RFYV+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHILRASGRDTQLGGNIGTAVLTLEPPQADRFYVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH T+++Y +IK+++V  S  AI+ ++D     IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGTMQHYADIKERLVAGSGTAIVGVDDSLSSLIADRVERAGTKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIF-DFSQ-ETKK--HNIQNLVTSAVVCMQLG 296
            RIS +   ++       + ++ +  +  +F D +  +T +  HN QN   +   C+ +G
Sbjct: 242 VRISRRHPLAEGVYAEGTALMRATGGASSLFTDLAGIQTLRGGHNAQNAAAAIAACLAVG 301

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           +  ++I   L S  GL HR+Q +A+ G  IF+NDSKATN        L+   RIYWIAGG
Sbjct: 302 ISEKDIVDGLRSFPGLKHRMQPVAKKGETIFVNDSKATNA-EAAAPALSSYDRIYWIAGG 360

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ-ALKSVVRDVEN 415
           L K    ++L PF  KI KAY IG +A  F    G  +   +S TL++    +      +
Sbjct: 361 LPKEGGITSLTPFFPKIVKAYLIGEAAPSFAATLGEAVPYEISGTLEKAVAHAASDAARD 420

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
              P+ V+ SP CASFDQY NF  RG +F+  V  + G+ ML+
Sbjct: 421 AGAPATVMLSPACASFDQYKNFELRGDAFVEHVKALEGVIMLI 463


>gi|327194624|gb|EGE61474.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase protein [Rhizobium
           etli CNPAF512]
          Length = 470

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/464 (43%), Positives = 286/464 (61%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SG + A AL   G  V AWDD+P +V +A   GI   D   I
Sbjct: 2   IPVTTLKDRKVALFGLGGSGFATARALILGGARVTAWDDNPDSVAKAAAEGIHTEDLHTI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  S  VLSPG+ LT    HW V LA+   V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQSLFVLSPGVPLTHPKPHWTVDLAHAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  GYD QLGGNIG  +L L+   P R+YV+ECSSYQI+L PT++
Sbjct: 122 TNGKSTTTALIAHILKSAGYDTQLGGNIGTAVLTLDPPKPERYYVVECSSYQIDLAPTLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y ++K+++V  S  A++ I+D     IA  +   G  +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADVKERLVAGSDVAVVGIDDSHSALIADRIQRAGVKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVI----FDFSQETKK-HNIQNLVTSAVVCMQL 295
            RIS +++ +D  +Y + + L  +A   ++     D  Q  +  HN QN   +   C+ +
Sbjct: 242 VRISRRNVVADG-IYAEGTKLVQAAGGAMLPFADLDGIQTLRGIHNAQNAAAAIAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  ++I+  L S  GL HR+Q + R G V+F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GVSADDIRAGLASFPGLKHRMQPVGRRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ-ALKSVVRDVE 414
           GL KS   +TL P+  +IAKAY IG +A  F    G  +   +S TL++    +      
Sbjct: 360 GLPKSGGITTLAPYFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLERAVAHAAADADH 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           +    S V+ SP CASFDQY NF  RG +F+S V+ + G+ ML+
Sbjct: 420 DEAAASAVMLSPACASFDQYKNFEVRGDAFVSHVAALDGMTMLI 463


>gi|260462088|ref|ZP_05810332.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Mesorhizobium
           opportunistum WSM2075]
 gi|259031948|gb|EEW33215.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Mesorhizobium
           opportunistum WSM2075]
          Length = 466

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/459 (42%), Positives = 278/459 (60%), Gaps = 6/459 (1%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           +SF    +++FGLG SG++ A AL + G  V+AWDD+P +V +A   GIE  D R   W+
Sbjct: 5   ASFAGKRVSLFGLGGSGIATARALIEGGAEVLAWDDNPDSVAKAAATGIETADLRGADWA 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S  VLSPG+ LT    HW V+LA    VE+IGDIELF RER  S+  +PFI +TGTNG
Sbjct: 65  KFSAFVLSPGVPLTHPKPHWTVELARGAGVEVIGDIELFCRERTLSAPAAPFIGITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+L+  G D Q+GGNIG  ++ L+   P+R YV+ECSSYQI+L P+I+P+ 
Sbjct: 125 KSTTTALTAHILKSAGRDTQMGGNIGRAVMTLDPPKPDRHYVVECSSYQIDLAPSINPTA 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+++Y +IK+++V  S+ AII I+D  C +IA  +   G  + RI
Sbjct: 185 GILLNLTPDHLDRHGTMQHYASIKERLVAGSETAIIGIDDSWCAQIAERLERAGRQVIRI 244

Query: 244 SSQSLQSDSDLYIDESFLKC--SATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           S +   +D       + ++      S V F         +HN QN + +   C+++GL++
Sbjct: 245 SKRLPLTDGYFADGSNLMEAVHGRYSRVAFLEGIGSLRGQHNAQNALAAVAACLRVGLEL 304

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK 359
            EI+  L S  GL HR++ + R  HV+FINDSKATN        L+   RIYWIAGGL K
Sbjct: 305 GEIQSGLESFPGLAHRMEQVGRKDHVLFINDSKATNA-DAAAPALSSFNRIYWIAGGLPK 363

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD-VENVQL 418
                 L  F  +IAKAY IG +A  F    G  +   +S TL  A++   RD   +   
Sbjct: 364 EGGIEPLRGFFPRIAKAYLIGEAAPAFSATLGEAVPYEISGTLAAAVEHAARDAARDDSG 423

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEML 457
            ++VL SP CASFDQ+ NF  RG +F    + I G++ +
Sbjct: 424 EAVVLLSPACASFDQFKNFEVRGEAFRQAANAIEGVKPI 462


>gi|241205559|ref|YP_002976655.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240859449|gb|ACS57116.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 470

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 200/463 (43%), Positives = 283/463 (61%), Gaps = 6/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SG + A AL   GV V AWDD+P +V +A   GI   D   I
Sbjct: 2   IPVTTLKDRKVALFGLGGSGFATARALVSGGVEVTAWDDNPDSVAKAAAEGIRTEDLHSI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQALFVLSPGVPLTHPKPHWTVDLARAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  GYD QLGGNIG  +L L+     R+YV+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHILKSAGYDTQLGGNIGTAVLTLDPPKAERYYVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y ++K+++V  S  AI+ I+D     IA  +   G  +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADVKERLVAGSDVAIVGIDDSHSALIADRVERAGVKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIF---DFSQETK-KHNIQNLVTSAVVCMQLG 296
            RIS +++ +D         +K +  + + F   D  Q  +  HN QN   +   C+ +G
Sbjct: 242 VRISRRNVVADGIYAEGTRLIKAAGGAMLPFVDLDGIQTLRGSHNAQNAAAAVAACLAVG 301

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           +  ++I+    S  GL HR+Q + + G V+F+NDSKATN        L+   RIYWIAGG
Sbjct: 302 VSADDIRAGFASFPGLKHRMQPVGQRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIAGG 360

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE-N 415
           L K+   +TL P+  +IAKAY IG +A  F    G  +   +S TL++A+     D E +
Sbjct: 361 LPKAGGITTLAPYFPRIAKAYLIGEAAAEFAATLGEAVPYEISDTLERAVAHAAADAERD 420

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
               S V+ SP CASFDQY NF  RG +F+  V+ + GI ML+
Sbjct: 421 ESAASAVMLSPACASFDQYKNFEVRGEAFVGHVAALDGIAMLI 463


>gi|116253050|ref|YP_768888.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|118595681|sp|Q1ME31|MURD_RHIL3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|115257698|emb|CAK08796.1| putative UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 470

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/464 (43%), Positives = 286/464 (61%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SG + A AL   G  V AWDD+P +V +A   GI   D R I
Sbjct: 2   ISVTTLKDRKVALFGLGGSGFATARALVTGGAEVTAWDDNPDSVAKAAAEGIRTEDLRNI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQALFVLSPGVPLTHPKPHWTVDLARAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  GYD QLGGNIG  +L L+     R+YV+ECSSYQI+L PT++
Sbjct: 122 TNGKSTTTALIAHILKSAGYDTQLGGNIGTAVLTLDPPKAERYYVVECSSYQIDLAPTLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y +IK+++V  S  AI+ ++D     IA  +   G  +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADIKERLVAGSDVAIVGVDDSHSALIADRVERAGVKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVI----FDFSQETK-KHNIQNLVTSAVVCMQL 295
            RIS +++ +D  +Y + + L  +A   ++     D  Q  +  HN QN   +   C+ +
Sbjct: 242 VRISRRNVVADG-IYAEGTKLIQAAGGAMLPFADLDGIQTLRGSHNAQNAAAAVAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  + I+  L S  GL HR+Q + + G V+F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GVSADAIRAGLASFPGLKHRMQPVGQRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE- 414
           GL K+   +TL P+  +IAKAY IG +A  F    G  +   +S TL++A+     D E 
Sbjct: 360 GLPKAGGITTLAPYFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLERAVAHAAADAER 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           +    S V+ SP CASFDQY NF  RG +F+  V+ + GI ML+
Sbjct: 420 DESAASAVMLSPACASFDQYKNFEVRGEAFVGHVAALDGITMLI 463


>gi|222086446|ref|YP_002544980.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase protein
           [Agrobacterium radiobacter K84]
 gi|221723894|gb|ACM27050.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase protein
           [Agrobacterium radiobacter K84]
          Length = 470

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 205/465 (44%), Positives = 281/465 (60%), Gaps = 10/465 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ +   +A+FGLG SG + A AL   G  V AWDD+P +V +A   GI V D R I
Sbjct: 2   IPVTTLKGKKVALFGLGGSGFATARALVAGGAEVTAWDDNPDSVAKASAEGIPVADLRTI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W  +S  VLSPG+ LT    HW V LA    VE+IGD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWKGLSVFVLSPGVPLTHPKPHWTVDLARAAGVEVIGDVELFVRERREHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+ +G D QLGGNIG  IL L+     R+YV+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHILQSSGRDTQLGGNIGTAILTLDPPKAERYYVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y +IK+++V  S  AI+ ++D     IA  +   G  +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADIKERLVAGSGVAIVGVDDSYSSLIADRIERAGAKV 241

Query: 241 SRISSQ-----SLQSDSDLYIDESFLKCSATSEVIFDFSQETK-KHNIQNLVTSAVVCMQ 294
            RIS +      L ++    I+ S   C+       D  Q  +  HN QN   +   C+ 
Sbjct: 242 IRISRRHALAGGLYAEGSRIIEASI--CAIEEIADLDGIQTLRGSHNAQNAAAAIAACLA 299

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           +G+  ++I+  L S  GL HR+Q + R G V+F+NDSKATN        L+   RIYWIA
Sbjct: 300 VGVSGDDIRAGLRSFPGLKHRMQPVGRRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIA 358

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE 414
           GGL K    +TL P    IAKAY IG +A  F    G ++   +S TL++A+     D +
Sbjct: 359 GGLPKEGGITTLAPLFRHIAKAYLIGEAAPAFAATLGEQVPYEISGTLERAVAHAADDAD 418

Query: 415 NVQ-LPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
             +   + V+ SP CASFDQY NF  RG +F+S V+ I G+ MLV
Sbjct: 419 KDEHEAAAVMLSPACASFDQYKNFEVRGDAFVSHVAAIEGVTMLV 463


>gi|209550176|ref|YP_002282093.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209535932|gb|ACI55867.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 470

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/464 (42%), Positives = 285/464 (61%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SGL+ A AL   G  V AWDD+P +V +A   GI   D   I
Sbjct: 2   IPVTTLKDRKVALFGLGGSGLATARALVSGGAEVTAWDDNPDSVAKASAEGIRTEDLHTI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQALFVLSPGVPLTHPKPHWTVDLARAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  GYD QLGGNIG  +L L+     R+YV+ECSSYQI+L PT++
Sbjct: 122 TNGKSTTTALIAHILKSAGYDTQLGGNIGTAVLTLDPPKAGRYYVVECSSYQIDLAPTLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y ++K+++V  S  AI+ ++D     IA  +      +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADVKERLVAGSDVAIVGVDDSHSALIADRVERADVKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVI----FDFSQETK-KHNIQNLVTSAVVCMQL 295
            RIS +S+ + S +Y + S L  +A   ++     D  Q  +  HN QN   +   C+ +
Sbjct: 242 VRISRRSVVA-SGIYAEGSRLIQAAGGAMLPFADLDGIQTLRGSHNAQNAAAAVAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  ++I+  L S  GL HR+Q + + G V+F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GVSADDIRAGLASFPGLKHRMQPVGQRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA-LKSVVRDVE 414
           GL K+   +TL P+  +IAKAY IG +A  F    G  +   +S TL++A + +      
Sbjct: 360 GLPKAGGITTLAPYFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLERAVVHAAADAER 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           +    S V+ SP CASFDQY NF  RG +F+  V+ + GI ML+
Sbjct: 420 DEAAASAVMLSPACASFDQYKNFEVRGEAFVGHVAALDGIAMLI 463


>gi|190892585|ref|YP_001979127.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhizobium etli
           CIAT 652]
 gi|190697864|gb|ACE91949.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase protein [Rhizobium
           etli CIAT 652]
          Length = 470

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 201/464 (43%), Positives = 285/464 (61%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SG + A AL   GV V AWDD+P +V +A   GI   D   I
Sbjct: 2   IPVTTLKDRKVALFGLGGSGFATARALILGGVRVTAWDDNPDSVAKAAAEGIHTEDLHTI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  S  VLSPG+ LT    HW V LA    V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQSLFVLSPGVPLTHPKPHWTVDLARAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR  GYD QLGGNIG  +L L+     R+YV+ECSSYQI+L PT++
Sbjct: 122 TNGKSTTTALIAHILRSAGYDTQLGGNIGTAVLTLDPPKAERYYVVECSSYQIDLAPTLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y ++K+++V  S  A++ I+D     IA  +   G  +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADVKERLVAGSDVAVVGIDDSHSALIADRVQRAGVKM 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVI----FDFSQETK-KHNIQNLVTSAVVCMQL 295
            RIS +++ +D  +Y + + L  +A   ++     D  Q  +  HN QN   +   C+ +
Sbjct: 242 VRISRRNVVADG-IYAEGTKLVQAAGGAMLPFADLDGIQTLRGSHNAQNAAAAVAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  ++I+  L S  GL HR+Q + R G V+F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GVSADDIRAGLASFPGLKHRMQPVGRRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ-ALKSVVRDVE 414
           GL KS   +TL P+  +IAKAY IG +A  F    G  +   +S TL++    +      
Sbjct: 360 GLPKSGGITTLAPYFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLERAVAHAAADADR 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           +    S V+ SP CASFDQY NF  RG +F+S V+ + G+ ML+
Sbjct: 420 DEAAASAVMLSPACASFDQYKNFEVRGDAFVSHVAALDGMTMLI 463


>gi|15965931|ref|NP_386284.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Sinorhizobium
           meliloti 1021]
 gi|307308241|ref|ZP_07587950.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sinorhizobium
           meliloti BL225C]
 gi|307319708|ref|ZP_07599133.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sinorhizobium
           meliloti AK83]
 gi|7387920|sp|Q52953|MURD_RHIME RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|15075200|emb|CAC46757.1| Probable UDP-N-acetylmuramoylalanine--D-glutamate ligase
           [Sinorhizobium meliloti 1021]
 gi|306894639|gb|EFN25400.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sinorhizobium
           meliloti AK83]
 gi|306901239|gb|EFN31845.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sinorhizobium
           meliloti BL225C]
          Length = 463

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/464 (43%), Positives = 285/464 (61%), Gaps = 8/464 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF+   +A+FGLG SGL+ A AL   G  V+AWDD+P +V +A   GI   D R  
Sbjct: 2   IPVTSFKGRKVALFGLGGSGLATAQALVSGGADVVAWDDNPDSVAKAAAAGIATADLRGA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W   +  VLSPG+ LT    HW V LA+Q  VEIIGD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWHAFAAFVLSPGVPLTHPKPHWSVDLAHQAGVEIIGDVELFVRERRKHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR +G D QLGGNIG  +L L+     RFYV+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHILRTSGRDTQLGGNIGTAVLTLDPPKAGRFYVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH T+++Y +IK+++V  S  A++ ++D     IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGTMQHYADIKERLVAGSGTAVVGVDDSLSSLIADRVERAGTKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCS--ATSEVIFDFSQ-ETKK--HNIQNLVTSAVVCMQL 295
            RIS +   ++  +Y + S L  +    S +  D +  +T +  HN QN   +   C+ +
Sbjct: 242 VRISRRHPLAEG-IYAEGSALMRAQDGASSLFTDLAGIQTLRGGHNAQNAAAAIAACLAV 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  ++I   L S  GL HR+Q +A+ G V+F+NDSKATN        L+   RIYWIAG
Sbjct: 301 GISGKDIVDGLRSFPGLKHRMQPVAKKGEVVFVNDSKATNA-EAAAPALSSYDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ-ALKSVVRDVE 414
           GL K    ++L PF  KI KAY IG +A  F    G  +   +S TL++    +      
Sbjct: 360 GLPKEGGITSLAPFFPKIVKAYLIGEAAPSFAATLGEAVPYEISGTLEKAVAHAAADAAR 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           + Q P+ V+ SP CASFDQY NF  RG +F+  V+ + G+ ML+
Sbjct: 420 DSQGPAAVMLSPACASFDQYKNFEVRGDAFVGHVAALEGVSMLI 463


>gi|146342500|ref|YP_001207548.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Bradyrhizobium sp. ORS278]
 gi|146195306|emb|CAL79331.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Bradyrhizobium sp.
           ORS278]
          Length = 466

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 202/467 (43%), Positives = 289/467 (61%), Gaps = 11/467 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  AL+  G  VIA DD    + +A   G    D R +
Sbjct: 2   IPVTSFAGKTVAVFGLGGSGLASCHALRAGGAEVIAADDGADRMTEAAKAGFITADLRTV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  + LVL+PG+ LT    HW V  A +  VE+IGDIELF RERR  +  +PFIA+TG
Sbjct: 62  SWSNFAALVLAPGVPLTHPVPHWSVLRAREAGVEVIGDIELFCRERRRHAPDAPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H++R  GYD Q+GGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLMRVAGYDTQMGGNIGTAILSLEPPRMGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           PSIG+LLN+S DH+DRH T+ENY  +K+++V   K    AI+ ++D  C  IA  ++  G
Sbjct: 182 PSIGILLNVSEDHIDRHGTIENYAAVKERLVAGVKPQGTAIVGVDDGFCRAIADRLDQAG 241

Query: 238 HSISRISSQSLQSDSDLYID-ESFLKCS--ATSEV--IFDFSQETKKHNIQNLVTSAVVC 292
             + RIS ++  +D  LY + E+ ++ S  A SEV  +        +HN QN   +A   
Sbjct: 242 KRVVRISVKNPLADG-LYTEHETIVRSSGGARSEVARLGGIGSLRGQHNAQNAACAAAAA 300

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
           + +G++ + +++ L S  GL HR++ + RLG+V+F+NDSK TN  +  HA L+    I+W
Sbjct: 301 LAIGVREDVLQQGLRSFPGLAHRMEQVGRLGNVLFVNDSKGTNADATAHA-LSSFADIFW 359

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           IAGG  K+   ++L  F  +I KAY IG +A  F    G K+   +S TL+ A++    D
Sbjct: 360 IAGGKPKAGGITSLAGFFPRIRKAYLIGEAAKEFAGTLGEKVPHAMSGTLEVAVEQAAAD 419

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
            +   L  ++VL SP CASFDQ+ NF  RG  F   V  +PG+E +V
Sbjct: 420 AKASGLKEAVVLLSPACASFDQFRNFEIRGTRFRDLVQALPGVEKVV 466


>gi|319782846|ref|YP_004142322.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317168734|gb|ADV12272.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 466

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 195/457 (42%), Positives = 276/457 (60%), Gaps = 6/457 (1%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           +SF    +++FGLG SG++ A AL + G  V+AWDD+P +V +A   GI   D R   W+
Sbjct: 5   ASFSGKRVSLFGLGGSGIATARALIEGGADVLAWDDNPDSVAKAAIAGIATADLRGADWA 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S  VLSPG+ LT    HW V+LA    VEI+GDIELF RER  S+  +PFIA+TGTNG
Sbjct: 65  KFSAFVLSPGVPLTHPKPHWTVELARGSGVEIVGDIELFCRERMLSAPTAPFIAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+L+  G D Q+GGNIG  ++ L+   P+R YV+ECSSYQI+L P+I+P+ 
Sbjct: 125 KSTTTALTAHILKAAGRDAQMGGNIGRAVMTLDPPEPDRHYVVECSSYQIDLAPSINPTA 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+++Y  IK+++V  S+ AI+ I+D  C +IA  +   G  + RI
Sbjct: 185 GILLNLTPDHLDRHGTMQHYAAIKERLVAGSETAIVGIDDSWCAQIAERLERAGRHVIRI 244

Query: 244 SSQSLQSDSDLYIDESFLKC--SATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           S +   +D       + ++      S V F         +HN QN + +   C+++GL++
Sbjct: 245 SKRLPLTDGYFADGSNLMEAVHGRYSRVAFLEGIGSLRGQHNAQNALAAVAACLKIGLEL 304

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK 359
            EI+  L S  GL HR++ + R  HV+FINDSKATN        L+   RIYWIAGGL K
Sbjct: 305 GEIQSGLESFPGLAHRMEQVGRKDHVLFINDSKATNA-DAAAPALSSFARIYWIAGGLPK 363

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD-VENVQL 418
                 L  F  +IAKAY IG +A  F    G  +   +S TL  A++    D  ++   
Sbjct: 364 EGGIEPLRGFFPRIAKAYLIGEAAPAFSATLGEAVPYEISGTLAAAVEHAAHDAAKDDSG 423

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
            ++VL SP CASFDQ+ NF  RG +F    + I G++
Sbjct: 424 EAVVLLSPACASFDQFKNFEVRGEAFRQAANAIEGVK 460


>gi|114704924|ref|ZP_01437832.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Fulvimarina
           pelagi HTCC2506]
 gi|114539709|gb|EAU42829.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Fulvimarina
           pelagi HTCC2506]
          Length = 463

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 196/460 (42%), Positives = 275/460 (59%), Gaps = 5/460 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           MK+ +F    +A+FGLG SGL+ A AL + G ++IA+DD+P +V++A   GI   + REI
Sbjct: 1   MKIDTFAGLRVALFGLGGSGLATASALIEGGANLIAFDDNPGSVEKAVTHGIPTQNLREI 60

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W+ ++  VLSPG+ LT    HW V LAN   V IIGD+E+F RER   + ++ F+A+TG
Sbjct: 61  DWNGLAAFVLSPGVPLTHPRPHWSVDLANAAGVPIIGDVEIFGRERASKAPEARFVAITG 120

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H L++ G D QLGGNIG+P+L L+  +P R YV+ECSSYQI+L P + 
Sbjct: 121 TNGKSTTTALIAHCLKEAGRDTQLGGNIGVPVLTLQEPTPERHYVVECSSYQIDLAPGLK 180

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS+ +LLN++ DHLDRH T+E+Y ++K+++V  +  A+I  +D  C  IA  +   G  +
Sbjct: 181 PSVALLLNLTADHLDRHGTIEHYASVKERLVVGADRAVIGADDIWCRAIADRIEAAGRPV 240

Query: 241 SRISSQSLQSDSDLYIDESFLKC-SATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLG 296
            RIS Q   +    Y D   ++     SE  FD +       +HN QN   +        
Sbjct: 241 VRISGQGAVAGGVGYADGIVVRALDGFSEASFDLTGIGSLRGRHNGQNAAAAVAALTLCD 300

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           +   +I + L S  GL HR++ + R+G  +FINDSKATN  +   A  + + RIYWIAGG
Sbjct: 301 VGEAQILKGLRSFPGLAHRMEEVGRIGKTLFINDSKATNADAAATALASFE-RIYWIAGG 359

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENV 416
           L K    + L  F  KI KAY IG +A  F    G  +   +S TLD A+ S  RD    
Sbjct: 360 LPKEGGIAELSRFFPKIVKAYLIGEAAPAFAATLGEDVAYEISATLDNAVASAARDSAED 419

Query: 417 QLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
           +  + VL SP CASFDQY NF  RG +F   V  +  IE+
Sbjct: 420 EKSAAVLLSPACASFDQYRNFEVRGDAFRDSVRSLKDIEV 459


>gi|154245789|ref|YP_001416747.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Xanthobacter
           autotrophicus Py2]
 gi|154159874|gb|ABS67090.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Xanthobacter
           autotrophicus Py2]
          Length = 537

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 199/464 (42%), Positives = 279/464 (60%), Gaps = 11/464 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ F++ ++A+FGLG SGL+ A ALK  G HVIA+DD   + ++A + GI V D R I
Sbjct: 15  IPVTVFKDRTVALFGLGGSGLATAEALKAGGAHVIAYDDAEASRRKAGEAGILVQDLRSI 74

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W+I++ LVLSPG+ LT    HW VKLA     E+IGDIELF RER   + +SPFIA+TG
Sbjct: 75  DWTIVAALVLSPGVPLTHPEPHWSVKLARDAGAEVIGDIELFCRERHAIARRSPFIAITG 134

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR  G DVQ+GGNIG  IL+L    P R +V+ECSSYQ++L P++D
Sbjct: 135 TNGKSTTTALITHILRVAGRDVQMGGNIGTAILSLAPPKPGRVHVVECSSYQVDLAPSLD 194

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMNFIG 237
           PS+GV+LNI+PDHLDRH T+E+Y  +K+++V        A++ ++D     +A      G
Sbjct: 195 PSVGVMLNITPDHLDRHGTIEHYAAVKERLVAGVEGGGTAVVGVDDDFSAAMADRAVEAG 254

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE-----TKKHNIQNLVTSAVVC 292
             + RIS +    D  +++D   L  S      F             HN QN   +   C
Sbjct: 255 KHVVRISVKRALPDG-IWLDGETLVVSEGGAERFRLPLAGIGSLRGTHNAQNAAAAFAAC 313

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
             +G+  E I  A+    GL HR++ +   G V+F+NDSKATN  +   A L     I+W
Sbjct: 314 RGVGVAPEIITIAMKRFPGLAHRMEEVGNKGAVLFVNDSKATNADAAERA-LASFTSIFW 372

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           IAGG  K+   + L PF  ++AKAY IG +A  F    G  +   ++ TLD+A+ +  RD
Sbjct: 373 IAGGKPKTGGIAPLAPFFDRVAKAYLIGEAAEEFATTLGSTVAHEIAGTLDKAVAAAARD 432

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
            E   L   +VL SP CASFDQ+ NF  RG +F   V ++PG+E
Sbjct: 433 AEASGLKDPVVLLSPACASFDQFPNFEVRGDAFRELVKQVPGVE 476


>gi|86358452|ref|YP_470344.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhizobium
           etli CFN 42]
 gi|118595680|sp|Q2K6B9|MURD_RHIEC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|86282554|gb|ABC91617.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase protein [Rhizobium
           etli CFN 42]
          Length = 470

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 197/465 (42%), Positives = 280/465 (60%), Gaps = 10/465 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SG + A AL   G  V AWDD+P +V +A   GI   D   I
Sbjct: 2   IPVTTLKDRKVALFGLGGSGFATARALIAGGAEVTAWDDNPDSVAKASAEGIRTEDLHGI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQALFVLSPGVPLTHPKPHWTVDLARAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  GYD QLGGNIG  +L L+     R+YV+ECSSYQI+L PT++
Sbjct: 122 TNGKSTTTALIAHILKSAGYDTQLGGNIGTAVLTLDPPKAGRYYVVECSSYQIDLAPTLN 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           PS G+LLN++PDHLDRH T+++Y ++K+++V  S  AI+ I+D     IA  +   G  +
Sbjct: 182 PSAGILLNLTPDHLDRHGTMQHYADVKERLVAGSDVAIVGIDDSHSALIADRVERAGVKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQ----ETKK--HNIQNLVTSAVVCMQ 294
            RIS ++  + S +Y  E      A    +  F+     +T +  HN QN   +   C+ 
Sbjct: 242 VRISRRNAVA-SGIYA-EGIRLVQAVGGAMLPFADLDGIQTLRGSHNAQNAAAAVAACLA 299

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           +G+  + I+  L S  GL HR+Q + + G V+F+NDSKATN        L+   RIYWIA
Sbjct: 300 VGVSADAIRAGLASFPGLKHRMQPVGKRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIA 358

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ-ALKSVVRDV 413
           GGL K+   +TL P+  +IAKAY IG +A  F    G  +   +S TL++    +     
Sbjct: 359 GGLPKAGGITTLAPYFPRIAKAYLIGEAAAEFAATLGEAVPYEISGTLERAVAHAAADAE 418

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
            +    S V+ SP CASFDQY NF  RG +F+S V+ + G+ ML+
Sbjct: 419 RDEAAASAVMLSPACASFDQYRNFEVRGDAFVSHVAALDGMTMLI 463


>gi|217979587|ref|YP_002363734.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Methylocella
           silvestris BL2]
 gi|217504963|gb|ACK52372.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylocella
           silvestris BL2]
          Length = 461

 Score =  362 bits (929), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 188/445 (42%), Positives = 263/445 (59%), Gaps = 7/445 (1%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           FR+ S+AVFGLG SG   A AL   G  V  WDD+  A ++A+  G+ + +   + W   
Sbjct: 7   FRDQSVAVFGLGGSGFITAQALVAGGASVYVWDDNEHAREKARAAGLRIENLASVDWRGF 66

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
           S LVLSPG+ LT    HW V  A +  VE+IGDIELF RERR  +  +P IA+TGTNGKS
Sbjct: 67  SALVLSPGVPLTHPAPHWTVVKAREAGVEVIGDIELFCRERRRIAPDAPLIAITGTNGKS 126

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T ALI+H+    G+DVQ+GGNIG PIL LE  S  R +V+ECSSYQI+L P++DP++GV
Sbjct: 127 TTTALIAHLFATLGFDVQIGGNIGTPILALEPPSSERVHVVECSSYQIDLAPSLDPTVGV 186

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISS 245
           LLN++PDHLDRH T+ENY  IK ++V+ + HA+I ++D  C  IA  +   GH +  +S+
Sbjct: 187 LLNVTPDHLDRHGTMENYAAIKARLVSAADHAVIGVDDAFCAAIAKKLRAEGHDVIGVSA 246

Query: 246 QS-LQSDSDLYIDES-FLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGLKVE 300
              L+ D  ++   + + +     ++I D S        HN QN   S  V   +GL   
Sbjct: 247 AGMLEGDGVVFEGGALYWRGGRRLDLIADLSGVGSLRGAHNGQNAAASVAVLHAIGLDGA 306

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
            + + L S  GL HR++ + + G  + +NDSKATN  +   A L+    I+WI GG +K 
Sbjct: 307 GLAKGLRSFAGLAHRMEEVGKYGKALLVNDSKATNADAAEKALLSFD-NIFWILGGRAKQ 365

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD-VENVQLP 419
               +L P   KIAK Y IG ++  F    G        +TL+ AL    RD +E+ +  
Sbjct: 366 GGIESLKPLFGKIAKGYLIGEASHDFAKTIGDAFPVAFCQTLENALPLAARDAIESARAE 425

Query: 420 SIVLFSPGCASFDQYNNFRERGFSF 444
            +VL SP CASFDQ+ +F +RG  F
Sbjct: 426 PVVLLSPACASFDQFPDFEKRGDRF 450


>gi|227822653|ref|YP_002826625.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Sinorhizobium
           fredii NGR234]
 gi|227341654|gb|ACP25872.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sinorhizobium
           fredii NGR234]
          Length = 463

 Score =  362 bits (928), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 198/463 (42%), Positives = 283/463 (61%), Gaps = 6/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++F+   +A+FGLG SGL+ A AL   G  V AWDD+P +V +A   GI   D R +
Sbjct: 2   IPVTTFKGRKVALFGLGGSGLATAEALGAGGAAVTAWDDNPDSVAKAMAAGIATADLRHV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  S  VLSPG+ LT    HW V LA+Q  VEIIGD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSAFSAFVLSPGVPLTHPKPHWTVDLAHQAGVEIIGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+ +G D QLGGNIG  +L L+     RF+V+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHILKSSGRDTQLGGNIGRAVLTLDPPKAGRFFVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+ G+LLN++PDHLDRH T+++Y +IK+++V  S  A++ ++D     IA  +   G  +
Sbjct: 182 PTAGILLNLTPDHLDRHGTMQHYADIKERLVAGSGTAVVGVDDSFSSLIAERVERAGTKV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKC-SATSEVIFDFSQ-ETKK--HNIQNLVTSAVVCMQLG 296
            RIS +   +D       S ++  + T+E+  D    +T +  HN QN   +   C+ +G
Sbjct: 242 VRISRRHGLADGIYAEGSSLMRAENGTAELFADLGGIQTLRGGHNAQNAAAAVAACLTVG 301

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           +  ++I   L +  GL HR+Q IA+   ++F+NDSKATN        L+   RIYWIAGG
Sbjct: 302 VDRQDIVHGLKTFPGLKHRMQPIAKRDDIVFVNDSKATNA-DAAAPALSSYERIYWIAGG 360

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL-DQALKSVVRDVEN 415
           L K    S+L P+  +I KAY IG +A +F    G  +   +S TL      +      +
Sbjct: 361 LPKEGGISSLTPYFPRIVKAYLIGEAAPVFAATLGEAVPYEISGTLDRAVAHAAADAARD 420

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
            + P+ V+ SP CASFDQY NF  RG +F+  V+ + G+ ML+
Sbjct: 421 HEGPTAVMLSPACASFDQYKNFEVRGDAFVGHVAALEGVTMLI 463


>gi|85714971|ref|ZP_01045956.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Nitrobacter
           sp. Nb-311A]
 gi|85698168|gb|EAQ36040.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Nitrobacter
           sp. Nb-311A]
          Length = 466

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 191/466 (40%), Positives = 277/466 (59%), Gaps = 9/466 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  ALK  G  VIA DD    + +A   G    D R +
Sbjct: 2   IPVTSFSGKTVAVFGLGGSGLASCRALKAGGAEVIAGDDDTDNLAKAARAGFITADLRNV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W+  + LVL+PG+ LT  + HW V  A Q  VE+IGDIELF RER+  +  +PF+A+TG
Sbjct: 62  SWTNFAALVLAPGVPLTHPSPHWSVLAARQAGVEVIGDIELFCRERKRHAPDAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL++H++R+ G+DVQ+GGNIG  IL+LE     R +VIE SSYQI+L P++D
Sbjct: 122 TNGKSTTTALVAHLMREAGHDVQMGGNIGTAILSLEAPRRGRVHVIEMSSYQIDLAPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIG 237
           P++G+LLN+SPDHLDRH T+E+Y  +K+++   V     A++ ++D  C  IA      G
Sbjct: 182 PTVGILLNVSPDHLDRHGTIEHYAEVKERLIAGVQPQGTAVVGVDDRWCAAIADRQERAG 241

Query: 238 HSISRIS-SQSLQSDSDLYIDESFLKCSATSEVIFD---FSQETKKHNIQNLVTSAVVCM 293
            ++ R+S  Q L    ++  +   L        I D         +HN QN   ++   +
Sbjct: 242 RNVVRVSVRQPLAYGVNVEQERIVLASGGARSEIADIGGIGSLRGRHNAQNAACASAAAL 301

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG+  E +++ L S  GL HR++ + R  HV+F+NDSK TN  +   A L+    I+WI
Sbjct: 302 ALGVSREILQQDLRSFPGLAHRMEQVGRKAHVLFVNDSKGTNADATGKA-LSSFADIFWI 360

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG  KS   ++L  F  +I KAY IG +A  F     GK+   +S TLD A+ +  RD 
Sbjct: 361 AGGKPKSGGIASLDAFFPRIRKAYLIGEAAQEFAATLEGKVAYEISGTLDVAVPAAARDA 420

Query: 414 ENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           E   +  ++VL SP CASFDQ+ NF  RG  F   V  +PG+  ++
Sbjct: 421 EGAGVAEAVVLLSPACASFDQFRNFEVRGDHFRELVQALPGVTPVI 466


>gi|13471551|ref|NP_103117.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Mesorhizobium
           loti MAFF303099]
 gi|30316110|sp|Q98KB1|MURD_RHILO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|14022293|dbj|BAB48903.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Mesorhizobium loti
           MAFF303099]
          Length = 466

 Score =  359 bits (922), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 195/457 (42%), Positives = 274/457 (59%), Gaps = 6/457 (1%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           +SF    +++FGLG SG++ A AL + G  V+AWDD+P +V +A   GI   D R   W+
Sbjct: 5   ASFAGKQVSLFGLGGSGIATARALIEGGAQVLAWDDNPDSVAKAAATGIATADLRGADWA 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S  VLSPG+ LT    HW V+LA    VE+IGDIELF RER   +  +PFIA+TGTNG
Sbjct: 65  KFSAFVLSPGVPLTHPKPHWTVELAKGAGVEVIGDIELFCRERILQAPTAPFIAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+L+  G D Q+GGNIG  ++ L+   P+R +V+ECSSYQI+L P+I+P+ 
Sbjct: 125 KSTTTALTAHILKSAGRDTQMGGNIGRAVMTLDPPKPDRHFVVECSSYQIDLAPSINPTA 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+++Y +IK+++V  S+ AII I+D  C +IA  +   G  + RI
Sbjct: 185 GILLNLTPDHLDRHGTMQHYASIKERLVAGSETAIIGIDDSWCAQIAERLERAGQQVIRI 244

Query: 244 SSQSLQSDSDLYIDESFLKC--SATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           S +   +D       + ++      S+V F         +HN QN + +   C+++GL +
Sbjct: 245 SKRLPLTDGYFADGTNLMEAVHGRYSKVAFLEGIGSLRGQHNAQNALAAVAACLKVGLDL 304

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK 359
            EI+  L S  GL HR++ + R  HV+F+NDSKATN  +   A L+   RIYWIAGGL K
Sbjct: 305 GEIQSGLESFPGLAHRMEQVGRKDHVLFVNDSKATNADAAAPA-LSSFPRIYWIAGGLPK 363

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLP 419
                 L  F  +IAKAY IG +A  F    G  +   +S TL  A+     D       
Sbjct: 364 EGGIEPLRGFFPRIAKAYLIGEAAPAFSATLGEAVPYEISGTLAAAVAHAAHDAAKDDSG 423

Query: 420 S-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
             +VL SP CASFDQ+ NF  RG +F    S I G++
Sbjct: 424 EVVVLLSPACASFDQFKNFEVRGEAFRQAASAIDGVK 460


>gi|182677683|ref|YP_001831829.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|182633566|gb|ACB94340.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 462

 Score =  358 bits (920), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 197/457 (43%), Positives = 269/457 (58%), Gaps = 7/457 (1%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW 62
           +++F+   +A+FGLG SGL +A ALK  G  V  WDD   A + AK  G+EV+D  +  W
Sbjct: 4   VTAFKGKRLALFGLGGSGLVSAQALKAGGAEVAVWDDKDSARETAKAKGLEVLDLSQADW 63

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
           S    LVL+PG+ LT    HW V+ A    +EIIGDIELF RERR  + +SPF+A+TGTN
Sbjct: 64  SQFCALVLAPGVPLTHPKPHWTVEKARAAGIEIIGDIELFCRERRLIAPKSPFVAITGTN 123

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T AL++H+ +  GY+V +GGNIG PIL LE  SP R +VIECSS+QI+LTPT+DP 
Sbjct: 124 GKSTTTALVAHLFQTFGYEVAIGGNIGTPILALEPPSPTRVHVIECSSFQIDLTPTLDPW 183

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           +GVLLNI+PDHLDRH T+ENY  IK ++V  +  A+IC++D  C  IA  +       + 
Sbjct: 184 VGVLLNITPDHLDRHGTMENYAAIKARLVMGADKAVICLDDEPCVAIAETLRQKHKPSTF 243

Query: 243 ISSQSLQSDSDLYIDESFL--KCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGL 297
           +S    +    + +D + L       S VI D +       +HN QN   +       G 
Sbjct: 244 VSISHPELRDGIILDGTTLVRHVDGGSVVIADLAGIASLRGRHNGQNAAAAVAALGAHGY 303

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGL 357
            ++ +++ L S  GL HRL+ + RLG+V+F+NDSKATN  +   A L+ +  I+WI GG 
Sbjct: 304 NLDLVRKGLESFPGLPHRLEEVGRLGNVLFVNDSKATNADAAEKALLSFE-NIFWILGGK 362

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
            K+     L P   KIAK Y IG ++  F    G         TLD A  +  RD +   
Sbjct: 363 PKAGGIDPLRPLFGKIAKGYLIGEASEAFAATIGDAFPLERCGTLDVATAAAARDADASA 422

Query: 418 LP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           LP  IVL SP CAS+DQ+ +F +RG  F      I G
Sbjct: 423 LPDPIVLLSPACASYDQFPDFEKRGDKFRELARAIIG 459


>gi|75675242|ref|YP_317663.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Nitrobacter
           winogradskyi Nb-255]
 gi|118595669|sp|Q3STT0|MURD_NITWN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|74420112|gb|ABA04311.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrobacter
           winogradskyi Nb-255]
          Length = 466

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 282/469 (60%), Gaps = 15/469 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  ALK  G  VIA DD+   + +A   G    D R +
Sbjct: 2   IPVTSFSGKTVAVFGLGGSGLASCHALKAGGAEVIAGDDNADNLAKAAQAGFITADLRTV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W+ ++ LVL+PG+ LT  + HW V  A Q  VE+IGD+ELF RER   +  +PFIA+TG
Sbjct: 62  VWANLAALVLAPGVPLTHPSPHWSVLAARQAGVEVIGDVELFCRERARHAPDAPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL++H++R+ GYDVQ+GGNIG  IL+LE     R +VIE SSYQI+L P++D
Sbjct: 122 TNGKSTTTALVAHLMREAGYDVQMGGNIGTAILSLEPPRRGRVHVIEMSSYQIDLAPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIG 237
           P++G+LLN+SPDHLDRH T+E+Y  +K+++   V     A++ ++DH C  IA      G
Sbjct: 182 PTVGILLNLSPDHLDRHGTIEHYAQVKERLIAGVQPQGTAVVGVDDHWCAAIADRQEQAG 241

Query: 238 HSISRIS-----SQSLQSDSDLYIDESFLKCSATSEV--IFDFSQETKKHNIQNLVTSAV 290
            S+ R+S     +  +  + D  +    +   A SE+  I        +HN QN   ++ 
Sbjct: 242 RSVVRVSVKRPLAHGVSVEQDRIV---LVSGGARSEIADIGGIGSLRGRHNAQNAACASA 298

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
             + LG+  + +++ L S  GL HR++ + R  HV+F+NDSK TN  +   A L+    I
Sbjct: 299 GALALGVSRDILQQDLRSFPGLAHRMEQVGRKAHVLFVNDSKGTNADATEKA-LSSFDEI 357

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
           +WIAGG  KS   ++L  F  +I KAY IG +A  F     GK+   +S TL+ A+ +  
Sbjct: 358 FWIAGGKPKSGGIASLDAFFPRIRKAYLIGEAAQEFAATLEGKVAYEISGTLEAAVPAAA 417

Query: 411 RDVENV-QLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
           RD E   +  ++VL SP CASFDQ+ NF  RG  F   V  +PG+  +V
Sbjct: 418 RDAEGAGRAGAVVLLSPACASFDQFRNFEVRGDRFRELVQALPGVTPVV 466


>gi|27381715|ref|NP_773244.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Bradyrhizobium japonicum USDA 110]
 gi|62900585|sp|Q89FU5|MURD_BRAJA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|27354884|dbj|BAC51869.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bradyrhizobium
           japonicum USDA 110]
          Length = 466

 Score =  357 bits (915), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 193/467 (41%), Positives = 284/467 (60%), Gaps = 11/467 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  ALK  G  VIA DD+   V +A   G    D R++
Sbjct: 2   IPVTSFAGKTVAVFGLGGSGLASCHALKAGGAEVIAADDNAENVAKAAQAGFITADLRDV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W+  + LVL+PG+ LT    HW V  A +  VE+IGDIELF RERR  +  +PF+A+TG
Sbjct: 62  SWAGFAALVLAPGVPLTHPVPHWSVLKAREAGVEVIGDIELFCRERRRHAPDAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+ +  GYD Q+GGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLTKVAGYDTQMGGNIGTAILSLEPPRTGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMNFIG 237
           PS+G+LLN+S DH+DRH T+ +Y  +K+++V        +I+ ++D  C  IA  ++  G
Sbjct: 182 PSVGILLNVSEDHIDRHGTIAHYAAVKERLVAGVQAGGTSIVGVDDGYCRDIADRLDRAG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFL---KCSATSEV--IFDFSQETKKHNIQNLVTSAVVC 292
            ++ RIS ++  + S ++++   +      A SEV  +         HN QN   +A   
Sbjct: 242 KNVVRISVKNPLA-SGIHVEHGTIVRTAGGARSEVAKLGGIGSLRGLHNAQNAACAAAAA 300

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
           + +G+  + ++  L S  GL HR++ + R G+V+F+NDSK TN  +  HA L+    I+W
Sbjct: 301 LAMGISQDVLQDGLRSFPGLAHRMEQVGRRGNVLFVNDSKGTNADATAHA-LSSFADIFW 359

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           IAGG  K+   ++L  F  +I KAY IG +A  F    G ++   +S+TLD A++   RD
Sbjct: 360 IAGGKPKAGGITSLTGFFPRIRKAYLIGEAAQEFSGTLGTQVAHEISQTLDVAVEHAARD 419

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
            E   L  ++VL SP CASFDQY NF  RG  F   V  +PG++ +V
Sbjct: 420 AEASGLTDAVVLLSPACASFDQYRNFEIRGTKFRELVQALPGVKPVV 466


>gi|328542964|ref|YP_004303073.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [polymorphum gilvum
           SL003B-26A1]
 gi|326412710|gb|ADZ69773.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Polymorphum gilvum
           SL003B-26A1]
          Length = 466

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 196/456 (42%), Positives = 272/456 (59%), Gaps = 6/456 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++A+FGLG SG++ A AL+  G  V AWDD P  V +A   G+   D R  
Sbjct: 2   IPVTSFAGRTVALFGLGGSGMATAEALRAGGAEVRAWDDAPARVAEAAARGVVTEDLRNA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  + LVL+PG+ALT    HW V+LA    VE+IGDIELF RERR     +P IA+TG
Sbjct: 62  DWSTFAALVLAPGVALTHPKPHWSVELARTAGVEVIGDIELFCRERRRICPDAPLIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  G DVQ+GGNIG P+L+L    P R YV+ECSSYQI+L P+I+
Sbjct: 122 TNGKSTTTALIAHLLKTLGLDVQMGGNIGTPVLDLAPLQPGRHYVVECSSYQIDLAPSIE 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P++G+L+N+SPDHLDRH T+ENY  IK+++V  S+ A++ ++D   E IA  +   G  +
Sbjct: 182 PTVGILMNLSPDHLDRHGTMENYAAIKERLVAGSRTAVVGVDDRFSEAIADRIARAGVRV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEV----IFDFSQETKKHNIQNLVTSAVVCMQLG 296
            RIS    Q+D         ++  + ++     +        +HN QN   +      LG
Sbjct: 242 RRISGHLPQADGVFAEGSRLVEADSGAQTLGADLAGIGALRGRHNAQNAAAAFAALRALG 301

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           L    I  AL+S  GL HR+Q +AR G ++FINDSKATN  +   A  +   RIYWIAGG
Sbjct: 302 LSAARIAGALVSFPGLAHRMQIVARSGRILFINDSKATNADAAAWALASYD-RIYWIAGG 360

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENV 416
             KS     L  +  +IA+AY IG +A  F     G++   +  TLD A+     D  + 
Sbjct: 361 KPKSGGIEPLADYFPRIARAYLIGEAAEAFAKTLDGRVAHEICGTLDVAVSRAAADAADD 420

Query: 417 QLPSI-VLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
               + VL SP CASFDQY NF  RG +F++ V+ +
Sbjct: 421 PAGEVAVLLSPACASFDQYPNFEVRGDAFVAAVNAL 456


>gi|148257421|ref|YP_001242006.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Bradyrhizobium sp. BTAi1]
 gi|146409594|gb|ABQ38100.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bradyrhizobium sp.
           BTAi1]
          Length = 466

 Score =  355 bits (912), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 198/467 (42%), Positives = 287/467 (61%), Gaps = 11/467 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  AL+  G  V+A DD    + +A   G    D R +
Sbjct: 2   IPVTSFAGKTVAVFGLGGSGLASCHALRAGGADVVAGDDGAERLAEAAKAGFVTADLRTV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  + LVL+PG+ LT    HW V  A +  +E+IGDIELF RERR  +  +PF+A+TG
Sbjct: 62  SWSDFAALVLAPGVPLTHPVPHWSVLKAREAGIEVIGDIELFCRERRRHAPDAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+++  GYD QLGGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLMQTAGYDTQLGGNIGTAILSLEPPRMGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           P++G+LLN+S DH+DRH T+ENY  +K+++V   K    AII ++D     IA  ++  G
Sbjct: 182 PTVGILLNVSEDHIDRHGTIENYAAVKERLVAGVKPEGTAIIGVDDGFSRAIADRLDQAG 241

Query: 238 HSISRISSQSLQSDSDLYID-ESFLKCS--ATSEV--IFDFSQETKKHNIQNLVTSAVVC 292
             + R+S ++  +D  LY++ E+ L+ +  A SEV  +        +HN QN   +A   
Sbjct: 242 KRVVRVSVKNPLADG-LYVEHETILRSASGARSEVARLGGIGSLRGQHNAQNAACAAAAT 300

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
           + +G+K + +++ L S  GL HR++ + R GHV+F+NDSK TN  +  HA L+    I+W
Sbjct: 301 LAIGVKQDVLQQGLRSFPGLVHRMEQVGRRGHVLFVNDSKGTNADATAHA-LSSFADIFW 359

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           IAGG  K+   ++L  F  +I KAY IG +A  F    G K+   +S TL+ A+     D
Sbjct: 360 IAGGKPKAGGITSLEGFFPRIRKAYLIGEAAAEFAGTLGNKVPHAMSGTLEVAVAQAAAD 419

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
            E   L  ++VL SP CASFDQ+ NF  RG  F   V  +PG+E +V
Sbjct: 420 AEASGLTDAVVLLSPACASFDQFRNFEIRGARFRDLVQALPGVERVV 466


>gi|299131927|ref|ZP_07025122.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Afipia sp. 1NLS2]
 gi|298592064|gb|EFI52264.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Afipia sp. 1NLS2]
          Length = 465

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 185/461 (40%), Positives = 271/461 (58%), Gaps = 9/461 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ F   ++AVFGLG SGL++  ALK  G  VIA DD    + QA   G    D R +
Sbjct: 2   IPVTCFEGQTVAVFGLGGSGLASCHALKAGGAEVIAGDDSAERLAQAAKAGFITADLRTV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W   + L+L+PG+ LT    HW V++A++  +E+IGD+ELF RERR  +  +PF+A+TG
Sbjct: 62  SWENFAALILTPGVPLTHPAPHWSVEMAHKAGIEVIGDVELFCRERRRHAPSAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL +H++R+ G+DVQ+GGNIG  IL+LE  +  R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALTAHLMRQAGFDVQMGGNIGTAILSLEPPAARRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           PS+G+LLN++ DH+DRH ++ENY  +K+++V   +    AI+ ++D    K A +    G
Sbjct: 182 PSVGILLNVTEDHIDRHGSIENYAEVKERLVVGVQRGGTAIVGVDDDFSAKAARNAELAG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEV----IFDFSQETKKHNIQNLVTSAVVCM 293
             +  +S Q    +      E+ ++ +A        +        +HN QN   +A   +
Sbjct: 242 KHVVTVSVQRRLDNGVFLEGETIVRGAAGGTAKLVDLRGIGSLRGRHNAQNAACAASAAL 301

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG+  + ++R L S  GL HR++ + R G V+F+NDSK TN  +   A L+    IYWI
Sbjct: 302 ALGVPFDVVQRGLRSFPGLAHRMEQVGRKGEVLFVNDSKGTNADAAGRA-LSSFSDIYWI 360

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG  KS    +L  F  +I KAY IG +A  F     G +   +S TLD A+    RD 
Sbjct: 361 AGGKPKSGGIESLREFFPRIRKAYLIGEAAEEFSKTLEG-VPQEMSGTLDVAVPHAARDA 419

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           E     ++VL SP CASFDQ+ NF  RG  F   V  +PG+
Sbjct: 420 EAAGGQAVVLLSPACASFDQFPNFEVRGDHFRKLVMALPGV 460


>gi|170739957|ref|YP_001768612.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Methylobacterium sp. 4-46]
 gi|168194231|gb|ACA16178.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           sp. 4-46]
          Length = 460

 Score =  353 bits (906), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 187/457 (40%), Positives = 271/457 (59%), Gaps = 12/457 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F   ++A+FGLG SGL+ A +L+  G  VIA DD+P  + +A   GI   D RE  W+
Sbjct: 5   TTFAGRTLALFGLGGSGLATALSLRAGGAAVIACDDNPERMAEAAAQGIATADLREAAWA 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             + L+L+PG+  T    HW VK A +  V +IGDIELF RER  S+  +PF+A+TGTNG
Sbjct: 65  DFAALLLAPGVPFTHPEPHWTVKRAAEAGVPVIGDIELFCRERAASAPDAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T ALI+HVLR+ G+DVQ+GGNIG  IL+L   S +R +VIE SS+QI+LTPT+ PSI
Sbjct: 125 KSTTTALIAHVLRETGHDVQMGGNIGTAILSLAPPSRDRVHVIEMSSFQIDLTPTLAPSI 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           GVLLN++PDHLDRH T+ENY  IK+++V  + HA+I ++D     I+   +     ++R+
Sbjct: 185 GVLLNVTPDHLDRHGTMENYAAIKERLVAGADHAVIGVDDDYTRAISARRD---GPLTRV 241

Query: 244 ------SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
                  +  + +   L ID +    +  +++    +     HN QN   +  V   LG+
Sbjct: 242 HVGEGAEAPGILARHGLLIDGTAEPPAPVADLT-GIASLRGAHNWQNAAVAYAVARGLGV 300

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGL 357
             +   RAL S  GL HR++ + R G V+FINDSKATN  S   A L    R++WI GG 
Sbjct: 301 APDAFARALRSFPGLPHRMEEVGRRGGVLFINDSKATNADSTEKA-LAAFPRVHWILGGK 359

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
            K     +L  +  +IA+AY IG ++  F     G        TLD+A+     D    +
Sbjct: 360 PKEGGIESLRAYFPRIARAYLIGAASEAFAATLEGHAPVIRCGTLDRAVARAAEDAAG-E 418

Query: 418 LPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
             ++VL SP CAS+DQ+ +F +RG  F + V  +PG+
Sbjct: 419 PEAVVLLSPACASYDQFRSFEDRGDQFRAMVRALPGL 455


>gi|298293101|ref|YP_003695040.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Starkeya novella
           DSM 506]
 gi|296929612|gb|ADH90421.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Starkeya novella
           DSM 506]
          Length = 460

 Score =  352 bits (903), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 191/461 (41%), Positives = 268/461 (58%), Gaps = 11/461 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +S+F++ ++A+FGLG SGL+ A AL   G  V AWDD   +V +A   GI   D R +
Sbjct: 2   IPVSTFKDRTVALFGLGGSGLATARALIAGGAEVTAWDDSSESVAKAAAEGIPTGDLRGL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W  +  LVL+PG+ LT    HW  +LA +  VEIIGDIELF RERR +    PF A+TG
Sbjct: 62  DWDDVEALVLAPGVPLTHPEPHWSARLAQEAGVEIIGDIELFCRERRLAPRHPPFAAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL++H+++  G D Q+GGN G  IL LE   P R YVIECSSYQI+L P++D
Sbjct: 122 TNGKSTTTALLAHLMKVGGRDAQIGGNFGPAILGLEPPKPGRVYVIECSSYQIDLAPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM---SKHAIICINDHQCEKIAYDMNFIG 237
           P++G+LLN+SPDHLDRH T+E+Y  +K+++V        A+I ++D     IA  +   G
Sbjct: 182 PAVGILLNLSPDHLDRHGTMEHYAAVKERLVAQVEAGGTAVIGVDDEWSRAIADRVEAAG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE-----TKKHNIQNLVTSAVVC 292
            ++ RIS +   +   +++D   L  +  +   F  S          HN QN   +    
Sbjct: 242 RNVVRISVRERLA-GGIWLDGDTLNVTKNATTEFTLSLAGIGSLRGAHNAQNAAAAFAAA 300

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
             LGL  E I   + S  GL HR++ +  +G V+F+NDSKATN  +   A L     I+W
Sbjct: 301 RALGLAPEVIATGMRSFPGLAHRMEEVRTIGKVLFVNDSKATNADAAERA-LTSFEDIFW 359

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           IAGG  K    + L P+  ++ KAY IG +A  F    G  +   +S TL+ A++S  RD
Sbjct: 360 IAGGKPKEGGIAPLKPYFPRVRKAYLIGVAAEDFAGTLGADVPHEISGTLEVAVESAARD 419

Query: 413 VENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
                L S +VL SP CASFDQ+ NF  RG +F + V  +P
Sbjct: 420 AAASGLASPVVLLSPACASFDQFRNFEVRGDAFRTLVKALP 460


>gi|304392258|ref|ZP_07374200.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ahrensia sp.
           R2A130]
 gi|303296487|gb|EFL90845.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ahrensia sp.
           R2A130]
          Length = 463

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 187/456 (41%), Positives = 271/456 (59%), Gaps = 19/456 (4%)

Query: 9   HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFL 68
            ++A+FGLG SGL  A AL   G  VIA+DD+P +V++A+  GI   D R I W  +  L
Sbjct: 10  QTVALFGLGGSGLVTAAALMAGGTQVIAFDDNPASVERAEAQGITCADLRTIDWDCVDAL 69

Query: 69  VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTV 128
           VL+PG+ LT    HW V+ A +  V I+GD+ELF R+   +   +P IA+TGTNGKS+T 
Sbjct: 70  VLAPGVPLTHPQPHWTVEFARRSEVPIVGDVELFFRQMAKAGRPAPVIAITGTNGKSTTT 129

Query: 129 ALISHVLRKNGYDVQLGGNIGLPILNLEYFS---PNRFYVIECSSYQIELTPTIDPSIGV 185
           ALI+HVL++ G DVQ+GGNIG  +L+L+  S    N+ YV+E SSYQI+L P+I P +G+
Sbjct: 130 ALIAHVLKQAGRDVQMGGNIGRAVLDLDPLSETPANQVYVVEISSYQIDLAPSIAPHVGL 189

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISS 245
           LLN++PDHL+RH TLENY  IK+++V  S  A++ ++D  C  I+  +     S SR   
Sbjct: 190 LLNLTPDHLERHGTLENYAGIKERLVAASDLAVVGLDDEHCRAISGRI-----SASRTPL 244

Query: 246 QSLQSD--SDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGLKVE 300
            ++  D  +D++  +   K     +++ D S       +HN QN   +   C  +GL  E
Sbjct: 245 VTISKDGAADVFFADG--KLIVDGDMVIDLSGVGSLRGQHNGQNAAAAFAACRAVGLSSE 302

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EI+    S  GL HR++    +G V+F+NDSKATN  +V  A L+   +++WIAGGL+K 
Sbjct: 303 EIQSGFNSFPGLAHRMEQAGHVGDVLFVNDSKATNAEAVAPA-LSSFPKVHWIAGGLAKD 361

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE---NVQ 417
               +L P   +IAKAYFIG +A  F       I   ++ +L QA+    RD        
Sbjct: 362 GGIGSLAPQFDRIAKAYFIGEAAGSFASQLPDTIPYEIAGSLKQAVNHAARDASLAAGKG 421

Query: 418 LPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
             ++VL SP  ASFDQ+ NF +RG +F   V+ + G
Sbjct: 422 AEAVVLLSPAAASFDQFPNFEKRGEAFKDAVAALEG 457


>gi|209884381|ref|YP_002288238.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oligotropha
           carboxidovorans OM5]
 gi|209872577|gb|ACI92373.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oligotropha
           carboxidovorans OM5]
          Length = 465

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 183/461 (39%), Positives = 267/461 (57%), Gaps = 9/461 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SG+++  ALK  G  V+A DD    + QA   G    D R +
Sbjct: 2   IPITSFAGQTVAVFGLGGSGVASCRALKAGGAEVVAGDDSAERLAQAAREGFITADLRTV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W   + L+L+PG+ LT    HW V++A +  +E+IGDIELF RERR  +  +PFIA+TG
Sbjct: 62  SWENFAALILTPGVPLTHPRPHWTVEMARKAGIEVIGDIELFCRERRLHAPGAPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL +H++R+ G+D Q+GGNIG  IL+L   +P R YVIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALTAHLMREAGFDAQMGGNIGTAILSLAPPAPQRVYVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMNFIG 237
           PS+G+LLN++ DH+DRH ++E+Y  +K+++V        AI+ ++D    K A      G
Sbjct: 182 PSVGILLNVTEDHIDRHGSIEHYAEVKERLVVGVPRGGTAIVGVDDDFSTKAARAAEDTG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEV----IFDFSQETKKHNIQNLVTSAVVCM 293
             + R+S Q    D      E  ++ +A        +        +HN QN   +A   +
Sbjct: 242 KHVVRVSVQRALDDGVFLDGERIVRGAAGGTAKLVDLNGIGSLRGRHNAQNAACAASAAL 301

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG+  + ++R L S  GL HR++ + + G V+F+NDSK TN  +   A L+    IYWI
Sbjct: 302 ALGVPFDVVQRGLASFPGLAHRMEQVGQKGEVLFVNDSKGTNADAAARA-LSSFTNIYWI 360

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG  K+    +L  F  +I KAY IG +A  F     G +   +S TLD+A+    RD 
Sbjct: 361 AGGKPKTGGIESLREFFPRIRKAYLIGEAAQEFSRTLEG-VPQEISGTLDEAVPHAARDA 419

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
                 ++VL SP CASFDQ+ NF  RG  F   V  + G+
Sbjct: 420 AASGGHAVVLLSPACASFDQFPNFEVRGDYFRKLVLALGGV 460


>gi|49474458|ref|YP_032500.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bartonella
           quintana str. Toulouse]
 gi|62900524|sp|Q6G122|MURD_BARQU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|49239962|emb|CAF26367.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           quintana str. Toulouse]
          Length = 466

 Score =  348 bits (893), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 186/461 (40%), Positives = 267/461 (57%), Gaps = 15/461 (3%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           + ++   +A+FGLG+SGL+AA AL   G  V+AWDD+P  V  AK   I   D +   WS
Sbjct: 5   TCYKGQKVALFGLGKSGLAAAQALMSGGAKVVAWDDNPSGVHTAKRENIPTRDLQYENWS 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQSPFI 116
               L+L+PG+ LT    HW V  A Q ++EI+GDIELFVR R        F     PFI
Sbjct: 65  EFVALILAPGVPLTYPQPHWVVDKARQADIEIVGDIELFVRARNHFLQHSGFRDQDVPFI 124

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           A+TGTNGKS+T AL++H+L + GYDVQ+GGNIG  IL L+ F   R YVIECSS+QIELT
Sbjct: 125 AITGTNGKSTTTALLAHLLEQMGYDVQMGGNIGTAILTLKPFVKKRIYVIECSSFQIELT 184

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI 236
           P++ P+IG+LLN++ DH+DRH +   YV  K+++VT + +A I +++  C+ +   +   
Sbjct: 185 PSLQPTIGLLLNLTSDHIDRHGSFAAYVQAKRRLVTGASYAFISVDNAVCQALYQQLLDE 244

Query: 237 GHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTSAVV 291
           GH +  +S +    ++  Y D +  F  C     ++ D +  T     HN QN +     
Sbjct: 245 GHQVGAVSKEHF-VENGFYADRTKLFSVCQGQRHMLADLADMTALRGSHNAQNALMVLAT 303

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
              L +    I++ L S  GL HR+Q + ++G V+FINDSKATN  +   A L+    I+
Sbjct: 304 LQALKISDPHIEKYLASYKGLAHRMQQVRKMGPVLFINDSKATNAEASAPA-LSTFNDIF 362

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           WI GG +K      L  F  KI KAY IG +A  F    G     ++S TL+ A+     
Sbjct: 363 WIVGGQAKEGGIEALRGFFHKIRKAYLIGEAAQEFAGVIGSAFPFSMSLTLENAVHEATV 422

Query: 412 DVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           D    +   ++VLFSP CAS+DQ+ N+  RG +F+S V ++
Sbjct: 423 DAMCCKAKEAVVLFSPACASYDQFKNYEVRGEAFVSFVMQL 463


>gi|115524118|ref|YP_781029.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodopseudomonas palustris BisA53]
 gi|115518065|gb|ABJ06049.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodopseudomonas
           palustris BisA53]
          Length = 482

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 189/470 (40%), Positives = 276/470 (58%), Gaps = 13/470 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF    +AVFGLG SGL++  ALK  G  VIA DD    + QA   G    D R +
Sbjct: 14  IPVTSFAGKMVAVFGLGGSGLASCHALKAGGAEVIACDDDLDRMVQAAQAGFITADLRGV 73

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           PW   + L+L+PG+ LT    HW V  A +  VE+IGD+ELF RER   + ++PF+A+TG
Sbjct: 74  PWQNFAALILTPGVPLTHPAPHWTVLAAREAGVEVIGDVELFCRERLRHAPEAPFVAITG 133

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H++R+ GYD Q+GGNIG  IL+L+     R +VIE SSYQI+LTP++D
Sbjct: 134 TNGKSTTTALIAHLMRQAGYDTQMGGNIGTAILSLQPPQNGRVHVIEMSSYQIDLTPSLD 193

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMNFIG 237
           PS+G++LN++ DH+DRH ++ENY  +K+++V        AII ++D     +A  +   G
Sbjct: 194 PSVGIMLNVTEDHIDRHGSIENYAAVKERLVAGVLPQGCAIIGVDDGFGRDMADRLERAG 253

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCS--ATSEV--IFDFSQETKKHNIQNLVTSAVVCM 293
             + R+S +   +D  +   E+ +K +  A  E+  I         HN QN   +A   +
Sbjct: 254 QPVLRVSVKGPLADGIIVEHETIVKVAGGARQEIARIGGIGSLRGLHNAQNAACAAAAVL 313

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIAR----LGHVIFINDSKATNLHSVIHAFLNEKRR 349
            LG++ E +++ L S  GL HR++ + R     G  +F+NDSK TN  +   A L+    
Sbjct: 314 ALGVRGETLQQGLRSFPGLAHRMEQVGRQAGNQGATLFVNDSKGTNADATAKA-LSSFGD 372

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
           I+WIAGG  K+    +L  F  +I KAY IG +A  F     G++   +S+TLD A+   
Sbjct: 373 IFWIAGGKPKTGGIESLAEFFPRIRKAYLIGAAAQEFAATLEGRVAYEISETLDVAVPHA 432

Query: 410 VRDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
            RD     LP  +VL SP CASFDQ+ NF  RG  F   V+ +PG+  +V
Sbjct: 433 ARDAAASGLPEPVVLLSPACASFDQFRNFEIRGTHFRDLVTALPGVAAVV 482


>gi|254500899|ref|ZP_05113050.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Labrenzia
           alexandrii DFL-11]
 gi|222436970|gb|EEE43649.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Labrenzia
           alexandrii DFL-11]
          Length = 466

 Score =  346 bits (887), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 192/459 (41%), Positives = 279/459 (60%), Gaps = 8/459 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           +++++F   ++A+FGLG SGL+ A AL+  G +V+ +DD+   V +A   G++  D + +
Sbjct: 2   IEVTTFEVQTVALFGLGGSGLATAKALQAGGANVVCFDDNETRVAEAAAAGLKTQDLKTL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS +S LVL+PG+ LT    HW V LA    VE+IGD+ELF RE R    ++PFIA+TG
Sbjct: 62  DWSGVSALVLAPGVPLTHPVPHWSVDLARNAGVEVIGDVELFCREHRKLCPEAPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR+ G DVQ+GGNIG P+L LE   P R YV+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHLLRELGLDVQMGGNIGTPVLELEPPRPGRHYVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P++G+ +N+SPDHLDRH TLENY  IK+++V  +K AI+ ++D     IA  +      +
Sbjct: 182 PTVGLHMNLSPDHLDRHGTLENYAAIKERLVAGAKVAIVGVDDGLSSMIADRLELARKPV 241

Query: 241 SRISSQSLQSDSDLYIDESFL---KCSATSEVIFDFSQETKK--HNIQNLVTSAVVCMQL 295
            RI+ +  +  + +Y     L      A +EV      ++ +  HN QN   +      L
Sbjct: 242 CRIAGER-ELTAGIYAHNGRLIEAHDGAQTEVALLMGIDSLRGDHNAQNAAAAFACLRAL 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
            +  ++I  A+ +  GL HR++ +AR G  +FINDSKATN  +   A  +   RIYWIAG
Sbjct: 301 EIPADKIAAAMKNFPGLHHRMEIVARTGRTLFINDSKATNADAAARALASFD-RIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS-VVRDVE 414
           G +K+   S+L  +   IAKA+ IG +A  F     G +   +S TL QA++       E
Sbjct: 360 GRAKAGGISSLDEYFPNIAKAFLIGEAAEEFAKTLDGHVPYAVSGTLTQAVRDAAAEAAE 419

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           +      +L SP CASFDQY NF  RG +F++ V  +PG
Sbjct: 420 DGAEEIAILLSPACASFDQYANFELRGAAFVNAVRALPG 458


>gi|188584358|ref|YP_001927803.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Methylobacterium populi BJ001]
 gi|179347856|gb|ACB83268.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           populi BJ001]
          Length = 455

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 185/453 (40%), Positives = 265/453 (58%), Gaps = 8/453 (1%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SGL+   +L   G  V+AWDD+  +  +A++ GI V D  +  WS
Sbjct: 5   TTFAGQKLALFGLGGSGLATVRSLLAGGADVLAWDDNAGSRDRAREQGITVTDLNDADWS 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S LVL+PG+ LT    HW V LA Q  + IIGDIE+F RER   + ++PF+A+TGTNG
Sbjct: 65  GFSALVLAPGVPLTHPEPHWTVGLAQQAGIPIIGDIEIFCRERAALAPEAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+LR  G DVQ+GGNIG  +L+L   + NR +V+E SS+QI+LTP++DPS+
Sbjct: 125 KSTTTALTAHLLRHAGRDVQMGGNIGTAVLSLAPPAENRVHVVELSSFQIDLTPSLDPSV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+ENY  IK+++V  S  A+I ++D  C  IA      G  I R+
Sbjct: 185 GILLNLTPDHLDRHGTMENYAAIKERLVAGSDLAVIGVDDAYCAAIAGRRR--GERI-RL 241

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLKVE 300
             +     +  Y+  +         VI + S       +HN+QN   +    ++LGL   
Sbjct: 242 HVEGHGDAAGDYVCRAGAVRGPDGAVIAEISGIQSLLGEHNLQNAAAAVAAALRLGLTGA 301

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EI   L S  GL HR++ + R+G  +F+NDSKATN  S   A L   R I+WI GG +K 
Sbjct: 302 EIAAGLKSFPGLAHRMEPLRRIGPTLFVNDSKATNADSTEKALL-AFRDIHWIVGGKAKE 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420
                L P   ++A AY IG S+  F     G++  T   TL+ A  +  +        +
Sbjct: 361 GGIEPLAPLFDRVAHAYLIGASSDAFAATLDGRLPFTRCDTLEAATAAAAQAARASATDA 420

Query: 421 -IVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
            +VL SP CAS+DQ+ NF  RG  F + V+ +P
Sbjct: 421 PVVLLSPACASYDQFPNFEVRGDRFRALVAALP 453


>gi|170748777|ref|YP_001755037.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170655299|gb|ACB24354.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 454

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 191/456 (41%), Positives = 269/456 (58%), Gaps = 9/456 (1%)

Query: 2   KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP 61
            ++ F++ ++A+FGLG SGL+ A ALK  G  V AWDD+  ++ +A++ GIE  D RE  
Sbjct: 3   PVTVFQDKTVALFGLGGSGLATALALKAGGAAVQAWDDNADSLARAREAGIETRDLREAD 62

Query: 62  WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
           WS  +  VLSPG+ LT    HW V+LA    V IIGDIELF RERR  +  +PF+A+TGT
Sbjct: 63  WSGFAAFVLSPGVPLTHPEPHWSVRLARDAGVAIIGDIELFCRERRARAPGAPFVAITGT 122

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+T ALI+HVL + G DVQ+GGNIG  IL+LE  + +R +VIE SS+QI+LTP++DP
Sbjct: 123 NGKSTTTALIAHVLAQGGRDVQMGGNIGTAILSLEPPAADRVHVIEMSSFQIDLTPSLDP 182

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
           S+GVL+NI+PDHLDRH T+E Y  IK++++  +  A++ ++D     IA   +  G  + 
Sbjct: 183 SVGVLMNITPDHLDRHGTMEQYAAIKERLIQGAGLAVVGVDDAPSRAIA---DRRGADLV 239

Query: 242 RI---SSQSLQSDSDLYIDESFLKCSATSEV-IFDFSQETKKHNIQNLVTSAVVCMQLGL 297
           R+       L +D+    D    +   T+   +         HN QN   +  V   L L
Sbjct: 240 RVHVPHGDVLCTDALTVRDGIVREPDGTALADVNGIGSLRGAHNWQNAAVAVAVARALDL 299

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGL 357
             E+I+  L S  GL HR++ + R GHV+F+NDSKATN  S   A L   R I+WI GG 
Sbjct: 300 SPEQIQAGLTSFPGLPHRMEEVGRRGHVLFVNDSKATNADSTEKA-LTAFRDIHWILGGK 358

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           +K      L P+  ++A AY IG ++  F     G +  T  +TL+ A+     +     
Sbjct: 359 AKEGGIFPLVPYFERVAHAYLIGAASDAFAATLEGAVPYTRCETLENAVPKAAENAAASG 418

Query: 418 LP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
            P  +VL SP CAS+DQ+ NF  RG  F   V  +P
Sbjct: 419 APEPVVLLSPACASYDQFRNFEIRGNRFRELVQALP 454


>gi|220920537|ref|YP_002495838.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Methylobacterium nodulans ORS 2060]
 gi|219945143|gb|ACL55535.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylobacterium
           nodulans ORS 2060]
          Length = 460

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 181/456 (39%), Positives = 263/456 (57%), Gaps = 10/456 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F   ++A+FGLG SGL+ A +L+  G  V+A DD+P  +  A+  G+   D R   W+
Sbjct: 5   TTFAGRTLALFGLGGSGLATALSLQAGGARVVACDDNPERMAAAEAEGVATADLRGADWA 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             + L+L+PG+  T    HW VK A    V +IGDIELF RER  ++  +PF+A+TGTNG
Sbjct: 65  EFAALLLAPGVPFTHPEPHWTVKRAASAGVPVIGDIELFCRERATTAPDAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T ALI+HVLR+ G+DVQ+GGNIG  IL+L   +P R +VIE SS+QI+LTPT+ PS+
Sbjct: 125 KSTTTALIAHVLRETGHDVQMGGNIGTAILSLAPPAPGRVHVIEMSSFQIDLTPTLKPSV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           GVLLNI+PDHLDRH  + NY  IK++++  S HA+I ++D     IA         ++R+
Sbjct: 185 GVLLNITPDHLDRHGDMANYAGIKERLIASSDHAVIGVDDDYTRAIAARH---AGPLTRV 241

Query: 244 SSQSLQSDSDLYIDESFL--KCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLK 298
                     +      L   C+     + D +        HN QN   +  V   LG+ 
Sbjct: 242 HVGETAPGPGILARHGVLIDGCTEPPSPVADLTGIPSLRGSHNWQNAGIAYAVARALGVA 301

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLS 358
            +   +AL S  GL HR++ + R G V+FINDSKATN  S   A L    R++WI GG  
Sbjct: 302 PDAFAQALRSFPGLPHRMEEVGRRGSVLFINDSKATNADSTEKA-LAAFPRVHWILGGKP 360

Query: 359 KSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQL 418
           K    ++L P+  +IA AY IG ++  F     G    +   TL+ A+     D  + + 
Sbjct: 361 KEGGIASLAPYFPRIAHAYLIGAASDAFAATLEGHAPVSRCGTLEAAVAQAAEDAAH-EP 419

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
            ++VL SP CAS+DQ+ +F +RG  F + V  +PG+
Sbjct: 420 EAVVLLSPACASYDQFRSFEDRGDQFRAMVRALPGL 455


>gi|118590894|ref|ZP_01548294.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Stappia
           aggregata IAM 12614]
 gi|118436416|gb|EAV43057.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Stappia
           aggregata IAM 12614]
          Length = 466

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 182/457 (39%), Positives = 269/457 (58%), Gaps = 6/457 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++F    +A+FGLG SGL+ A ALK  G  V+ +DD+   V QA   G+   + R++
Sbjct: 2   ISVTTFEGRKVALFGLGGSGLATARALKAGGADVVCFDDNEARVTQAAGEGLSTQNLRDL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS ++ LVL+PG+ LT    HW V LA    VEI+GD+ELF RERR     +P IA+TG
Sbjct: 62  DWSNVAALVLAPGVPLTHPVPHWSVDLARDAGVEIVGDVELFCRERRKQCPAAPLIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+  G DVQLGGNIG P+L L+   P R YV+ECSSYQI+L PT+D
Sbjct: 122 TNGKSTTTALIAHLLKALGRDVQLGGNIGTPVLELDPPQPGRHYVVECSSYQIDLAPTLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
            ++G+ +N+SPDHLDRH ++ENY  IK+++V  +K A++ ++D     IA  M      +
Sbjct: 182 ATVGIHMNLSPDHLDRHGSMENYAAIKERLVAGAKVAVVGVDDRLSSAIADRMELARKPV 241

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEV----IFDFSQETKKHNIQNLVTSAVVCMQLG 296
            RI+ +   ++         ++    S+V    +         HN QN   +      L 
Sbjct: 242 CRIAGEKELTNGIYARHGRLIEAHDGSQVEVALLGGIDSLRGDHNGQNAAAAFAALRALE 301

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           +   +I  AL +  GL HR++ + + G +++INDSKATN  +   A  + + RIYWIAGG
Sbjct: 302 IPAAQIAEALKTFPGLHHRMEVVEKKGRILYINDSKATNADAAARALASFE-RIYWIAGG 360

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS-VVRDVEN 415
            +K+   S+L  +  KIAK + IG +A  F     G++   +S TL+QA++       E+
Sbjct: 361 RAKAGGISSLDEYFPKIAKTFLIGEAAQDFAKTLDGRVPFKISGTLNQAVQDAAAEAAED 420

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
                 +L SP CASFDQ+ NF  RG +F+  V  +P
Sbjct: 421 GAEEIAILLSPACASFDQFPNFELRGAAFVDAVRALP 457


>gi|307944896|ref|ZP_07660233.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseibium sp.
           TrichSKD4]
 gi|307771820|gb|EFO31044.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseibium sp.
           TrichSKD4]
          Length = 466

 Score =  340 bits (872), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 182/457 (39%), Positives = 265/457 (57%), Gaps = 8/457 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF    +A+FGLG SGLS A AL + G  V  WDD P  + +AK   + V D  ++
Sbjct: 2   IAITSFSGKHVALFGLGASGLSTALALVEGGCKVTCWDDAPARLVEAKRKKLIVEDLNKV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS    L+L+PG++LT    HW V  A    +E+IGD+ELF RERR    ++P +A+TG
Sbjct: 62  DWSEFDALILAPGVSLTHPLPHWTVDKARDAGIEVIGDVELFFRERRKVCPEAPVVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T +LI+H+L+  G D Q+GGNIG+P+L LE F   R +VIECSSYQI+L P++D
Sbjct: 122 TNGKSTTTSLIAHLLKSAGLDTQMGGNIGVPLLELEPFHAERHFVIECSSYQIDLAPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+IG+ +N+SPDHLDRH +LENY  IK+++V  +K AI+ ++D    +IA  +      +
Sbjct: 182 PTIGIHMNLSPDHLDRHGSLENYAAIKERLVAGAKVAIVGVDDSLSTQIADRLELARKPV 241

Query: 241 SRISSQSLQSDSDLY-----IDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
            RIS  + +    +Y     + E++        ++         HN QN   +      L
Sbjct: 242 CRISG-AFELPDGVYAHQGKLFEAYDGAQRKVGILDGIDSLRGDHNGQNAAAAFAALRVL 300

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
            +   EI + +    GL HR++ + R G ++F+NDSKATN        L+   RIYWIAG
Sbjct: 301 KVDEAEILKGMADFPGLHHRMEVVGRSGRLLFVNDSKATNA-DAAARALSSFDRIYWIAG 359

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           GL K    ++L  +  ++A+AY IG +A  F     G ++ TLS TL++A+     D   
Sbjct: 360 GLPKEGGIASLDLYWPRVARAYLIGEAAEEFGKTLKGHVDYTLSGTLEKAVVQATSDARA 419

Query: 416 VQLPSI-VLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                + VL SP CASFDQY NF  RG +F   V  +
Sbjct: 420 DAADEVAVLLSPACASFDQYANFELRGSAFSEAVRNL 456


>gi|254563999|ref|YP_003071094.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           extorquens DM4]
 gi|254271277|emb|CAX27289.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           extorquens DM4]
          Length = 455

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 183/454 (40%), Positives = 260/454 (57%), Gaps = 10/454 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SGL    +L   G  V+AWDD+  +  +A++ GI V D  E  WS
Sbjct: 5   TTFAGQKLALFGLGGSGLVTVRSLLAGGADVLAWDDNAGSRDRAREQGITVTDLNEADWS 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S LVL+PG+ LT    HW V+LA +  + IIGDIE+F RER   +  +PF+A+TGTNG
Sbjct: 65  GFSALVLAPGVPLTHPEPHWTVELARKAGIPIIGDIEIFCRERTALAPDAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+LR  G DVQ+GGNIG  IL+LE  + NR +V+E SS+QI+LTP++ P +
Sbjct: 125 KSTTTALTAHLLRHAGRDVQMGGNIGTAILSLEPPAANRVHVVELSSFQIDLTPSLKPGV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+ENY  IK+++V  +  A+I ++D  C  IA      G  I R+
Sbjct: 185 GILLNLTPDHLDRHGTMENYAAIKERLVAGADLAVIGVDDPYCAAIAERRT--GERI-RL 241

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLKVE 300
             +     +  Y+  +         VI + +        HN+QN   +    ++LGL   
Sbjct: 242 HVEGHGDAAGDYVGANGTVRGPDGAVIAEVTGIQALLGDHNLQNAAAAVAAAIRLGLSGA 301

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EI   L S  GL HR++ + R+G  +F+NDSKATN  S   A L   R I+WI GG +K 
Sbjct: 302 EIAAGLKSFPGLAHRMEPLRRIGPTLFVNDSKATNADSTEKALL-AFRDIHWIVGGKAKE 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL--DQALKSVVRDVENVQL 418
                L P   ++A AY IG S+  F     G++  T   TL       +        + 
Sbjct: 361 GGIEPLAPLFDRVAHAYLIGASSEAFAATLEGRVAFTRCGTLEAATEAAARAARASGTEA 420

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           P +VL SP CAS+DQ+ NF  RG  F + V+ +P
Sbjct: 421 P-VVLLSPACASYDQFPNFEVRGDRFRTLVAALP 453


>gi|218532974|ref|YP_002423790.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Methylobacterium chloromethanicum CM4]
 gi|218525277|gb|ACK85862.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylobacterium
           chloromethanicum CM4]
          Length = 455

 Score =  339 bits (870), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 184/454 (40%), Positives = 258/454 (56%), Gaps = 10/454 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SGL    +L   G  V+AWDD+  +  +A++ GI V D  E  WS
Sbjct: 5   TTFAGQKLALFGLGGSGLVTVRSLLAGGADVLAWDDNAGSRDRAREQGITVTDLNEADWS 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S LVL+PG+ LT    HW V LA Q  + IIGDIE+F RER   +  +PF+A+TGTNG
Sbjct: 65  GFSALVLAPGVPLTHPEPHWTVGLARQAGIPIIGDIEIFCRERAALAPDAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+LR  G DVQ+GGNIG  IL+LE  +  R +V+E SS+QI+LTP++ P +
Sbjct: 125 KSTTTALTAHLLRHAGRDVQMGGNIGTAILSLEPPAATRVHVVELSSFQIDLTPSLKPGV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+ENY  IK+++V  +  A+I ++D  C  IA      G  I R+
Sbjct: 185 GILLNLTPDHLDRHGTMENYAAIKERLVAGADLAVIGVDDPYCAAIAERRT--GERI-RL 241

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLKVE 300
             +     +  Y+  +         VI + S        HN+QN   +    ++LGL   
Sbjct: 242 HIEGHGDAAGDYVGANGTVRGPDGAVIAEVSGIQALLGDHNLQNAAAAVAAAIRLGLSSA 301

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EI   L S  GL HR++ + R+G  +F+NDSKATN  S   A L   R I+WI GG +K 
Sbjct: 302 EIAAGLKSFPGLAHRMEPLRRIGPTLFVNDSKATNADSTEKALL-AFRDIHWIVGGKAKE 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL--DQALKSVVRDVENVQL 418
                L P   ++A AY IG S+  F     G++  T   TL       +        + 
Sbjct: 361 GGIEPLAPLFDRVAHAYLIGASSEAFAATLEGRVAFTRCGTLEAATEAAARAARASGTEA 420

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           P +VL SP CAS+DQ+ NF  RG  F + V+ +P
Sbjct: 421 P-VVLLSPACASYDQFPNFEVRGDRFRTLVAALP 453


>gi|49475857|ref|YP_033898.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bartonella
           henselae str. Houston-1]
 gi|62900525|sp|Q6G2Q3|MURD_BARHE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|49238665|emb|CAF27911.1| udp-n-acetylmuramoylalanine--d-glutamate ligase [Bartonella
           henselae str. Houston-1]
          Length = 466

 Score =  339 bits (870), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 184/464 (39%), Positives = 264/464 (56%), Gaps = 15/464 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ ++   +A+FGLG+SGL+ A AL   G  V+AWDD+P  V+ A    I   + +  
Sbjct: 2   ISIAFYKGKKVALFGLGKSGLATAQALISGGADVVAWDDNPSGVQAAHRENIPARNLQYE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            WS    L+L+PG+ LT    HW V  A Q N+EIIGDIELFVR R        F     
Sbjct: 62  NWSEFVALILAPGVPLTYPQPHWVVDKARQANIEIIGDIELFVRARNHFLQQYGFCDEDV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T AL++H+L + GYDVQ+GGNIG  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTALLAHLLEQMGYDVQMGGNIGTAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           +L P++ P+IG+LLN++PDH+DRH +  +YVN KK +VT +  A I ++D  C+ +   +
Sbjct: 182 DLAPSLQPTIGLLLNLTPDHIDRHGSFAHYVNAKKNLVTGASQAFISVDDAACQVLYRQL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTS 288
              GH +  +S +    ++  Y D +  F  C     ++ D +        HN QN + +
Sbjct: 242 LHEGHHVEAVSKEHF-VENGFYADGTQLFSVCQGRRHMLADLASMAALRGSHNAQNALMA 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +    + + L S  GL HR+Q + ++G V+FINDSKATN        L    
Sbjct: 301 LATLQALKITDPHMNKHLASYQGLAHRMQQVRKMGSVLFINDSKATNA-EASAPALAAFN 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WI GG +K     +L  F  KI KAY IG +A  F    G     ++S TL+ A+  
Sbjct: 360 NIFWIVGGQAKEAGIVSLRGFFHKIRKAYLIGAAAEEFAGVIGSSFPFSMSLTLENAVHE 419

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              D    +    +VLFSP CAS+DQ+ N+  RG +F+S V ++
Sbjct: 420 AAVDAMRCKAKEVVVLFSPACASYDQFKNYEVRGEAFISFVMQL 463


>gi|319407505|emb|CBI81153.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella sp.
           1-1C]
          Length = 468

 Score =  339 bits (869), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 183/469 (39%), Positives = 272/469 (57%), Gaps = 15/469 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  +R   +AVFGLG+SG++ A  L   G  V+AWDD+  +V+ A    I   D    
Sbjct: 2   ISVECYRGQKVAVFGLGKSGIATAKVLIACGTEVVAWDDNCSSVEAACKENIPTKDLYYE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            W+    L+L+PG+ LT    HW V+ A Q N+EIIGDIELFVR R        F     
Sbjct: 62  DWTEFVALILAPGVPLTYPRPHWVVEKARQENIEIIGDIELFVRARNLFLQQNGFDDQDV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T AL++H+L K GYDVQ+GGNIG  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTALLAHLLEKMGYDVQMGGNIGTAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           EL P++ P++G+LLN++PDH+DRH + E YV +K+++V+ +  A+I I+   C  +   +
Sbjct: 182 ELAPSLQPTVGLLLNLTPDHIDRHGSFERYVQVKERVVSRASRALISIDSLVCCALYQKL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTS 288
              G+SI  +S + +  +   Y++ +  F        ++ D +  T     HN +N + +
Sbjct: 242 FSEGYSIDPVSKEHVVKNG-FYVEGTKLFAIYHGQHHMLADLANITSLRGSHNAENALMA 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +   +I+  L S  GL HR+Q + ++G ++FINDSKATN  S + A L    
Sbjct: 301 LATLQILKITTLDIEEHLASYLGLAHRMQQVCKIGSILFINDSKATNAESSVPA-LTTFN 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WI GG  K      L  F  KI KAY IG++A  F    G     ++S  L+ A++ 
Sbjct: 360 NIFWIVGGQEKEGGIDALKGFFYKIRKAYLIGSAAENFARIIGSAFPFSMSLNLENAVRE 419

Query: 409 VVRD-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
              D   +++  ++VLFSP CAS+DQ+ N+  RG +F+S V ++   E+
Sbjct: 420 AASDAARDMEKEAVVLFSPACASYDQFKNYEVRGETFVSLVMQLKKQEL 468


>gi|163868715|ref|YP_001609927.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bartonella
           tribocorum CIP 105476]
 gi|161018374|emb|CAK01932.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           tribocorum CIP 105476]
          Length = 464

 Score =  338 bits (868), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 187/474 (39%), Positives = 269/474 (56%), Gaps = 35/474 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ ++   +A+FGLG SGL+ A AL   G  V+AWDDHP +V++A +  I   D    
Sbjct: 2   ISVACYKGKKVALFGLGMSGLATAQALMRGGAEVVAWDDHPASVQEAFEKNIPTRDLHNE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            WS    LVL+PG+ L     HW V+ A + N+EIIGDIELFVR R        F     
Sbjct: 62  DWSEFVALVLAPGVPLIYPKPHWVVEKARKENIEIIGDIELFVRARHHFLQHYDFCDQDI 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T AL++H+L K GYDVQ+GGNIG  IL LE F+  R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTALLAHLLEKMGYDVQVGGNIGQAILTLEPFAKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           +L P++ P+IG+LLN++PDH+DRH +   YV  KK++V  +  A I ++D  CE +   +
Sbjct: 182 DLAPSLQPTIGLLLNLTPDHIDRHGSFARYVQTKKQLVAQASQAFISVDDAACEILYQQL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV-- 291
              GH I  IS        D +++  F    A    +F   Q  ++H + NL + A +  
Sbjct: 242 LHEGHKIEAIS-------KDHFVENGFY---AEGTKLFSVRQ-GERHMLANLASVATLRG 290

Query: 292 -------------CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHS 338
                           L +    + + L S  GL HR+Q + ++G ++FINDSKATN  +
Sbjct: 291 DHNAQNALMALAALQALKITDRSLNKHLASYKGLPHRMQQVRKMGTILFINDSKATNADA 350

Query: 339 VIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL 398
              A L     I+WI GG +K     +L  F  KI KAY IG++A  F    G  +  ++
Sbjct: 351 TAPA-LCAFNDIFWIVGGQAKKGGIESLREFFPKIRKAYLIGSAAEEFARIIGSALPFSM 409

Query: 399 SKTLDQALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           S TL+ A++    D  + +    +VL SP CAS+DQ+ N+  RG +F+S V ++
Sbjct: 410 SLTLENAVREATIDAMHCKAKEVVVLLSPACASYDQFKNYEVRGEAFVSLVMQL 463


>gi|163854031|ref|YP_001642074.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Methylobacterium extorquens PA1]
 gi|163665636|gb|ABY33003.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           extorquens PA1]
          Length = 455

 Score =  338 bits (866), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 183/454 (40%), Positives = 258/454 (56%), Gaps = 10/454 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SGL    +L   G  V+AWDD+  +  +A++ GI V D  E  WS
Sbjct: 5   TTFAGQKLALFGLGGSGLVTVRSLLAGGADVLAWDDNAGSRDRAREQGITVTDLNEADWS 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S LVL+PG+ LT    HW V LA Q  + +IGDIE+F RER   +  +PF+A+TGTNG
Sbjct: 65  GFSALVLAPGVPLTHPEPHWTVGLARQAGIPVIGDIEIFCRERAALAPDAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+LR  G DVQ+GGNIG  IL+LE  +  R +V+E SS+QI+LTP++ P +
Sbjct: 125 KSTTTALTAHLLRHAGRDVQMGGNIGTAILSLEPPAATRVHVVELSSFQIDLTPSLKPGV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+ENY  IK+++V  +  A+I ++D  C  IA      G  I R+
Sbjct: 185 GILLNLTPDHLDRHGTMENYAVIKERLVAGADLAVIGVDDPYCAAIAERRT--GERI-RL 241

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLKVE 300
             +     +  Y+  +         VI + S        HN+QN   +    ++LGL   
Sbjct: 242 HIEGHGDAAGDYVGANGTVRGPDGAVIAEVSGIQALLGDHNLQNAAAAVAAAIRLGLTST 301

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EI   L S  GL HR++ + R+G  +F+NDSKATN  S   A L   R I+WI GG +K 
Sbjct: 302 EIAAGLKSFPGLAHRMEPLRRIGPTLFVNDSKATNADSTEKALL-AFRDIHWIVGGKAKE 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL--DQALKSVVRDVENVQL 418
                L P   ++A AY IG S+  F     G++  T   TL       +        + 
Sbjct: 361 GGIEPLAPLFDRVAHAYLIGASSEAFAATLEGRVAFTRCGTLEAATEAAARAARASGTEA 420

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           P +VL SP CAS+DQ+ NF  RG  F + V+ +P
Sbjct: 421 P-VVLLSPACASYDQFPNFEVRGDRFRTLVAALP 453


>gi|254470506|ref|ZP_05083910.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudovibrio sp.
           JE062]
 gi|211960817|gb|EEA96013.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudovibrio sp.
           JE062]
          Length = 466

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 188/441 (42%), Positives = 266/441 (60%), Gaps = 6/441 (1%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL 70
           +A+FGLG SGL  A AL+  G  V  WDD+  +V  A++ G+  ID R++  +  + LV+
Sbjct: 12  VALFGLGGSGLVTARALEAGGARVDVWDDNEASVAAAEEQGLAAIDLRDVDMTRYAALVV 71

Query: 71  SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVAL 130
           +PG+ LT    HW V  A +  + +IGD+ELFV ER     ++PF+A+TGTNGKS+T AL
Sbjct: 72  APGVPLTHPTPHWSVVRAQEAGIPVIGDVELFVNEREAVCPEAPFVAITGTNGKSTTTAL 131

Query: 131 ISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNIS 190
           ISHVL++ G DVQ+GGNIG P+L+LE FS +R YV+E SSYQI+L P++ P IGV++N+S
Sbjct: 132 ISHVLKECGMDVQMGGNIGRPVLDLEGFSEDRVYVVEVSSYQIDLAPSLAPDIGVMMNLS 191

Query: 191 PDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQS 250
           PDHLDRH  +ENY +IK+++V  ++ A++ ++D     IA      G  I  IS      
Sbjct: 192 PDHLDRHGNMENYASIKERLVKAARLAVVGVDDEFSAAIAQRRAESGEPIELISCHEPVE 251

Query: 251 DSDLYIDESFLKCSATSEVIF-DFSQETK---KHNIQNLVTSAVVCMQLGLKVEEIKRAL 306
                 D   ++     +V+  D S        HN QN   +  VC  LGL+++EI  AL
Sbjct: 252 FGVYAADGKVIEVFDEEQVVVADLSSSNTLRGSHNGQNASAAVAVCAALGLELDEIAGAL 311

Query: 307 LSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTL 366
            +  GL HRL+ +A  G V+F+NDSKATN  +  HA      RIYWIAGG  K+   S+L
Sbjct: 312 ATFPGLAHRLKLVAEAGKVLFVNDSKATNAEAAAHALAAFD-RIYWIAGGRPKAGGISSL 370

Query: 367 FPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ-LPSIVLFS 425
             +  KI KAY IG +A  F     G + +    +LD A+++  RD    +   ++VL S
Sbjct: 371 KAYFPKIVKAYLIGEAAEEFEQELSGSVEAHKFGSLDMAVEAAARDAARDKSKEAVVLLS 430

Query: 426 PGCASFDQYNNFRERGFSFMS 446
           P CASFDQ+ +F  RG +F S
Sbjct: 431 PACASFDQFKSFEVRGDAFES 451


>gi|300021776|ref|YP_003754387.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523597|gb|ADJ22066.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 471

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 185/472 (39%), Positives = 268/472 (56%), Gaps = 22/472 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           ++ +SF   ++AVFGLG SG+++A +L   G  V AWDD       A   G+ ++D  E 
Sbjct: 2   IRATSFNGKTVAVFGLGGSGIASARSLLAGGATVAAWDDGEAGRSAAAREGVPLVDLAEA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  S LVL+PG+ LT    HW V+ A    VEIIGDIE+F RER   +  +PFI +TG
Sbjct: 62  DWSQFSALVLAPGVPLTHPEPHWTVRKAQDSGVEIIGDIEIFARERAAQAPDAPFIGITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR  G DVQLGGNIG  +L LE  +P R +VIE SS+QI+LTPT+ 
Sbjct: 122 TNGKSTTTALIAHILRHAGRDVQLGGNIGRAVLTLEDPAPERCHVIELSSFQIDLTPTLK 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P++GV+LN++PDHLDRH T+ENY  +K+++V  ++ A + ++D       + +  +   I
Sbjct: 182 PTVGVMLNVTPDHLDRHGTIENYAAVKERLVDGAEVAAVGLDDE------FGLAMLQRRI 235

Query: 241 SRISSQSLQSDSDLYIDESFLK----CSATSEVIFDFSQET------KKHNIQNLVTSAV 290
            +  + +  ++  +    S L     CS    +    +          KHN QN + +  
Sbjct: 236 QKAPAIAFSAEKSIAPGYSLLDDTIICSNREALAVKLASLGGIATLRGKHNAQNALAAVA 295

Query: 291 V---CMQ-LGLKVE-EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN 345
               C+  +G   + + + AL S  GL HR++ I R+G+V+F+NDSKATN  S   A L+
Sbjct: 296 AVRECLNWIGQSSDLDWQGALASFPGLPHRMEEIGRIGNVLFVNDSKATNADSTEKALLS 355

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD-Q 404
             R ++WIAGG  K+   S L  +   +AK Y IG S+  F     GK+    S TLD  
Sbjct: 356 FPRDVFWIAGGKPKAGGISALEKYFGGVAKVYLIGESSEDFAQTLEGKVTFERSGTLDAA 415

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
              +      +     +VL SP CAS+DQ+ NF  RG +F   V  +PG+ M
Sbjct: 416 VAAAARDAKASTGAEPVVLLSPACASYDQFRNFEVRGDAFRKLVEAVPGVAM 467


>gi|240850894|ref|YP_002972294.1| UDP-N-acetylmuramoylalanine--D-glutamateligase [Bartonella grahamii
           as4aup]
 gi|240268017|gb|ACS51605.1| UDP-N-acetylmuramoylalanine--D-glutamateligase [Bartonella grahamii
           as4aup]
          Length = 464

 Score =  335 bits (860), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 181/464 (39%), Positives = 262/464 (56%), Gaps = 15/464 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ ++   +A+FGLG+SGL+ A AL   G  V+AWDD P +V+ A    I   D R  
Sbjct: 2   ISVACYKGQKVALFGLGKSGLATAQALMRGGAEVVAWDDSPSSVQMAFRHNIPTRDLRYE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            WS    L+++PG+ L     HW V+ A + N+EIIGDIELFVR R+       F     
Sbjct: 62  DWSEFVALIVAPGVPLNYPQPHWVVEKARKKNIEIIGDIELFVRARQHFLQHYGFCDQDV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T  L++H+L K GYDVQ+GGNIG  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTVLLAHLLEKMGYDVQVGGNIGKAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           +LTP++ P+IG+LLN++PDH+DRH +   YV  K+ ++  +  A I ++D  C  +   +
Sbjct: 182 DLTPSLQPTIGLLLNLTPDHIDRHGSFACYVQTKRHLIAQASQAFISVDDAACRFLYQQL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTS 288
              G  I  IS      ++  Y D +  F        ++ D +  T    +HN QN + +
Sbjct: 242 LHEGKKIGAISKDHF-VENGFYADGTKLFAVYQGQRHMLADLTSMTALRGRHNAQNALMA 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +    + + L S  GL HR+Q + ++G V+FINDSKATN  +   A L+   
Sbjct: 301 LATLQALKITDPSMNKHLASYKGLDHRMQQVRKMGAVLFINDSKATNADATAPA-LSTFN 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WI GG +K     +L  F  KI KAY IG++A  F    G     ++S TL  A++ 
Sbjct: 360 DIFWIVGGQAKKGGIESLRKFFPKIRKAYLIGSAAEEFARTIGSAFPFSMSLTLKNAVRE 419

Query: 409 VVRDVENVQLPSI-VLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              D    +   + VL SP CAS+DQ+ N+  RG  F+S V ++
Sbjct: 420 AAVDAMGCKEKEVTVLLSPACASYDQFKNYEMRGEEFVSFVMQL 463


>gi|86749115|ref|YP_485611.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodopseudomonas palustris HaA2]
 gi|118595683|sp|Q2IYL0|MURD_RHOP2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|86572143|gb|ABD06700.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodopseudomonas
           palustris HaA2]
          Length = 466

 Score =  335 bits (858), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 186/463 (40%), Positives = 272/463 (58%), Gaps = 9/463 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   S+AVFGLG SGL++  AL+  G  VIA DD+   + +A        D R +
Sbjct: 2   IPVTSFAGQSVAVFGLGGSGLASCHALRAGGAEVIACDDNLDRMVEAAQANFITADLRNL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           PW   + LVL+PG+ LT    HW V  A +  VE+IGD+ELF RERR  +  +PF+A+TG
Sbjct: 62  PWMNFAALVLTPGVPLTHPTPHWSVLKAREAGVEVIGDVELFCRERRLHAPNAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H++R+ GYD Q+GGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLMRQAGYDTQMGGNIGTAILSLEPPRAGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           PS+G+LLN++ DH+DRH T+E+Y  +K+++V   +    AII ++D      A  +   G
Sbjct: 182 PSVGILLNVTEDHIDRHGTIEHYAAVKERLVAGVQDGGTAIIGVDDGFGRDAADRLERAG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFLKC--SATSEV--IFDFSQETKKHNIQNLVTSAVVCM 293
             + RIS +   +       E+ ++    A+ EV  +         HN QN   +A   +
Sbjct: 242 KRVVRISVKQPLASGITADRETIVQADGGASHEVAKLDGIGSLRGLHNAQNAAAAAAAAL 301

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG+  + ++  L S  GL HR++ + R G  +F+NDSK TN  +   A L+    I+WI
Sbjct: 302 ALGVGPDVLQNGLRSFPGLAHRMEQVGRQGTTLFVNDSKGTNADATAKA-LSSFGEIFWI 360

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG  K+    +L  +  +I KAY IG +A  F     G++   +S TLD A+ +  RD 
Sbjct: 361 AGGKPKTGGIDSLAEYFPRIRKAYLIGEAAQEFAATLEGRVPYEISVTLDNAVPAAARDA 420

Query: 414 ENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
            +  LP  +VL SP CASFDQ+ NF  RG  F   V+ + G++
Sbjct: 421 ASSGLPEPVVLLSPACASFDQFRNFEIRGTKFRDLVTALDGVK 463


>gi|240141485|ref|YP_002965965.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           extorquens AM1]
 gi|240011462|gb|ACS42688.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylobacterium
           extorquens AM1]
          Length = 455

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 181/454 (39%), Positives = 257/454 (56%), Gaps = 10/454 (2%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SGL    +L   G  V+AWDD+  +  +A++ GI V D  E  WS
Sbjct: 5   TTFAGQKLALFGLGGSGLVTVRSLLAGGADVLAWDDNAGSRDRAREQGITVTDLNEADWS 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S LVL+PG+ LT    HW V LA Q  + +IGDIE+F RER   +  +PF+A+TGTNG
Sbjct: 65  GFSALVLAPGVPLTHPEPHWTVGLARQAGIPVIGDIEIFCRERAALAPNAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+LR  G DVQ+GGNIG  IL+LE  +    +V+E SS+QI+LTP++ P +
Sbjct: 125 KSTTTALTAHLLRHAGRDVQMGGNIGTAILSLEPPAATCVHVVELSSFQIDLTPSLKPGV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+ENY  IK+++V  +  A+I ++D  C  IA      G  I R+
Sbjct: 185 GILLNLTPDHLDRHGTMENYAAIKERLVAGADLAVIGVDDPYCAAIAERRT--GERI-RL 241

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFS---QETKKHNIQNLVTSAVVCMQLGLKVE 300
             +     +  Y+  +         VI + +        HN+QN   +    ++LGL   
Sbjct: 242 HVEGHGDAAGDYVGANGTVRGPDGAVIAEVTGIQALLGDHNLQNAAAAVAAAIRLGLTSA 301

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
           EI   L S  GL HR++ + R+G  +F+NDSKATN  S   A L   R I+WI GG +K 
Sbjct: 302 EIAAGLKSFPGLAHRMEPLRRIGPTLFVNDSKATNADSTEKALL-AFRDIHWIVGGKAKE 360

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL--DQALKSVVRDVENVQL 418
                L P   ++A AY IG S+  F     G++  T   TL       +        + 
Sbjct: 361 GGIEPLAPLFDRVAHAYLIGASSEAFAATLEGRVAFTRCGTLEAATEAAARAARASGTEA 420

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           P +VL SP CAS+DQ+ NF  RG  F + V+ +P
Sbjct: 421 P-VVLLSPACASYDQFPNFEVRGDRFRTLVAALP 453


>gi|319404512|emb|CBI78117.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 468

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 180/469 (38%), Positives = 272/469 (57%), Gaps = 15/469 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  ++   +AVFGLG+SG++ A  L   G  VIAWDD+  +V+ A    I   +    
Sbjct: 2   ISVECYKGQKVAVFGLGKSGIATAKVLIACGTEVIAWDDNCSSVEAACKENIPTKNLYYE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            W+    L+L+PG+ LT    HW V+ A Q N+EIIGDIELFVR R        F     
Sbjct: 62  DWTEFVALILAPGVPLTYPRPHWVVEKARQENIEIIGDIELFVRARNLFLQQNGFDDQDV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T AL++H+L K GYDVQ+GGNIG  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTALLAHLLEKMGYDVQMGGNIGTAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           EL P++ P++G+LLN++PDH+DRH + E YV +K+++V+ +  A+I I+   C  +   +
Sbjct: 182 ELAPSLQPTVGLLLNLTPDHIDRHGSFERYVQVKERVVSRASRALISIDSLVCCALYQKL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTS 288
              G+ I  +S + +  +   Y++ +  F        ++ D +        HN +N + +
Sbjct: 242 FDEGYPIDPVSKEHVVKNG-FYVEGTKLFAIYYGQHHMLADLANIASLRGSHNAENALMA 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +   +I+  L S  GL HR+Q + ++G ++FINDSKATN  + + A L    
Sbjct: 301 LATLQILKITTLDIEEHLASYLGLAHRMQQVCKIGSILFINDSKATNAEASVPA-LTTFN 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WI GG +K      L  F  KI KAY IG++A  F    G     ++S TL+ A++ 
Sbjct: 360 NIFWIVGGQAKEGGIDALKGFFYKIRKAYLIGSTAENFARIIGSAFPFSMSLTLENAVRE 419

Query: 409 VVRD-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
              D   +++  ++VLFSP CAS+DQ+ N+  RG +F+S V ++   E+
Sbjct: 420 AASDAARDMEKEAVVLFSPACASYDQFKNYEVRGETFVSLVMQLKKQEL 468


>gi|92116833|ref|YP_576562.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Nitrobacter
           hamburgensis X14]
 gi|118595668|sp|Q1QNU5|MURD_NITHX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|91799727|gb|ABE62102.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Nitrobacter
           hamburgensis X14]
          Length = 466

 Score =  333 bits (854), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 184/462 (39%), Positives = 272/462 (58%), Gaps = 9/462 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  ALK  G  VIA DD+   + +    G    D R +
Sbjct: 2   IPVTSFAGKTVAVFGLGGSGLASCHALKAGGAEVIAGDDNADNLAKVAQAGFITADLRNV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W   + LVL+PG+ LT    HW V  A Q  VE+IGDIELF RER   +  +PF+A+TG
Sbjct: 62  SWVNFAALVLAPGVPLTHPKPHWSVLAARQAGVEVIGDIELFCRERARHAPDAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL++H++R+ G+DVQ+GGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALVAHLMREAGHDVQMGGNIGTAILSLEPPRKGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKK-IVTMSKH--AIICINDHQCEKIAYDMNFIG 237
           P++G+LLN+SPDHLDRH T+E+Y  +K++ I  +  H  A++ ++D      A  +   G
Sbjct: 182 PTVGILLNVSPDHLDRHGTIEHYAAVKERLIAAVQPHGTAVVGVDDIWSRTAADRIEQAG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEV----IFDFSQETKKHNIQNLVTSAVVCM 293
             + R+S +   +D      +  ++ S  ++     I        +HN QN   ++   +
Sbjct: 242 KRVVRVSVKRPLADGISVDHDRIVRASGGAQAEIADIGGIGSLRGRHNAQNAACASAAAL 301

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG+  + +++ L S  GL HR++ + R  +V+F+NDSK TN  +   A L+    I+WI
Sbjct: 302 ALGVGRDILQQDLRSFPGLAHRMEQVGRKANVLFVNDSKGTNADATEKA-LSSFAEIFWI 360

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG  KS   + L     +I KAY IG +A  F     G++   +S TL+ A+ +  RD 
Sbjct: 361 AGGKPKSGGIAPLAELFPRIRKAYLIGEAAEEFAGTLEGRVVYEISGTLEAAVPAAARDA 420

Query: 414 ENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           E   L  ++VL SP CASFDQ+ NF  RG  F   V  +PG+
Sbjct: 421 EGSGLADAVVLLSPACASFDQFRNFEARGDRFRELVRALPGV 462


>gi|319408826|emb|CBI82483.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           schoenbuchensis R1]
          Length = 468

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 184/469 (39%), Positives = 274/469 (58%), Gaps = 15/469 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  ++   +A+FGLG+SGL+ A AL   G  VI WD++P +V+ A    I   D R  
Sbjct: 2   ISVECYKGQKVALFGLGQSGLATAQALITGGAEVIGWDENPSSVEAACRENIPTRDLRYE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            WS    L+L+PG+ LT   +HW V  A Q  +EIIGDIELFVR R        F     
Sbjct: 62  DWSEFVALILAPGVPLTHPQSHWTVDKARQAGIEIIGDIELFVRARNHFLRQHGFCDQDV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T  L++H+L K GYDVQ+GGNIG  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTTLLAHLLDKMGYDVQMGGNIGTAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           +L+P++ P++G+LLN++PDH+DRH +  +Y  +K ++V+ + HA++ ++D  C+ +   +
Sbjct: 182 DLSPSLQPTVGLLLNLTPDHIDRHGSFTHYAQVKGRLVSKASHALVSVDDAACQVLYQQL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSE--VIFDFSQETK---KHNIQNLVTS 288
              GH +  IS +    D   Y + + L   +  +  ++ D +  T     HN+QN +  
Sbjct: 242 VNKGHQVKAISKEHCIDDG-FYAEGTKLFSISHGQRCLLADLATITSLRGAHNVQNALMV 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +    I++ L S  GL HR+Q + ++G V+FINDSKATN  +   A L    
Sbjct: 301 LATLQVLKITDPHIEKHLASYMGLAHRMQQVRKMGSVLFINDSKATNAEASACA-LATFN 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WIAGG +K    + L  F  KI KAY IG +A  F    G     ++S TL+ A++ 
Sbjct: 360 DIFWIAGGQAKESGIAPLKGFFDKIHKAYLIGAAAEDFARTIGSAFPFSMSLTLENAVQE 419

Query: 409 VVRDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
              D  +  +  ++VLFSP CAS+DQ+ N+  RG +F+S V ++   E+
Sbjct: 420 AAIDATHANVKEAVVLFSPACASYDQFKNYEMRGETFISLVRQLKENEL 468


>gi|90423695|ref|YP_532065.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodopseudomonas palustris BisB18]
 gi|118595684|sp|Q216E0|MURD_RHOPB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|90105709|gb|ABD87746.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodopseudomonas
           palustris BisB18]
          Length = 466

 Score =  329 bits (844), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 186/466 (39%), Positives = 273/466 (58%), Gaps = 9/466 (1%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   ++AVFGLG SGL++  ALK  G  V+A DD+   + +A   G    D   +
Sbjct: 2   IPITSFAGKTVAVFGLGGSGLASCQALKAGGADVVASDDNIDRLVEAAQAGFITADLHSV 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS I+ LVL+PG+ LT    HW V  A    VE+IGDIELF RERR  +  +PF+A+TG
Sbjct: 62  AWSNIAALVLTPGVPLTHPAPHWAVLAAQAAGVEVIGDIELFCRERRLLAPDAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR+ G+D Q+GGNIG  IL+LE  +  R +V+E SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLLRQAGFDTQMGGNIGTAILSLEPPAAGRVHVVEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM---SKHAIICINDHQCEKIAYDMNFIG 237
           PS+G+LLN++ DHLDRH ++E+Y  +K+++V        AI+ ++D      A  +   G
Sbjct: 182 PSVGILLNVTEDHLDRHGSIEHYAAVKQRLVAGVPDGGTAIVGVDDDFSATAAERVALDG 241

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCS-ATSEVIF---DFSQETKKHNIQNLVTSAVVCM 293
            ++ R+S +   ++  +  + +  + +    E I            HN QN   +A   +
Sbjct: 242 KTVLRLSVKRPLANGIVVENNAIYRVTDGEREAIARIDGIGSLRGLHNAQNAAAAAAAVL 301

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG+  E ++R L S  GL HR++ + R G  +F+NDSKATN        L+    I+WI
Sbjct: 302 ALGVDREALQRGLRSFPGLAHRMEQVGRQGETLFVNDSKATNA-DAAAKALSSFEEIFWI 360

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG  K+    +L  F  KI KAY IG +A  F     GK++  + +TL+ A+    RD 
Sbjct: 361 AGGKPKTGGIDSLAGFFPKIRKAYLIGEAAQEFAATLDGKVDYEICETLEVAVPHAARDA 420

Query: 414 ENVQL-PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
              +L   +VL SP CASFDQ+ NF  RG  F   V+ +P +E +V
Sbjct: 421 AASELVDPVVLLSPACASFDQFRNFEIRGNRFRELVTALPHVEPVV 466


>gi|319899159|ref|YP_004159252.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           clarridgeiae 73]
 gi|319403123|emb|CBI76681.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           clarridgeiae 73]
          Length = 471

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 181/467 (38%), Positives = 269/467 (57%), Gaps = 18/467 (3%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           ++   +AVFGLG+SG++ A  L   G  V+AWDD+  +V+ A    I   +     WS  
Sbjct: 7   YKGQKVAVFGLGQSGIATAKVLISCGAEVVAWDDNFSSVEAACKENIPTKNLYYEDWSEF 66

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQSPFIAV 118
             L+L+PG+ LT    HW V+ A Q N+EIIGDIELFVR R        FS    PF+A+
Sbjct: 67  IALILAPGVPLTYPRPHWVVEKARQENIEIIGDIELFVRARNLFLQQNDFSDQDVPFVAI 126

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T AL+SH+L K GYDVQ GGNIG  IL L+ F   R YVIECSS+QIEL P+
Sbjct: 127 TGTNGKSTTTALLSHLLEKMGYDVQTGGNIGTAILTLKPFVKKRIYVIECSSFQIELAPS 186

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           + P+IG+LLN++PDH+DRH + E Y  IK ++V+ + +A+I ++   C  +   +   G+
Sbjct: 187 LQPTIGLLLNLTPDHIDRHGSFELYGQIKGRVVSKASNALISVDSLVCRALYQKLFDEGY 246

Query: 239 SISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCM 293
            I  +S +    +   Y++ +  F        ++ D +  T     HN +N + +     
Sbjct: 247 QIKPVSKERFIKNG-FYVEGTKLFSVRYGHRHLLADLANMTSLRGSHNAENALMALATLQ 305

Query: 294 QLGL---KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            L +   ++ +I+  L S  GL HR+Q + ++G ++FINDSKATN  +   A L     I
Sbjct: 306 MLKITTSEISDIEEHLASYLGLAHRMQEVCKIGSILFINDSKATNAEASAPA-LATFNNI 364

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
           +WI GG +K     +L  F  KI KAY IG +A  F    G     ++S TL+ A++   
Sbjct: 365 FWIVGGQAKEGGIDSLKGFFYKIRKAYLIGTAAENFARIIGSAFPFSMSLTLENAVREAA 424

Query: 411 RD-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
            D   +    +++LFSP CAS+DQ+ N++ RG +F+S V ++   E+
Sbjct: 425 SDAARDTTQDAVILFSPACASYDQFKNYKVRGEAFVSLVMQLKKEEL 471


>gi|158421725|ref|YP_001523017.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Azorhizobium
           caulinodans ORS 571]
 gi|158328614|dbj|BAF86099.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase precursor
           [Azorhizobium caulinodans ORS 571]
          Length = 536

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 193/461 (41%), Positives = 262/461 (56%), Gaps = 12/461 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +S+F++  +AVFGLG SGL+ A AL   G  VI WDD     K+A+  GI V D  E 
Sbjct: 73  IPVSTFKDRRVAVFGLGGSGLATAQALLAGGAEVIGWDDGEAGRKKAEAAGITVSDLHEA 132

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  + LVL+PG+ LT    HW V LA    VEIIGDIELF RERR     +PF A+TG
Sbjct: 133 DWSGFAALVLAPGVPLTHPTPHWTVGLAQAAGVEIIGDIELFCRERRALKPTAPFAAITG 192

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL+SH+++  G DVQ+GGNIG  IL+LE F   R +V+ECSSYQI+L P +D
Sbjct: 193 TNGKSTTTALLSHLMKVGGRDVQMGGNIGTAILSLEPFKAGRVHVVECSSYQIDLAPGLD 252

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIG 237
           PS+G+ LN++PDH+DRH T E+Y  +K+++   V     A++ ++D     IA      G
Sbjct: 253 PSVGIHLNLTPDHIDRHGTFEHYGAVKERLIAGVQPGGTAVVGVDDAPSAAIADRAEAAG 312

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDF-----SQETKKHNIQNLVTSAVVC 292
             + RIS +   +D  +++D   L  S     +F             HN QN   +    
Sbjct: 313 IHVVRISVKQPLADG-IWLDGETLVVSEKGAEVFRLPLTGIGSLRGAHNAQNAAAAMAAA 371

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
             LGL  E I   +    GL HR++ +   G V+F+NDSKATN  +   A L     ++W
Sbjct: 372 RGLGLAYEVIAVGMQRFPGLAHRMEQVGTRGKVLFVNDSKATNADAAERA-LASFSDVFW 430

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           IAGG  K+   + L PF  ++ KAY IG +A  F     G +   +  TLD+A+ +  RD
Sbjct: 431 IAGGKPKAGGITPLKPFFPRVRKAYLIGEAAADFAATL-GDVPHEVVGTLDRAVAAAARD 489

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
                L   +VL SP CASFDQY NF  RG +F   V E+P
Sbjct: 490 AAASSLDHPVVLLSPACASFDQYPNFEVRGDAFRHLVEELP 530


>gi|296448265|ref|ZP_06890159.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylosinus
           trichosporium OB3b]
 gi|296254217|gb|EFH01350.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylosinus
           trichosporium OB3b]
          Length = 473

 Score =  326 bits (836), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 184/462 (39%), Positives = 259/462 (56%), Gaps = 15/462 (3%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW 62
           +++F + S+A+FGLG SGLS A AL   G  V AWDD      +A+  G+ ++D     W
Sbjct: 4   VTTFAHRSVALFGLGGSGLSTARALIAGGASVAAWDDSEAGRAKAEAQGVTLVDLTSADW 63

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
           S    L+LSPG+ LT    HW V+ A++  +EIIGDIELF RER   +  + FIA+TGTN
Sbjct: 64  SAFDALILSPGVPLTHPKPHWTVERAHEAQIEIIGDIELFCRERERHAPGATFIAITGTN 123

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T ALI+H+LR+ G DVQLGGNIG PIL+LE  S  R +VIECSS+QI+LTP++ P+
Sbjct: 124 GKSTTTALIAHILRRAGKDVQLGGNIGTPILDLEPPSEERIHVIECSSFQIDLTPSLAPT 183

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           IG+L+N++PDH+DRH T+++Y  +K+++V  +  A+I ++D  C  I   +        R
Sbjct: 184 IGILINLTPDHIDRHGTMDDYAAVKERLVDGADIALIGVDDVYCHAIGARLTQAHCEGQR 243

Query: 243 I--SSQSLQSDSDLYIDESFL------KCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
           +   S +   D   YI+   +           +E + D           N   +A     
Sbjct: 244 VIPVSATRALDWGFYIESGKVIYRQSGHGPEEAETLGDLGDARALRGAHNAQNAAFAAAA 303

Query: 295 L---GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
           +   GL  EEI   L    GL HR++ + R G V+FINDSKATN  +   A L+    I+
Sbjct: 304 VWHCGLNCEEIADGLADYPGLPHRMEEVGRRGRVLFINDSKATNADAAEKALLSFD-DIF 362

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD--QALKSV 409
           WIAGG +K      L P    I KAY IG +A  F     G +      TLD   A  + 
Sbjct: 363 WIAGGKAKEGGIKPLRPLFPLIRKAYLIGAAAQDFARTLEGAVAFEQCGTLDRALARAAE 422

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              + + + P +VL SP CAS+DQ+ NF  RG +F     E+
Sbjct: 423 EAALSDAREP-VVLLSPACASYDQFANFEARGDAFRRLAQEL 463


>gi|323137895|ref|ZP_08072970.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylocystis sp.
           ATCC 49242]
 gi|322396898|gb|EFX99424.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Methylocystis sp.
           ATCC 49242]
          Length = 475

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 263/465 (56%), Gaps = 15/465 (3%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW 62
           +++F++  +A+FGLG SGLS A AL   G HV AWDD      +A   G+ + D  +  W
Sbjct: 4   VTTFKDKRVALFGLGGSGLSTARALMAGGAHVHAWDDGEAGRLKAVAQGVPLEDLSQADW 63

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
           S  +  +L+PG+ LT    HW V LA    VEIIGD+ELF RER   +  SPF+A+TGTN
Sbjct: 64  SQFAAFILTPGVPLTHPTPHWTVPLAKAAGVEIIGDVELFCRERAAHTGGSPFVAITGTN 123

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T ALI+H+L + G DVQLGGNIG+PIL+LE  S  R +VIECSS+QI+L P+++P+
Sbjct: 124 GKSTTTALIAHILGEAGRDVQLGGNIGVPILDLEPPSDERIHVIECSSFQIDLAPSLNPT 183

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           IG+L+N++PDH+DRH ++ENY  +K+++V  ++ A++ ++D     I   +        R
Sbjct: 184 IGLLINLTPDHIDRHGSMENYAAVKERLVAGAEVALVGVDDIYTHAIGGRLLAAARPDQR 243

Query: 243 I--SSQSLQSDSDLYIDESFL------KCSATSEVIFDFSQETKKHN---IQNLVTSAVV 291
           +   S +   D   Y+++  +           +E+I               QN   +A  
Sbjct: 244 VVPVSGARTLDWGFYVEDGSVYFREKGHPPEEAELIGTLKGARALRGAHNAQNAAFAAAA 303

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
             + GL+ +EI + LLS  GL HR++ + R+   +F+NDSKATN  +   A L     IY
Sbjct: 304 TWECGLEDDEIAQGLLSYPGLPHRMEEVGRIERTLFVNDSKATNADAAEKA-LASFDDIY 362

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           WI GG SK      L  +  +I KAY IG ++  F     G +     +TLD A      
Sbjct: 363 WIIGGKSKEGGIEPLRDYFPRIRKAYLIGAASDEFARTLEGALPFERCETLDVATTRAAL 422

Query: 412 D--VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           D      Q P +VL SP CAS+DQ+ NF  RG +F   V  +P I
Sbjct: 423 DALAGEAQEP-VVLLSPACASYDQFPNFEVRGDAFRGIVHGLPAI 466


>gi|312114846|ref|YP_004012442.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219975|gb|ADP71343.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 470

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 187/457 (40%), Positives = 254/457 (55%), Gaps = 12/457 (2%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
           SF+   +AVFG+G SGL+AA +L   G   + WDD       A   G+ V D REI W  
Sbjct: 6   SFKGRKVAVFGMGMSGLAAARSLIAGGAETMVWDDGEKGRDAAVAAGLPVRDLREIDWRA 65

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
           +  LVL+PG+ LT    HW VKLA    VEIIGD E+F RERR      P IA+TGTNGK
Sbjct: 66  LDSLVLAPGVPLTHPEPHWTVKLAEANGVEIIGDTEIFFRERRRVGANCPVIAITGTNGK 125

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+T AL +H+L   G     GGNIG  +L+L  F   + YV+E SS+Q++LTP++DP  G
Sbjct: 126 STTTALSNHLLNAAGRASVCGGNIGRAVLDLPPFVDGQHYVLELSSFQLDLTPSLDPDAG 185

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
           +LLNI+PDH+DRH +LE Y  +K+K+   +T    A+I  +D  C+ IA      G    
Sbjct: 186 ILLNITPDHIDRHGSLEGYAAVKEKLFANMTGGGTAVIGADDALCDAIAARAEARGVRTL 245

Query: 242 RISSQSLQSDSDLYIDESFLKCSATSEV-----IFDFSQETKKHNIQNLVTSAVVCMQLG 296
           RISS    + + +Y + S L   A   +     +         HN QN   +      LG
Sbjct: 246 RISSTKPVA-TGIYGEGSGLFELADGALQNRASLSGIGSLRGAHNAQNAAAALAATRSLG 304

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           L    +   L S  GL HR+Q I R+GHV+F+NDSKATN  +   A L+    IYWIAGG
Sbjct: 305 LPWATLVEGLQSFPGLAHRMQEIRRIGHVLFVNDSKATNADAAERALLSFT-NIYWIAGG 363

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ--ALKSVVRDVE 414
             K+     L PF  +I KAY IG +A  F    GG++  ++++TLD+  A  +     +
Sbjct: 364 KPKAGGIEPLAPFFPRIKKAYLIGVAAEEFAQTIGGRVPVSMARTLDRAVAEAAADAAAQ 423

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                ++VL SP CAS+DQY NF  RG +F + V  +
Sbjct: 424 GSGEDAVVLLSPACASYDQYPNFEIRGDAFRAAVEAL 460


>gi|121601920|ref|YP_989230.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bartonella
           bacilliformis KC583]
 gi|120614097|gb|ABM44698.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella
           bacilliformis KC583]
          Length = 468

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 180/464 (38%), Positives = 264/464 (56%), Gaps = 15/464 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  ++   +A+FGLG+SGL+ A AL   G  VIAWDD+P  V+ A    I   D    
Sbjct: 2   ISVECYKGKKVALFGLGKSGLATAQALISGGAEVIAWDDNPAGVEAACKENIATRDLHHE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            WS    L+L+PG+ L     HW V  A Q NVE+IGDIELFVR R        F     
Sbjct: 62  DWSEFVALILAPGVPLFYPKPHWVVDKARQENVEVIGDIELFVRARNHFLQQYDFCDWDV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T  L+ H+L + GYDVQ+GGN+G  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTTLLVHLLEQMGYDVQMGGNVGTAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           +L P++ P+IG+LLN++PDH+DRH T  +Y  +K  +V+ + HA+I ++D  C+ +   +
Sbjct: 182 DLAPSLQPTIGILLNLTPDHIDRHGTFAHYAQVKGLLVSRASHALISVDDAACKTLYQQL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTS 288
               H +  IS +    ++  Y++ +  F        ++ D +  T     HN QN +  
Sbjct: 242 VDEKHQVEAISKKHF-VENGFYVEGTQLFSVRHGQRHMLVDLAAVTSLRGSHNAQNALMV 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +    +++ L+S  GL HR+Q + ++G V+FINDSKATN  +   A L    
Sbjct: 301 LATLQALKITDPHLEKHLVSYAGLAHRMQQVRKIGSVLFINDSKATNADASAVA-LATFD 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WI GG +K      L  F  KI KAY IG +A  F    G     ++S TL+ A++ 
Sbjct: 360 DIFWILGGKAKEGGIGALRKFFPKIRKAYLIGEAAEDFVRVIGSSFPISMSLTLENAVRE 419

Query: 409 VVRDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              D  + ++  ++VL SP CAS+DQ+ N+  RG +F+S V ++
Sbjct: 420 AAIDASHEKVKEAVVLLSPACASYDQFKNYEMRGEAFISFVMQL 463


>gi|319406008|emb|CBI79639.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Bartonella sp. AR
           15-3]
          Length = 468

 Score =  321 bits (823), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 182/464 (39%), Positives = 265/464 (57%), Gaps = 15/464 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  ++   +AVFGLG+SG++ A  L   G  V+AWDD+  +V+ A    I   +    
Sbjct: 2   ISVECYKGQKVAVFGLGKSGIATAKVLISCGTEVVAWDDNYSSVEAACKENIPTKNLYNE 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQS 113
            WS    LVL+PG+ L     HW V+ A Q N+EIIGDIELFVR R        F     
Sbjct: 62  DWSEFVALVLAPGVPLIYPRPHWVVEKARQENIEIIGDIELFVRARNLFLQQHGFDDQDI 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           PFIA+TGTNGKS+T  L++H+L K GYDVQ+GGNIG  IL L+ F   R YVIECSS+QI
Sbjct: 122 PFIAITGTNGKSTTTTLLAHLLEKMGYDVQMGGNIGTAILTLKPFVKKRIYVIECSSFQI 181

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           EL P++ P++G+LLN++PDH+DRH + E YV +K+ +++ +  A+I I+   C  +   +
Sbjct: 182 ELAPSLQPTVGLLLNLTPDHIDRHGSFERYVQVKEYVISRASRALISIDSLVCRALYQKL 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTS 288
              GH I  +S +    +   Y++ +  F        ++ D +  T     HN +N + +
Sbjct: 242 FDEGHQIDPVSKEHFVKNG-FYVEGTKLFSIRHGQYHLLADLANITSLRGSHNAENALMA 300

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 L +    I+  L S  GL HR+Q + R+G V+FINDSKATN  + + A L    
Sbjct: 301 LATLQILKITTLNIEEHLASYLGLAHRMQQVCRIGSVLFINDSKATNAEASVPA-LATFN 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I+WI GG +K      L  F  KI KAY IGN+   F    G     ++S TL+ A++ 
Sbjct: 360 NIFWIVGGQAKEGGIDALKGFFYKIRKAYLIGNAVENFARIIGSAFPFSMSFTLENAVRE 419

Query: 409 VVRD-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            V D   ++   S++LFSP CAS+DQ+ N+  RG +F+S V ++
Sbjct: 420 AVNDATHDINQESVILFSPACASYDQFKNYEVRGETFVSLVMQL 463


>gi|91977862|ref|YP_570521.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodopseudomonas palustris BisB5]
 gi|91684318|gb|ABE40620.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodopseudomonas
           palustris BisB5]
          Length = 470

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 188/474 (39%), Positives = 274/474 (57%), Gaps = 27/474 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   S+AVFGLG SGL++  AL+  G  VIA DD+   V +A        D R +
Sbjct: 2   IPVTSFAGQSVAVFGLGGSGLASCHALRAGGAEVIACDDNLDRVVEATQANFITADLRSL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           PW+  + L+L+PG+ LT    HW V  A +  VE+IGD+ELF RERR  +  SPF+A+TG
Sbjct: 62  PWANFAALILTPGVPLTHPTPHWSVLKAREAGVEVIGDVELFCRERRRHAPDSPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H++R+ GYD Q+GGNIG  IL+LE     R +VIE SSYQI+LTP++ 
Sbjct: 122 TNGKSTTTALIAHLMREAGYDTQMGGNIGTAILSLEPPRSGRVHVIEMSSYQIDLTPSLA 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           P++G+LLN++ DH+DRH T+E+Y  +K+++V   +    AII ++D      A  +   G
Sbjct: 182 PTVGILLNVTEDHIDRHGTIEHYAAVKERLVAGVQDGGTAIIGVDDGFGRDAADRLERAG 241

Query: 238 HSISRIS-SQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK----------HNIQNLV 286
             + RIS  Q L   S +  D   ++ SA        S+E  +          HN QN  
Sbjct: 242 KQVVRISVKQPLA--SGITADHETIRSSAGGA-----SREIARLGGIGSLRGLHNAQNAA 294

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARL----GHVIFINDSKATNLHSVIHA 342
            ++   + LG+  + +++ L S  GL HR++ + R     G  +F+NDSK TN  +   A
Sbjct: 295 AASAAALALGVSADALQKGLRSFPGLAHRMEQVGRQSSGEGATLFVNDSKGTNADATAKA 354

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L+    I+WIAGG  K+    +L  +  +I KAY IG +A  F     GK+   +S+TL
Sbjct: 355 -LSSFGEIFWIAGGKPKTGGIESLAEYFPRIRKAYLIGEAAEEFAATLEGKVAYEISETL 413

Query: 403 DQALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
           D A+ +  RD     L   +VL SP CASFDQ+ NF  RG  F   V+ + G++
Sbjct: 414 DNAVAAAARDAAASGLAEPVVLLSPACASFDQFRNFEIRGTRFRELVTALDGVK 467


>gi|316933184|ref|YP_004108166.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodopseudomonas
           palustris DX-1]
 gi|315600898|gb|ADU43433.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodopseudomonas
           palustris DX-1]
          Length = 465

 Score =  318 bits (815), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 187/465 (40%), Positives = 276/465 (59%), Gaps = 15/465 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   S+AVFGLG SGL++  ALK  G  VIA DD+   + +A   G    D R +
Sbjct: 2   IPVTSFAGASVAVFGLGGSGLASCHALKAGGAEVIACDDNLDRMVEAAQAGFITADLRNL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           PW+  + LVL+PG+ LT    HW V  A +  VE+IGD+ELF RERR  + ++PF+A+TG
Sbjct: 62  PWTNFAALVLTPGVPLTHPAPHWTVLKAQEAGVEVIGDVELFCRERRAHAPRAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR+ G+D QLGGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLLREAGWDTQLGGNIGTAILSLEPPKDGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           P++G+LLN++ DH+DRH T+E+Y  +K+++V   +    AI+ ++D      A  +   G
Sbjct: 182 PTVGILLNVTEDHIDRHGTIEHYAAVKERLVAGVQDGGTAIVGVDDEFGRAAADRIERAG 241

Query: 238 HSISRISSQ-----SLQSDSDL--YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
           + + R+S Q      + +D D    ++E     SA    +         HN QN   +A 
Sbjct: 242 NRVVRMSVQGPVTSGITADLDAIRRVEEG---ASAEVAKLGGIGSLRGLHNAQNAAAAAA 298

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
             + LG+  E++++ L S  GL HR++ + R G  +F+NDSKATN  +   A  +    I
Sbjct: 299 AVLALGVSPEQLQQGLRSFPGLAHRMEQVGRQGTTLFVNDSKATNADAAAKALASFG-EI 357

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
           +WIAGG  K+    +L  +  +I KAY IG +A  F     G++   +S+TL+ A+ +  
Sbjct: 358 FWIAGGKPKTGGIESLAEYFPRIRKAYLIGQAAQEFAATLKGRVPYEISETLEAAVPAAA 417

Query: 411 RDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           RD     L   +VL SP CASFDQ+ NF  RG  F   V+ + G+
Sbjct: 418 RDAAASGLTEPVVLLSPACASFDQFRNFEIRGTRFRELVTALDGV 462


>gi|16126795|ref|NP_421359.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Caulobacter
           crescentus CB15]
 gi|221235575|ref|YP_002518012.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Caulobacter
           crescentus NA1000]
 gi|30316113|sp|Q9A597|MURD_CAUCR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|254766042|sp|B8H096|MURD_CAUCN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|13424123|gb|AAK24527.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Caulobacter
           crescentus CB15]
 gi|220964748|gb|ACL96104.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Caulobacter
           crescentus NA1000]
          Length = 471

 Score =  316 bits (809), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 173/465 (37%), Positives = 259/465 (55%), Gaps = 19/465 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F + ++AVFGLGR+GL+AA AL   G  V  WD+ P + + A   G  V+D +  
Sbjct: 2   IPVRGFEDKTVAVFGLGRTGLTAARALIAGGAKVALWDEKPASREAAAAEGFAVVDLQAA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL--QSPFIAV 118
            WS  + L+LSPG+ L+    HW V+ A    VE++GD+ELF R    +    +   IA+
Sbjct: 62  DWSQFAALMLSPGVPLSHPKPHWTVEKARAAGVEVLGDVELFARTVNAAPAHKRPKIIAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+    G D ++GGNIGL +L LE       YV+E SSYQ++LT +
Sbjct: 122 TGTNGKSTTTALIGHLCASAGRDTRVGGNIGLGVLGLEDMHGGAVYVLELSSYQLDLTSS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
           + P   VLLNISPDHLDRH  ++ Y+  K++I         AII ++D  C++I  ++  
Sbjct: 182 LKPDAVVLLNISPDHLDRHGGMDGYIAAKRRIFLNQGKGDTAIIGVDDAWCQQICTEITA 241

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK------KHNIQNLVTSA 289
                    S        +Y  +  L   AT E + + +   +      +HN QN   + 
Sbjct: 242 ANRRTIWPISAGKAMGRGVYALQGVL-YDATGERVVEVADILRARSLPGRHNWQNAAAAY 300

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                +G+ +++    L++  GL HR++T+ ++G V F+NDSKATN  +   A ++   +
Sbjct: 301 AAARAIGISMQDAVDGLMTFPGLAHRMETVGKIGKVRFVNDSKATNADAARQA-MSSYPK 359

Query: 350 IYWIAGGLSKS---DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
            YWIAGG++K+   DD   LFP   +IAKAY IG +A  F     GK    LS TL++A+
Sbjct: 360 FYWIAGGVAKAGGIDDLKDLFP---RIAKAYLIGEAAEPFSWTLAGKAECVLSGTLEKAV 416

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +    D       +IVL SP CASFDQ+++F  RG +F + V+ +
Sbjct: 417 QQAYADAAASGEEAIVLLSPACASFDQFSDFEARGEAFRAAVNGL 461


>gi|329848047|ref|ZP_08263075.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Asticcacaulis
           biprosthecum C19]
 gi|328843110|gb|EGF92679.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Asticcacaulis
           biprosthecum C19]
          Length = 475

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 179/462 (38%), Positives = 249/462 (53%), Gaps = 13/462 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F    +A+FGLGRSGLSAA ALK  G   + WDD   +   A   G  V D ++ 
Sbjct: 2   IPVKGFEGKRVAIFGLGRSGLSAARALKAGGAEPVLWDDKVASTAAAMKEGFTVEDLKKA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE-RRFSSLQSP-FIAV 118
            W+    L+LSPG+ LT    HW VK A    V+++GDIELF R   RF +   P  +A+
Sbjct: 62  DWAEFDALMLSPGVPLTHPEPHWTVKAAKAAGVQVLGDIELFARTLARFPARNRPKTVAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+L+  G +V +GGNIG+ +L+L+   P   YVIE SSYQ++L+ T
Sbjct: 122 TGTNGKSTTTALIGHILKSAGKNVHVGGNIGIGVLDLDEMQPGAVYVIETSSYQLDLSLT 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
             P + +L+N+SPDHLDRH  ++ Y+  KK+I       + A+I  +D     +   M  
Sbjct: 182 FKPDVSILMNLSPDHLDRHGGMDGYIAAKKRIFMNQEKGQTAVIGADDDYTADLISQMR- 240

Query: 236 IGHSIS--RISSQSLQSDSDLYIDESFLKCSAT-SEVIFDFSQE---TKKHNIQNLVTSA 289
           + H +    ISS+ +  D    ++      S   +  I D       T +HN QN   + 
Sbjct: 241 VSHPVKLVAISSRRVVGDGVYALNGELYDASGERARHIIDLKTVRTLTGRHNWQNGAAAF 300

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
             C  LGL  E+I   + S  GL HR+Q I R+G V FINDSKATN  +   A ++   +
Sbjct: 301 AACKALGLTNEQIAVGMRSFPGLAHRMQEIGRIGKVRFINDSKATNADAARQA-MSSFDK 359

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
            +WIAGG +K+     L     +I  A+ IG +A LF    G     T S+ L  A    
Sbjct: 360 FFWIAGGKAKAGGIDELRDLYPRIKHAFLIGEAAELFEKTIGKAAPCTQSRLLFTATAQA 419

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             + E      IVLFSP CASFDQ+ +F  RG +F   V+EI
Sbjct: 420 YAEAEKSGKEEIVLFSPACASFDQFTDFEARGDAFRDAVNEI 461


>gi|197105787|ref|YP_002131164.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Phenylobacterium
           zucineum HLK1]
 gi|226722943|sp|B4RFS2|MURD_PHEZH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|196479207|gb|ACG78735.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Phenylobacterium
           zucineum HLK1]
          Length = 469

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/462 (36%), Positives = 256/462 (55%), Gaps = 13/462 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +S F   ++AVFGL R+GL+AA AL   G  V  WDD P A + A+  G E+ D    
Sbjct: 2   IPVSGFEGRTVAVFGLARTGLAAARALVAGGAKVALWDDKPAAREAAQAEGFELTDLTRA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAV 118
            W   + ++LSPG+ LT    HW V+ A +   EI+GDIELF R    +    +   +A+
Sbjct: 62  DWREFAAVMLSPGVPLTHPAPHWTVERAREAGAEIVGDIELFARTVNAAPEHKRPKIVAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+  + G DV++GGNIG  +L LE       YV+E SSYQ++LT +
Sbjct: 122 TGTNGKSTTTALIGHICAEAGRDVRIGGNIGYGVLGLEDMHGGAVYVLELSSYQLDLTSS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDM-- 233
           +   + V+LNISPDHL+RH T++ YV  K++I+        A+I ++D   ++I  ++  
Sbjct: 182 LHADVTVILNISPDHLERHGTMDEYVAAKRRILLNQGKGDTAVIGVDDPWGQRICTEITA 241

Query: 234 ----NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
                 +  S S+  S+ + +   L  D +  +    +++    S    +HN QN   + 
Sbjct: 242 ANRRTIVPVSASKAMSRGVYALDGLLYDATGERAQEVADLKRARSL-PGRHNWQNAAAAY 300

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                LG+  EE  + L++  GL HR++T+A LG V F+NDSKATN  +   A ++   +
Sbjct: 301 AAARGLGISGEEAAQHLMTFPGLAHRMETVAVLGKVRFVNDSKATNADAARQA-MSSYPK 359

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
            YWIAGGL K+     L     +I KAY +G +A  F     GK  +  S T++ A++  
Sbjct: 360 FYWIAGGLPKTGGIDGLIDLFPRIEKAYLVGEAAPAFADVLRGKAPAVESGTIEAAVRQA 419

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             D       +IVL SP CASFDQ+ +F ERG +F + V ++
Sbjct: 420 YADARAAGQEAIVLLSPACASFDQFADFEERGEAFRAAVQKL 461


>gi|315498851|ref|YP_004087655.1| UDP-N-acetylmuramoylalanine/d-glutamate ligase [Asticcacaulis
           excentricus CB 48]
 gi|315416863|gb|ADU13504.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Asticcacaulis
           excentricus CB 48]
          Length = 488

 Score =  309 bits (791), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 181/462 (39%), Positives = 247/462 (53%), Gaps = 13/462 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + + SF    +A+FGLGRSGLSAA ALK  G   + WDD P ++  A   G  + + +  
Sbjct: 22  IPVKSFAGKRVAIFGLGRSGLSAARALKAGGAEPLLWDDKPQSMLSASKEGFTIENLKVA 81

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE-RRFSSLQSP-FIAV 118
            WS I  L+LSPG+ LT    HW VK A + NV +IGDIELF R        Q P  +A+
Sbjct: 82  DWSEIDALMLSPGVPLTHPEPHWTVKAAQEANVPVIGDIELFARTLNALPEKQRPKTVAI 141

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+L+  G D  +GGNIG+ +L+L        YVIE SSYQ++LT T
Sbjct: 142 TGTNGKSTTTALIGHILKAAGRDAHIGGNIGIGVLDLPEMHAGTIYVIETSSYQLDLTQT 201

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
             P + VL+N SPDHLDRH  ++ Y+  KK+I    T  + A+I  +D   + +  +M  
Sbjct: 202 FRPDVAVLMNFSPDHLDRHGDMDGYIKAKKRIFLNQTAHETAVIGTDDEWSQAVVTEMT- 260

Query: 236 IGHSISRISSQSLQS-DSDLYIDESFLKCSATSEV--IFDFSQE---TKKHNIQNLVTSA 289
             HS++ I   S ++    +Y     +  + T     I D       T +HN QN   + 
Sbjct: 261 AHHSVNLIPISSRRTLGRGVYALNGVIYDATTDRARQIIDLKTVRTLTGRHNWQNACAAY 320

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
             C  LGL VE I   + S  GL HR+Q I R+ +V FINDSKATN  +   A ++    
Sbjct: 321 SACRALGLTVEVIVAGIRSFPGLDHRMQEIGRIKNVRFINDSKATNADAARQA-MSSYDS 379

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
            YWIAGG +K+     L     ++  AY IG +A LF    G     T S+ L  A+   
Sbjct: 380 FYWIAGGRAKAGGIEELKDLFPRVKHAYLIGEAAELFEKTIGTAATCTQSRLLFTAVAQA 439

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
               E      +VL SP CAS DQ+ +F  RG +F   V++I
Sbjct: 440 FAAAEKSGKEEVVLLSPACASQDQFTDFEARGDAFKEAVADI 481


>gi|295688559|ref|YP_003592252.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Caulobacter segnis
           ATCC 21756]
 gi|295430462|gb|ADG09634.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Caulobacter segnis
           ATCC 21756]
          Length = 470

 Score =  305 bits (782), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 172/467 (36%), Positives = 255/467 (54%), Gaps = 19/467 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F   ++AVFGLGR+GL+AA AL   G  V  WD+   + + A   G  V+D    
Sbjct: 2   IPVRGFEGKTVAVFGLGRTGLTAARALIAGGAKVALWDEKVASREAAAAEGFPVVDLETA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL--QSPFIAV 118
            W   + L+LSPG+ LT    HW V+ A    VEI+GDIELF R    + +  +   IA+
Sbjct: 62  DWRQFAALMLSPGVPLTHPKPHWTVQKAKAAGVEILGDIELFARTVAAAPVHKRPKIIAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+    G D ++GGNIG  +L LE       YV+E SSYQ++LT +
Sbjct: 122 TGTNGKSTTTALIGHLCASAGRDTRIGGNIGQGVLGLEDMHGGAVYVLELSSYQLDLTSS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
           + P   VLLNISPDHLDRH  ++ Y+  K++I         AII ++D  C++I  ++  
Sbjct: 182 LHPDAVVLLNISPDHLDRHGGMDGYIAAKRRIFLNQGKGDTAIIGVDDPWCQQICTEITA 241

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK------KHNIQNLVTSA 289
                    S        +Y  +  L   AT E + + +   +      +HN QN   + 
Sbjct: 242 ANRRTIWPISAGKAMGRGVYALQGVL-YDATGERVVEVADLLRARSLPGRHNWQNAAAAY 300

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                +G+ +++    L++  GL HR++T+ ++G V F+NDSKATN  +   A ++   +
Sbjct: 301 AAARAIGIPMQDAVDGLMTFPGLAHRMETVGKIGKVRFVNDSKATNADAARQA-MSSYPK 359

Query: 350 IYWIAGGLSKS---DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
            YWIAGG++K+   DD   LFP   ++AKAY IG +A  F     GK    +S TL++A+
Sbjct: 360 FYWIAGGVAKAGGIDDLKDLFP---RVAKAYLIGEAAEPFSWTLAGKAEVAMSGTLERAV 416

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
                D       +IVL SP CASFDQ+++F  RG +F + V+ + G
Sbjct: 417 SQAYADAAASDEEAIVLLSPACASFDQFSDFEARGEAFRAAVNGLVG 463


>gi|192292416|ref|YP_001993021.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodopseudomonas palustris TIE-1]
 gi|192286165|gb|ACF02546.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodopseudomonas
           palustris TIE-1]
          Length = 469

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 187/464 (40%), Positives = 273/464 (58%), Gaps = 15/464 (3%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           +SF   S+AVFGLG SGL++  ALK  G  VIA DD+   + +A   G    D R +PW+
Sbjct: 5   TSFAGQSVAVFGLGGSGLASCHALKAGGAEVIACDDNLDRMVEAAQAGFITADLRNLPWT 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             + LVL+PG+ LT    HW V  A +  VE+IGD+ELF RER+  + ++PF+A+TGTNG
Sbjct: 65  NFAALVLTPGVPLTHPAPHWTVLKAQEAGVEVIGDVELFCRERKAHAPRAPFVAITGTNG 124

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T ALI+H+LR+ G+D QLGGNIG  IL+LE     R +VIE SSYQI+LTP++DP++
Sbjct: 125 KSTTTALIAHLLREAGWDTQLGGNIGTAILSLEPPKDGRVHVIEMSSYQIDLTPSLDPTV 184

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIGHSI 240
           G+LLN++ DH+DRH T+E+Y  +K+++V   +    +II ++D      A  +   G  +
Sbjct: 185 GILLNVTEDHIDRHGTIEHYAAVKERLVAGVQDGGTSIIGVDDEFGRAAADRIERAGKRV 244

Query: 241 SRISSQS-LQSD--SDLYIDESFLKCSATSEV--IFDFSQETKKHNIQNLVTSAVVCMQL 295
            R+S Q  +QS   +DL      +    ++EV  +         HN QN   +A   + L
Sbjct: 245 VRMSVQGPVQSGITADLETIRR-IDGGKSTEVAKLGGIGSLRGLHNAQNAAAAAAAVLAL 303

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARL----GHVIFINDSKATNLHSVIHAFLNEKRRIY 351
           G+  E +++ L S  GL HR++ + R     G  +F+NDSKATN  +   A  +    I+
Sbjct: 304 GVSPEVLQQGLRSFPGLAHRMEQVGRQVGEKGTTLFVNDSKATNADAAAKALASFG-EIF 362

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           WIAGG  K+    +L  +   I KAY IG +A  F     G++   +S+TL+ A+ +  R
Sbjct: 363 WIAGGKPKTGGIESLAEYFPSIRKAYLIGQAAQEFAATLEGRVPYEISETLEAAVPAAAR 422

Query: 412 DVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           D     L   +VL SP CASFDQ+ NF  RG  F   V+ + G+
Sbjct: 423 DAAASGLAEPVVLLSPACASFDQFRNFELRGTRFRELVTALDGV 466


>gi|39936594|ref|NP_948870.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodopseudomonas palustris CGA009]
 gi|62900683|sp|Q6N409|MURD_RHOPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|39650450|emb|CAE28973.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Rhodopseudomonas
           palustris CGA009]
          Length = 469

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 186/471 (39%), Positives = 274/471 (58%), Gaps = 23/471 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++SF   S+AVFGLG SGL++  ALK  G  VIA DD+   + +A   G    D R +
Sbjct: 2   IPVTSFAGQSVAVFGLGGSGLASCHALKAGGAEVIACDDNLDRMVEAAQAGFITADLRNL 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           PW+  + LVL+PG+ LT    HW V  A +  VE+IGD+ELF RER+  + ++PF+A+TG
Sbjct: 62  PWTNFAALVLTPGVPLTHPAPHWTVLKAQEAGVEVIGDVELFCRERKAHAPRAPFVAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+LR+ G+D QLGGNIG  IL+LE     R +VIE SSYQI+LTP++D
Sbjct: 122 TNGKSTTTALIAHLLREAGWDTQLGGNIGTAILSLEPPKDGRVHVIEMSSYQIDLTPSLD 181

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIG 237
           P++G+LLN++ DH+DRH T+E+Y  +K+++V   +    +II ++D      A  +   G
Sbjct: 182 PTVGILLNVTEDHIDRHGTIEHYAAVKERLVAGVQDGGTSIIGVDDEFGRAAADRIERAG 241

Query: 238 HSISRISSQ-------SLQSDSDLYIDESFLKCSATSEV--IFDFSQETKKHNIQNLVTS 288
             + R+S Q       +   DS   +D        ++EV  +         HN QN   +
Sbjct: 242 KRVVRMSVQGPVTFGITADLDSIRRVD-----GGTSTEVAKLGGIGSLRGLHNAQNAAAA 296

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIAR----LGHVIFINDSKATNLHSVIHAFL 344
           A   + LG+  E +++ L S  GL HR++ + R     G  +F+NDSKATN  +   A  
Sbjct: 297 AAAVLALGVSPEVLQQGLRSFPGLAHRMEQVGRQVGEQGTTLFVNDSKATNADAAAKALA 356

Query: 345 NEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ 404
           +    I+WIAGG  K+    +L  +  +I KAY IG +A  F     G++   +S+TL+ 
Sbjct: 357 SFG-DIFWIAGGKPKTGGIESLAEYFPRIRKAYLIGQAAQEFAATLEGRVPYEISETLEA 415

Query: 405 ALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           A+ +  RD     L   +VL SP CASFDQ+ NF  RG  F   V+ + G+
Sbjct: 416 AVPAAARDAAASGLAEPVVLLSPACASFDQFRNFELRGTRFRELVTALDGV 466


>gi|254419559|ref|ZP_05033283.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brevundimonas sp.
           BAL3]
 gi|196185736|gb|EDX80712.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brevundimonas sp.
           BAL3]
          Length = 467

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 183/460 (39%), Positives = 251/460 (54%), Gaps = 17/460 (3%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F    +AVFGLGRSG++AA ALK  G   I WDD      QA+  G  V D    
Sbjct: 2   IPVPGFEGRRVAVFGLGRSGITAARALKAGGATPILWDDGVSGRLQAQAEGFVVEDLTTA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE-RRFSSLQSPF-IAV 118
            WS  + LVLSPG  LT    HW V  A    V ++GDIELF R        + P+ IA+
Sbjct: 62  DWSGFAALVLSPGAPLTHPKPHWTVDKARAAGVPVVGDIELFARALDALPEGRRPWVIAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI  VL++ G  V +GGNIG+ +L L   +P   YVIE SSYQ++LT  
Sbjct: 122 TGTNGKSTTTALIGWVLQQAGLTVHVGGNIGIGVLALPEPTPGAVYVIEVSSYQLDLTTG 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHA-IICINDHQCEKIAYDMNFIG 237
             P   +L NISPDHLDRH  +E YV  K++I    K A  + I+D     I  ++   G
Sbjct: 182 FAPDAAILTNISPDHLDRHGGMEGYVAAKRRIFQSRKTAPYVGIDDPYGFAIWQELKAEG 241

Query: 238 HSISRIS-SQSLQSDSDLYIDESFLKCSATSE--VIFDFSQE---TKKHNIQNLVTSAVV 291
            ++  +S  + +  D  +Y+ + +L  +A      I D S+      +HN QN   + + 
Sbjct: 242 RAVDPVSVERPMDDDLGMYLMDDWLTYNAGGRPAPIVDLSKARSLPGRHNAQNAAFAFLA 301

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
              +G+  E + + LL+  GL HR++ +  +GHV FINDSKATN  +   A L    +++
Sbjct: 302 VNDMGIPEETVVKGLLTFPGLAHRMEAVGHIGHVRFINDSKATNADAARQA-LASYPKVF 360

Query: 352 WIAGGLSKS---DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           WIAGG  K    DD + LFP   ++AKAY IG +A  F     G     +SKT+D A+ +
Sbjct: 361 WIAGGKPKDGGIDDLADLFP---RVAKAYLIGEAAEAFAATL-GDTPHVISKTMDAAVVA 416

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
              D  +     IVL SP CASFDQY +F  RG +F + V
Sbjct: 417 AAADAASAGGDQIVLLSPACASFDQYPDFEVRGEAFRAAV 456


>gi|254292767|ref|YP_003058790.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Hirschia
           baltica ATCC 49814]
 gi|254041298|gb|ACT58093.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Hirschia baltica
           ATCC 49814]
          Length = 474

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 173/467 (37%), Positives = 259/467 (55%), Gaps = 22/467 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +S ++   +A+FGLGR+G+SAA AL   G  V AWDD+  + ++A + G+ + D  ++
Sbjct: 2   IPVSVYKGKDVALFGLGRTGISAARALMAGGARVHAWDDNEISREKAAEAGLTIADINKM 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE-RRFSSLQSP-FIAV 118
            W   S LVLSPGI       H  VK+A    V ++GD+ELF R      +   P  + +
Sbjct: 62  DWQKFSALVLSPGIPFKYPEPHRVVKMAKMVGVPVVGDMELFARAVAELPAYARPKIVGI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+L + G DV++GGNIG+ +L+L+  + N  YV+E SSYQ++L  +
Sbjct: 122 TGTNGKSTTTALIGHILERAGRDVRVGGNIGVGVLDLKAMNANSIYVLELSSYQLDLIDS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQ----CEKIAY 231
           +   + V LN+SPDHLDRH  ++ YV  K +I    T +  A+I ++D +    C ++A 
Sbjct: 182 LRCDVAVFLNVSPDHLDRHGGMQGYVAAKNRIFRNQTSADTAVIGVDDMRTQILCTRLAA 241

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFL--KCSATSEVIFDFSQETK---KHNIQNLV 286
           +       +  +S++ +     + + E  L    S  +E   D S       +HN QN  
Sbjct: 242 ENT---RRVCPVSAE-MALGRGVSVLEGMLSDSLSGHAETSVDLSSARALPGQHNHQNAA 297

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
            +   C  LGL   EI   L S  GL HRL+++  +  V F+NDSKATN  +   A L  
Sbjct: 298 AAYAACQSLGLDASEIIDGLNSFPGLEHRLESVGSVNGVAFVNDSKATNSQAAEQA-LRA 356

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
               +WIAGG +K D    L P+ S I KAY IG++   F +   GK  +    TLD A+
Sbjct: 357 YPNAFWIAGGRAKDDGIDALAPYFSSIKKAYLIGHAMSDFSNTLKGKTPTMNCGTLDVAV 416

Query: 407 KSVVRD--VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +  +D     ++ P ++LFSP CASFDQ+ +F  RG +F +QV  I
Sbjct: 417 AAAYKDALASGIKDP-VILFSPACASFDQFKDFEARGDAFKNQVHAI 462


>gi|167647631|ref|YP_001685294.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Caulobacter
           sp. K31]
 gi|189082872|sp|B0T833|MURD_CAUSK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|167350061|gb|ABZ72796.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Caulobacter sp.
           K31]
          Length = 469

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 170/465 (36%), Positives = 251/465 (53%), Gaps = 19/465 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F   ++AVFGLGR+GL+AA AL   G  V  WD+ P + + A   G+ V+D    
Sbjct: 2   IPVRGFEGKTVAVFGLGRTGLTAARALIAGGAKVALWDEKPESRQAAVAEGLNVVDLTTS 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAV 118
            WS  + L+LSPG+ LT    HW V  A    VE++GDIELF R    +    +   IA+
Sbjct: 62  DWSDYAALMLSPGVPLTHPKPHWTVGKAKAAGVEVLGDIELFARTVNAAPEHKKPKIIAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+ R+ G D ++GGNIG  +L LE       YV+E SSYQ++LT +
Sbjct: 122 TGTNGKSTTTALIGHLCRQAGRDTRVGGNIGEGVLGLEDMHGGAVYVLELSSYQLDLTSS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
           + P   VLLNISPDHLDRH  ++ Y+  K++I         AII ++D  C++I  ++  
Sbjct: 182 LKPDAVVLLNISPDHLDRHGGMDGYIAAKRRIFLNQGKGDTAIIGVDDPWCQQICTEITA 241

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK------KHNIQNLVTSA 289
                    S        +Y  +  L   AT E + + +   +      +HN QN   + 
Sbjct: 242 ANRRTIWPISAGKAMGRGVYALQGVL-YDATGERVTEMADLLRARSLPGRHNWQNAAAAY 300

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                +G+   +    L+S  GL HR++T+ +LG V F+NDSKATN  +   A ++   +
Sbjct: 301 AAAKAIGIPAHQAVDGLMSFPGLAHRMETVGKLGKVRFVNDSKATNADAARQA-MSSYPK 359

Query: 350 IYWIAGGLSKS---DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
            YWIAGG+ K+   DD   LFP   ++A AY IG +A  F     GK  +     ++ A+
Sbjct: 360 FYWIAGGVPKAGGIDDLVDLFP---RVAGAYLIGQAAEDFGKTLEGKAPARQCGDIETAV 416

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +   D       ++VL SP CASFDQ+ +F +RG +F + V+ +
Sbjct: 417 AAAYADAVASGEEAVVLLSPACASFDQFADFEQRGEAFRAAVNGL 461


>gi|154252861|ref|YP_001413685.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Parvibaculum
           lavamentivorans DS-1]
 gi|154156811|gb|ABS64028.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Parvibaculum
           lavamentivorans DS-1]
          Length = 467

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 176/458 (38%), Positives = 252/458 (55%), Gaps = 16/458 (3%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           + F   ++AV GLG+SG++   AL+  G +V AWDD      +A   G  + D     W 
Sbjct: 5   TGFEKRNVAVLGLGKSGMATVRALEAGGANVFAWDDAGEKRAEAAKAGFTLSDASGWDWK 64

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             + LVLSPGI LT    H  V  A    VE+IGDIELF  +R  +   +  +A+TGTNG
Sbjct: 65  TFAALVLSPGIPLTHPEPHPAVLTAKAAGVEVIGDIELF--QRAVTGTGAKVVAITGTNG 122

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T ALI H++R+ G D Q+GGNIG  +L LE  S +  YV+E SSYQI+L P++ P I
Sbjct: 123 KSTTTALIGHMVRRCGGDAQVGGNIGKAVLELEAPSASSVYVVEVSSYQIDLAPSLAPHI 182

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMN------ 234
            VLLNI+PDH+DRH T+E+Y ++K +I    T +  A+I I++ +   I    +      
Sbjct: 183 AVLLNITPDHIDRHGTVEHYADVKARIFARQTAADTAVIGIDERRSSDICTRESARRVEK 242

Query: 235 FIGHSISRISSQSLQS-DSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
            +  S+ +  S+ + + D  LY  +S    +A +  +         HN QN   +     
Sbjct: 243 VVPVSVGKALSRGVYALDGVLY--DSTGTQTAKAGDLRTIKTLAGAHNWQNAAAAYAAGR 300

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            LG + E I  A  S  GL HR++ +A    V F+NDSKATN  +   A L     IYWI
Sbjct: 301 ALGYQRERIFAAFESFPGLAHRMEIVAEAEGVRFVNDSKATNADAASKA-LGTYDNIYWI 359

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           AGG +K     +L P+  +I +AY IG++A  F     GK+ +    TLD+A+++  RD 
Sbjct: 360 AGGKAKEGGIESLEPWFPRIRRAYLIGDAAKSFGETLKGKVEAVQCGTLDRAVEAATRDA 419

Query: 414 ENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
                   +VL SP CASFDQ+ NF +RG +F + V E
Sbjct: 420 RADASDLKVVLLSPACASFDQFANFEQRGDAFRAAVQE 457


>gi|213019467|ref|ZP_03335273.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212994889|gb|EEB55531.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 443

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 176/450 (39%), Positives = 251/450 (55%), Gaps = 25/450 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF--- 57
           M+L+ ++N S+AVFGLG++GLS   AL  S   + AWDD+   +  AK +  E  +F   
Sbjct: 1   MQLNKYKNQSVAVFGLGKTGLSVINALTKSSAKIYAWDDNKEQIANAKKIYKEC-NFTHP 59

Query: 58  REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
            E  W  IS L+LSPG+ +     HW VKLA  F+ +I  DIELF+  +   +     I 
Sbjct: 60  NEYNWHEISTLILSPGVPIP---THWVVKLARSFDCKIKSDIELFLETK---TTNQKVIG 113

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177
           +TGTNGKS+T +LI H+L+  G  V +GGN+G+PIL+LE  +    YVIE SS+Q+EL  
Sbjct: 114 ITGTNGKSTTTSLIGHILKSTGKKVAIGGNLGMPILDLERDA--EIYVIEFSSFQLELMN 171

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM--NF 235
            I+  I VLLNI+PDH+DRH ++ NY+  K K++  SK A+I  ++    KI  D+   F
Sbjct: 172 EINVDISVLLNITPDHIDRHGSMNNYIATKLKLINGSKIAVIGCDN----KITSDVFNKF 227

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCS-ATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
            G+ I   +S S    S           S + S+V  +        N++N+V +  VC  
Sbjct: 228 TGNKIPISASMSPSLSSQCLGTGKLENHSLSVSDVKINLVS-----NVENIVAAHAVCKL 282

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           LG+    I   + S  GL HR + + ++ +V+FINDSKATN  S   A L+ K  IYWI 
Sbjct: 283 LGVDSSTIVNEIKSFPGLRHRNEFLGKIHNVLFINDSKATNAESTEKAILSYKN-IYWIV 341

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE 414
           GG SK     +L    +KI KA+ IG S  +F +    KI+      L+ A K    +  
Sbjct: 342 GGKSKKGGIESLSKHFTKIRKAFLIGESTEVFANIMENKIDYMKCYNLENAFKLAFEEAI 401

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           N +    +L SP C+SFDQ+ NF ERG +F
Sbjct: 402 NSKEEVAILLSPACSSFDQWKNFEERGEAF 431


>gi|190570951|ref|YP_001975309.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|190357223|emb|CAQ54641.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 451

 Score =  276 bits (707), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 175/450 (38%), Positives = 251/450 (55%), Gaps = 25/450 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF--- 57
           ++L+ ++N S+AVFGLG++GLS   AL  S   + AWDD+   +  AK +  E  +F   
Sbjct: 9   VQLNKYKNQSVAVFGLGKTGLSVINALTKSSAKIYAWDDNKEQIANAKKIYKEC-NFTHP 67

Query: 58  REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
            E  W  IS L+LSPG+ +     HW VKLA  F+ +I  DIELF+  +   +     I 
Sbjct: 68  NEYNWHEISTLILSPGVPIP---THWVVKLARSFDCKIKSDIELFLETK---TTNQKVIG 121

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177
           +TGTNGKS+T +LI H+L+  G  V +GGN+G+PIL+LE  +    YVIE SS+Q+EL  
Sbjct: 122 ITGTNGKSTTTSLIGHILKSTGKKVAIGGNLGMPILDLERDA--EIYVIEFSSFQLELMN 179

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM--NF 235
            I+  I VLLNI+PDH+DRH ++ NY+  K K++  SK A+I  ++    KI  D+   F
Sbjct: 180 EINVDISVLLNITPDHIDRHGSMNNYIATKLKLINGSKIAVIGCDN----KITSDVFNKF 235

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCS-ATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
            G+ I   +S S    S           S + S+V  +        N++N+V +  VC  
Sbjct: 236 TGNKIPISASMSPSLSSQCLGTGKLENHSLSVSDVKINLVS-----NVENIVAAHAVCKL 290

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           LG+    I   + S  GL HR + + ++ +V+FINDSKATN  S   A L+ K  IYWI 
Sbjct: 291 LGVDSSTIVNEIKSFPGLRHRNEFLGKIHNVLFINDSKATNAESTEKAILSYKN-IYWIV 349

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE 414
           GG SK     +L    +KI KA+ IG S  +F +    KI+      L+ A K    +  
Sbjct: 350 GGKSKKGGIESLSKHFTKIRKAFLIGESTEVFANIMENKIDYMKCYNLENAFKLAFEEAI 409

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           N +    +L SP C+SFDQ+ NF ERG +F
Sbjct: 410 NSKEEVAILLSPACSSFDQWKNFEERGEAF 439


>gi|114798168|ref|YP_761703.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Hyphomonas
           neptunium ATCC 15444]
 gi|114738342|gb|ABI76467.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hyphomonas
           neptunium ATCC 15444]
          Length = 471

 Score =  276 bits (705), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 169/462 (36%), Positives = 249/462 (53%), Gaps = 12/462 (2%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ +    +AV+GLGRSGLSAA ALK  G  V AWDD+     +A+  GI + D  + 
Sbjct: 2   IPITEYAGKDVAVYGLGRSGLSAAKALKAGGARVHAWDDNEETRAKAEAAGIALSDINKR 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE-RRFSSLQSP-FIAV 118
            W   + LVLSPGI       H  V++A    V +IGD+ELF R  +       P  +AV
Sbjct: 62  DWQTFAALVLSPGIPFKFPQPHRLVRMAEMTGVPVIGDMELFARAVQALPERARPKVVAV 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI H+L++ G D ++GGNIG  +L+L     N  YV+E SSYQ++L  +
Sbjct: 122 TGTNGKSTTTALIGHILKQAGRDARVGGNIGTGVLDLAALHSNAIYVLELSSYQLDLVKS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
           +   + V +N+SPDHLDRH  ++ Y   K +I    T    A+I  +D   + IA  ++ 
Sbjct: 182 LHCDVSVFMNLSPDHLDRHGGMDGYQAAKMRIFQNQTDKNVAVIGFDDIYTQSIAIGLSA 241

Query: 236 IG-HSISRISSQSLQSDSDLYIDES-FLKCSATSEVIFDFSQETK---KHNIQNLVTSAV 290
            G   + +ISS          +D   +   S  +E +    +      +HN QN   +  
Sbjct: 242 KGPQKVVQISSTYTLGKGISAVDGRLYDNQSGKAEFVGKLDECPALIGRHNHQNAAAAYA 301

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C  LGL    I   L +  GL HR++ +  L  + FINDSKATN  +   A L   + I
Sbjct: 302 ACRALGLDPATIMAGLRTFPGLAHRMEAVGELDGIRFINDSKATNAQAAEQA-LRSFKNI 360

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
           YWIAGG+ K++  + L      + KAY IG +   F     GK+ S +  +LD+A+++  
Sbjct: 361 YWIAGGVPKAEGIAPLASLFPNVTKAYLIGQAEDAFAATLNGKVPSQVCGSLDRAVEAAY 420

Query: 411 RDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           RD +    P +++LFSP CASFDQ+ ++  RG +F + V  I
Sbjct: 421 RDAKAAGEPGAVILFSPACASFDQFKDYEHRGDAFRTLVHGI 462


>gi|302383885|ref|YP_003819708.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194513|gb|ADL02085.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 492

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 172/485 (35%), Positives = 246/485 (50%), Gaps = 42/485 (8%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F    +AVFGLGRSG++AA ALK  G   I WDD      +A+  G  V D    
Sbjct: 2   IPVPGFDGRRVAVFGLGRSGITAARALKAGGAVPILWDDGVSGRMRAEAEGFTVEDLTTA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRF--SSLQSPFIAV 118
            WS  + LVLSPG  LT    HW V  A   +V +IGDIELF R      +  +   +A+
Sbjct: 62  DWSGFAALVLSPGAPLTHPKPHWTVDKARAADVPVIGDIELFARALAAIPADARPKVVAI 121

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T ALI  VL++ G  V +GGNIG+ +L L   +P+  YV+E SSYQ++LT +
Sbjct: 122 TGTNGKSTTTALIGWVLKQAGLTVHIGGNIGIGVLALSAPTPDAVYVVEVSSYQLDLTTS 181

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKK---IVTMSKHAIICINDHQCEKIAYDMNF 235
             P + +L NISPDHLDRH  +E YV  K +   +++  K A+I ++D    K    +N 
Sbjct: 182 FAPDVAILTNISPDHLDRHGGMEGYVAAKARLFQVMSPEKVALIGVDDDWGWKTVNALND 241

Query: 236 IGHSISRISSQSLQSDSD--------------------------LYIDESFLKCSATSEV 269
            G  +S I++++     D                          + +D +  K  A    
Sbjct: 242 RGLRLSTITTRTPPQFVDPAGGVPVAELATRLPDQKPAFDAGRFIIVDATGGKLVADGVA 301

Query: 270 IFDFSQE---TKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVI 326
           I D +       +HN QN   +      LG+  E     L++  GL HR++T+  LG V 
Sbjct: 302 IADLAPARSLPGRHNAQNAAFAYAAARALGVSTEAAVDGLMTFPGLAHRMETVGHLGPVR 361

Query: 327 FINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS---DDFSTLFPFISKIAKAYFIGNSA 383
           F+NDSKATN  +   A ++     +WIAGG +K    +D   LFP   ++AKAY IG +A
Sbjct: 362 FVNDSKATNADAARQALMSYPTS-FWIAGGRAKDGGIEDLRDLFP---RVAKAYLIGEAA 417

Query: 384 MLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFS 443
             F     G     ++  +  A+     D       ++VL SP CASFDQ+ +F  RG +
Sbjct: 418 ADFAATL-GDTPHVVAGDMATAVALAAADARAAGGDAVVLLSPACASFDQFPDFEVRGEA 476

Query: 444 FMSQV 448
           F + V
Sbjct: 477 FRAAV 481


>gi|46203167|ref|ZP_00051951.2| COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 341

 Score =  275 bits (702), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 140/328 (42%), Positives = 202/328 (61%), Gaps = 6/328 (1%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           ++F    +A+FGLG SGL+   +L   G  V+AWDD+  +  +A+D GI V D RE  WS
Sbjct: 17  TTFAGQKVALFGLGGSGLATIRSLLAGGADVLAWDDNAGSRDRARDQGITVTDLREADWS 76

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
             S LVL+PG+ LT    HW V LA    + IIGDIE++ RER   + ++PF+A+TGTNG
Sbjct: 77  GFSALVLAPGVPLTHPEPHWTVPLARAAGIAIIGDIEIYCRERAALAPEAPFVAITGTNG 136

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL +H+LR  G DVQ+GGNIG  IL+L+  +PNR +VIE SS+QI+LTP++ PSI
Sbjct: 137 KSTTTALTAHLLRHAGRDVQMGGNIGTAILSLQPPAPNRVHVIELSSFQIDLTPSLAPSI 196

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
           G+LLN++PDHLDRH T+ENY  IK++++  ++ A++ ++D  C  IA      G  + RI
Sbjct: 197 GILLNLTPDHLDRHGTMENYAAIKERLIAGAELAVVGVDDAYCAAIAE--RRTGERV-RI 253

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGLKVE 300
             +   + +   +  +     A   VI   S        HN+QN   +     +LGL  +
Sbjct: 254 HVEGHGAAAGDVVCSAGTVRGADGAVIAQVSGIASLLGDHNLQNAAAAVAAARRLGLTAD 313

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFI 328
           EI   L S  GL HR++ + R+G V F+
Sbjct: 314 EIAAGLQSFPGLAHRMEPLRRIGPVRFV 341


>gi|47779260|gb|AAT38528.1| MurD [Bartonella bacilliformis]
          Length = 430

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 155/397 (39%), Positives = 228/397 (57%), Gaps = 15/397 (3%)

Query: 68  LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR-------FSSLQSPFIAVTG 120
           L+L+PG+ L     HW V  A Q NVE+IGDIELFVR R        F     PFIA+TG
Sbjct: 31  LILAPGVPLFYPKPHWVVDKARQENVEVIGDIELFVRARNHFLQQYDFCDWDVPFIAITG 90

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T  L+ H+L + GYDVQ+GGN+G  IL L+ F   R YVIECSS+QI+L P++ 
Sbjct: 91  TNGKSTTTTLLVHLLEQMGYDVQMGGNVGTAILTLKPFVKKRIYVIECSSFQIDLAPSLQ 150

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P+IG+LLN++PDH+DRH T  +Y   K  +V+ + HA+I ++D  C+ +   +    H +
Sbjct: 151 PTIGILLNLTPDHIDRHGTFAHYAQGKGLLVSRASHALISVDDAACKTLYQQLVDEKHQV 210

Query: 241 SRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQL 295
             IS +    ++  Y++ +  F        ++ D +  T     HN QN +        L
Sbjct: 211 EAISKKHF-VENGFYVEGTQLFSVRHGQRHMLVDLAAVTSLRGSHNAQNALMVLATLQAL 269

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
            +    +++ L+S  GL HR+Q + ++G V+FINDSKATN  +   A L     I+WI G
Sbjct: 270 KITDPHLEKHLVSYAGLAHRMQQVRKIGSVLFINDSKATNADASAVA-LATFDDIFWILG 328

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           G +K      L  F  KI KAY IG +A  F    G     ++S TL+ A++    D  +
Sbjct: 329 GKAKEGGIGALRKFFPKIRKAYLIGEAAEDFVRVIGSSFPISMSLTLENAVREAAIDASH 388

Query: 416 VQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            ++  ++VL SP CAS+DQ+ N+  RG +F+S V ++
Sbjct: 389 EKVKEAVVLLSPACASYDQFKNYEMRGEAFISFVMQL 425


>gi|58698935|ref|ZP_00373796.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225630554|ref|YP_002727345.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia sp. wRi]
 gi|58534552|gb|EAL58690.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225592535|gb|ACN95554.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia sp. wRi]
          Length = 517

 Score =  269 bits (687), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 254/502 (50%), Gaps = 67/502 (13%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFR 58
           ++L+ ++N ++AVFGLG++GLSA  AL  SG  + AWDDH   +  AK M      I  +
Sbjct: 9   VQLNKYKNQNVAVFGLGKTGLSAINALTKSGARIYAWDDHEEQIANAKMMYKKCNFIHPK 68

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           E  W  IS LVLSPG+       HW VKLA +F+ +I  DIELF+  +   +     I V
Sbjct: 69  EYNWHEISALVLSPGVPT---EPHWIVKLARRFDCKIKSDIELFLEAK---TTNQKVIGV 122

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T +LI H+L+  G  V +GGN+G+P+L+LE  +    YVIE SS+Q+EL   
Sbjct: 123 TGTNGKSTTTSLIGHILKSAGKKVAIGGNLGVPVLDLERDA--EIYVIELSSFQLELMNE 180

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAII---------CINDHQCEKI 229
           I+  I  LLNI+PDH+DRH ++ENY+  K K++  S+ A+I           N    +KI
Sbjct: 181 INVDISALLNITPDHIDRHGSMENYIATKLKLINGSEVAVIGCDNEITADIFNKFTGDKI 240

Query: 230 AYDMNFIGHSISRISSQSLQ----------------------------SDSDLYIDESFL 261
              + +   S  R++ +S +                            S+    ID ++L
Sbjct: 241 PISVTYSPMSFQRVTLESRKEKPLPTTQMTEGGARDLISLAGNNLLDYSEQITGIDRNYL 300

Query: 262 KCSAT------SEVIFDFSQETKKH-------------NIQNLVTSAVVCMQLGLKVEEI 302
             S +         I   S + + H             N +N+  +  VC  LG+    I
Sbjct: 301 DPSVSYLDDKRGTGIQKISLKLENHSLSVSDVKINLISNAENIAATYAVCKVLGVDSNTI 360

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDD 362
              + S  GL HR + + ++ +V F+NDSKATN  S   A L+ +  I WIAGG SK   
Sbjct: 361 INGIKSFSGLRHRNELLGKIRNVFFVNDSKATNAKSSEKAILSYE-NINWIAGGRSKKGG 419

Query: 363 FSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIV 422
             +L    +++ KA+ IG S   F +    K++      L+ A +    +  N      +
Sbjct: 420 IESLSKHFTRVRKAFLIGESTEAFANVMENKVDYVKCCNLEDAFRLAFEEALNSAEEVTI 479

Query: 423 LFSPGCASFDQYNNFRERGFSF 444
           L SP CASFDQ+ NF ERG +F
Sbjct: 480 LLSPACASFDQWKNFEERGEAF 501


>gi|99036108|ref|ZP_01315140.1| hypothetical protein Wendoof_01000003 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 517

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 254/502 (50%), Gaps = 67/502 (13%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFR 58
           ++L+ ++N ++AVFGLG++GLSA  AL  SG  + AWDDH   +  AK M      I  +
Sbjct: 9   VQLNKYKNQNVAVFGLGKTGLSAINALTKSGARIYAWDDHEEQIANAKMMYKKCNFIHPK 68

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           E  W  IS LVLSPG+       HW VKLA +F+ +I  DIELF+  +   +     I V
Sbjct: 69  EYNWHEISALVLSPGVPT---EPHWIVKLARRFDCKIKSDIELFLEAK---TTNQKVIGV 122

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T +LI H+L+  G  V +GGN+G+P+L+LE  +    YVIE SS+Q+EL   
Sbjct: 123 TGTNGKSTTTSLIGHILKSAGKKVAIGGNLGVPVLDLERDA--EIYVIELSSFQLELMNE 180

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAII---------CINDHQCEKI 229
           I+  I  LLNI+PDH+DRH ++ENY+  K K++  S+ A+I           N    +KI
Sbjct: 181 INVDISALLNITPDHIDRHGSMENYIATKLKLINGSEVAVIGCDNEITVDIFNKFTGDKI 240

Query: 230 AYDMNFIGHSISRISSQSLQ----------------------------SDSDLYIDESFL 261
              + +   S  R++ +S +                            S+    ID ++L
Sbjct: 241 PISVTYSPMSFQRVTLESRKEKPLPTTQMTEGGARDLISLAGNNLLDYSEQITGIDRNYL 300

Query: 262 KCSAT------SEVIFDFSQETKKH-------------NIQNLVTSAVVCMQLGLKVEEI 302
             S +         I   S + + H             N +N+  +  VC  LG+    I
Sbjct: 301 DPSVSYLDDKRGTGIQKISLKLENHSLSVSDVKINLISNAENIAATYAVCKVLGVDSNTI 360

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDD 362
              + S  GL HR + + ++ +V F+NDSKATN  S   A L+ +  I WIAGG SK   
Sbjct: 361 INGIKSFSGLRHRNELLGKIRNVFFVNDSKATNAKSSEKAILSYE-NINWIAGGRSKKGG 419

Query: 363 FSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIV 422
             +L    +++ KA+ IG S   F +    K++      L+ A +    +  N      +
Sbjct: 420 IESLSKHFTRVRKAFLIGESTEAFANVMENKVDYVKCCNLEDAFRLAFEEALNSAEEVTI 479

Query: 423 LFSPGCASFDQYNNFRERGFSF 444
           L SP CASFDQ+ NF ERG +F
Sbjct: 480 LLSPACASFDQWKNFEERGEAF 501


>gi|42520684|ref|NP_966599.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|62900687|sp|Q73GT3|MURD_WOLPM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|42410424|gb|AAS14533.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 509

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 179/502 (35%), Positives = 259/502 (51%), Gaps = 67/502 (13%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFR 58
           M+L+ ++N ++AVFGLG++GLSA  AL  SG  + AWDDH   +  AK M      I  +
Sbjct: 1   MQLNKYKNQNVAVFGLGKTGLSAINALTKSGARIYAWDDHEEQIANAKMMYKKCNFIHPK 60

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           E  W  IS LVLSPG+       HW VKLA +F+ +I  DIELF+  +   +     I V
Sbjct: 61  EYNWHEISALVLSPGVPT---EPHWIVKLARRFDCKIKSDIELFLEAK---TTNQKVIGV 114

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+T +LI H+L+  G  V +GGN+G+P+L+LE  +    YVIE SS+Q+EL   
Sbjct: 115 TGTNGKSTTTSLIGHILKSAGKKVAIGGNLGVPVLDLERDA--EIYVIELSSFQLELMNE 172

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAII-CINDHQCE---KIAYDMN 234
           I+  I  LLNI+PDH+DRH ++ENY+  K K++  S+ A+I C N+   +   K   D  
Sbjct: 173 INVDISALLNITPDHIDRHGSMENYIATKLKLINGSEVAVIGCDNEITADIFNKFTGDKI 232

Query: 235 FIGHSISRISSQSLQSDS-----------------DLY----------------IDESFL 261
            I  + S +S Q +  +S                 DL                 ID ++L
Sbjct: 233 PISVTYSPMSFQCVTLESRKEKPLPTTQMTEGGARDLISLAGNNLLDYSEQITGIDRNYL 292

Query: 262 KCSAT------SEVIFDFSQETKKHNIQ------NLVTSA-------VVCMQLGLKVEEI 302
             S +         I   S + + H++       NL+++A        VC  LG+    I
Sbjct: 293 DPSVSYLDDKRGTGIQKISLKLENHSLSVSDVKINLISNAENIAATYAVCKVLGVDSNTI 352

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDD 362
              + S  GL HR + + ++ +V F+NDSKATN  S   A L+ +  I WIAGG SK   
Sbjct: 353 INGIKSFSGLRHRNELLGKIRNVFFVNDSKATNAKSSEKAILSYE-NINWIAGGRSKKGG 411

Query: 363 FSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIV 422
             +L    +++ KA+ IG S   F +    K++      L+ A +    +  N      +
Sbjct: 412 IESLSKHFTRVRKAFLIGESTEAFANVMENKVDYVKCCNLEDAFRLAFEEALNSAEEVTI 471

Query: 423 LFSPGCASFDQYNNFRERGFSF 444
           L SP CASFDQ+ NF ERG +F
Sbjct: 472 LLSPACASFDQWKNFEERGEAF 493


>gi|58584765|ref|YP_198338.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|75497798|sp|Q5GSC8|MURD_WOLTR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|58419081|gb|AAW71096.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 498

 Score =  263 bits (671), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 175/497 (35%), Positives = 248/497 (49%), Gaps = 69/497 (13%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEV--IDFR 58
           M+LS ++N S+AVFGLG++GLS    L  SG    AWDD    +  AK M  E   I  +
Sbjct: 1   MQLSKYKNQSVAVFGLGKTGLSVINVLIKSGAKAYAWDDSKEQMANAKTMYKECNFIHPK 60

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           +  W  I  L+LSPG+ ++    HW VKLA  F+ +I  DIELF+  +   +     + V
Sbjct: 61  KYDWHEIKALILSPGVPISYPKPHWIVKLARSFDCKIKSDIELFLEAK---AKNQKIVGV 117

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL--T 176
           TGTNGKS+T +LI H+L+  G  V +GGN+G+PIL+LE       YVIE SS+Q+EL   
Sbjct: 118 TGTNGKSTTTSLIGHILKSAGKKVAIGGNLGVPILDLE--KDAEIYVIEISSFQLELINM 175

Query: 177 PTIDP-----------------------------------------SIGVLLNISPDHLD 195
           P + P                                          I VLLNI+ DH+D
Sbjct: 176 PAVIPVHDHTFFSGSQYRAAWMIKRVSEMTKKMTEVTKRMAGMIKVDISVLLNITLDHID 235

Query: 196 RHHTLENYVNIKKKIVTMSKHAII-CINDHQCEKIAYDM--NFIGHSISRISSQSLQSDS 252
           RH ++ENY+ +K K++  SK A+I C N+     I  D+   F G+ I     +SL  D 
Sbjct: 236 RHGSMENYIAVKSKLIGGSKVAVIGCDNE-----ITADIFNKFTGNKIPISGVRSLLDDK 290

Query: 253 D-LYIDESFLKCS----ATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALL 307
               I E  LK      + S+   + +      N +N+  S  VC  L +    I   + 
Sbjct: 291 KGAEIQEISLKLENHNLSASDAKINLTS-----NAENIAASCAVCKLLKVDSSTIIDGIK 345

Query: 308 SCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLF 367
           S  GL HR + + ++ +V+F+NDSKATN  S   A L+ K  IYWI GG SK     +L 
Sbjct: 346 SFSGLKHRNELLGKIENVLFVNDSKATNAESSKKAILSYK-NIYWIVGGRSKEGGIESLS 404

Query: 368 PFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPG 427
              ++I KA  IG S  +F      K++      L+ A +    +    +  + +L SP 
Sbjct: 405 KHFARIRKALLIGESTEVFASTMENKVDYVRCCNLEDAFRLAFEEAIKSKEKTTILLSPA 464

Query: 428 CASFDQYNNFRERGFSF 444
           CASFDQ+ NF ERG +F
Sbjct: 465 CASFDQWRNFEERGEAF 481


>gi|83592288|ref|YP_426040.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodospirillum rubrum ATCC 11170]
 gi|118595685|sp|Q2RVU2|MURD_RHORT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|83575202|gb|ABC21753.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 477

 Score =  259 bits (661), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 157/469 (33%), Positives = 241/469 (51%), Gaps = 27/469 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF--- 57
           + L  +    + + GLG+SG++ A AL  +G  V AWDD P     A+   + + D    
Sbjct: 5   IPLYQYAGQDLGIMGLGKSGMATARALAGTGTRVHAWDDSPILRDAARAESVPLCDLTDQ 64

Query: 58  --REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPF 115
             R  PW  +  +V SPGI  T    H    +A++  V +  DI+L  R R+       F
Sbjct: 65  TSRTSPWPALQGVVWSPGIPHTFPQPHPVAVIAHERGVPLFCDIDLLARARQDCF----F 120

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           + +TGTNGKS+T ALI H+L+   + VQ+GGN+G P L+ E    +  YV+E SSYQ+EL
Sbjct: 121 LGITGTNGKSTTTALIGHILKAARHPVQVGGNLGTPALSFEPLPFHGTYVLELSSYQLEL 180

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYD 232
            P++   + VLLNI+PDHL RH  ++ Y+  K++I         A++CI+D     I   
Sbjct: 181 VPSLCCDVAVLLNITPDHLARHGGMDGYIAAKRQIFRCGPRPGVAVVCIDDEPSLAIHDA 240

Query: 233 M-NFIGHSISRISSQSLQSDSDLYIDESFLKCS-ATSEVIFDFSQETK---KHNIQNLVT 287
           +    G  +  +S+++L       +D   +  +      + D +        HN QN   
Sbjct: 241 LCRENGRKVVAVSTRALPRGGVGAVDGQLVDATQGRPRAVADLTTIATLPGAHNWQNAAA 300

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +   C Q G+  + I  A+ S  GL HR + +A +  V FINDSKATN  +   A L   
Sbjct: 301 AYAACRQHGIDAKIIVEAMASFPGLPHRQELVAEIDGVRFINDSKATNADAADKA-LRCY 359

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKIN----STLSKTLD 403
             +YWIAGG  K     +L P   ++ +AY IG +A  F     GK+      TL++ + 
Sbjct: 360 DTVYWIAGGQPKEGGIVSLEPHFHRMRQAYLIGQAAPAFERTLKGKVPLSQVGTLTRAVT 419

Query: 404 QALKSVVRDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +A K+  RD     +P ++VL SP CAS+DQ+++F  RG  F   V+++
Sbjct: 420 EAAKAAWRDA----IPGAVVLLSPACASWDQFSSFEHRGDIFRELVADL 464


>gi|114570630|ref|YP_757310.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Maricaulis
           maris MCS10]
 gi|114341092|gb|ABI66372.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Maricaulis maris
           MCS10]
          Length = 474

 Score =  256 bits (655), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 159/470 (33%), Positives = 243/470 (51%), Gaps = 29/470 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + + ++    +AVFGLGR+G++ A AL+  G  V  WDD   +  +A   G+ + D    
Sbjct: 2   IPIHAYEGRRVAVFGLGRTGIATAKALEAGGATVSCWDDAEPSRARAAAEGLTLDDLNRR 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR------ERRFSSLQSP 114
            W  I+ L+LSPGI LT    H  V+LA      +IGDIELF +      E+R    +  
Sbjct: 62  DWGDIAALILSPGIPLTHPKPHHMVELARAVEAPVIGDIELFAQALADLPEKR----RPK 117

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            I +TGTNGKS+T ALI H+LR  G +V +GGNIG  IL      P  +YV+E SSYQ++
Sbjct: 118 VIGITGTNGKSTTTALIGHILRATGRNVVVGGNIGDAILAQSPPRPGSYYVLELSSYQLD 177

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQC----- 226
           LT T+   + VLLN++PDH+DRH   + Y   KK++  M K    A++ I+D+       
Sbjct: 178 LTHTLACDVAVLLNVTPDHIDRHGDFDGYFRAKKRLFEMQKPGGLAVVGIDDNTTSAYYS 237

Query: 227 --EKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK---KHN 281
              +   +   I  S  R+ ++ + +  D   D   L C+  S  I D ++      +HN
Sbjct: 238 ALRRQRREEEVIPISAGRVFARGVYALGDRVYDA--LDCA--SHPIVDLAKVPTLPGRHN 293

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +      LG+       A+ +  GL HR + +A +  V ++NDSKATN  + + 
Sbjct: 294 AQNAAAALATVRALGVAGRAAADAITTFPGLPHRQERVATINGVTYVNDSKATNAEAAVQ 353

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A L    R+ WI GG +K+   S   P   ++AKAY IG ++  F     G++ +     
Sbjct: 354 A-LGCYERVRWIIGGRAKAGGLSAAKPQFHRVAKAYLIGEASESFGRELDGELPNESCGD 412

Query: 402 LDQALKSVVRD-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           L  A+ +  RD +       ++L SP  ASFDQ+ ++  RG  F + V++
Sbjct: 413 LAGAIAAATRDALAEGGSGQVILLSPAAASFDQFASYEARGDMFRTLVND 462


>gi|149914524|ref|ZP_01903054.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           AzwK-3b]
 gi|149811317|gb|EDM71152.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           AzwK-3b]
          Length = 496

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 167/478 (34%), Positives = 235/478 (49%), Gaps = 48/478 (10%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + ++ +    +AV GLGRSGLSA  AL+  G HV+AWDD+P A   A + G E+ D  R+
Sbjct: 33  IPVTGYDGQRVAVLGLGRSGLSAGRALRAGGAHVLAWDDNPEARDMASEEGFEIKDLSRD 92

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP----- 114
             +  I+ L++SPGI       +  V  A Q  V +  DI LF     F+SL        
Sbjct: 93  GAFDDIACLIVSPGIPHLYPQPNKAVAKALQAGVPVDNDIGLF-----FASLGGADWAVH 147

Query: 115 -----FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECS 169
                 +AVTG+NGKS+T ALI HVL + G DVQL GNIG  +L+++        V+E S
Sbjct: 148 DVAPRVVAVTGSNGKSTTSALIHHVLHEAGKDVQLAGNIGRGVLDIDPPGDGGVVVLELS 207

Query: 170 SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICIN----- 222
           SYQ EL   + P + V  N+SPDHLDRH  L  Y   K+++        A+I I+     
Sbjct: 208 SYQTELARALTPDVAVFTNLSPDHLDRHAGLGGYFAAKRRLFAEGGPDRAVIGIDEPEGL 267

Query: 223 -----------DHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEV-I 270
                      D +  +I+ D    G   S  + +   S+        + K      + +
Sbjct: 268 FMAGQLATAPGDDRVIRISVDRKLAGPGWSVFARKGFLSE--------YRKGKQQGAIDL 319

Query: 271 FDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFIND 330
            +      +HN QN   +   C  L L  + I+RA  S  GL HR Q IA    V F+ND
Sbjct: 320 REIKGLPGQHNHQNACAAYAACRSLSLSPKVIERAFHSFAGLPHRSQVIAEKDGVTFVND 379

Query: 331 SKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF 390
           SKATN+ S + A LN    I WI GGL K    + L P +  + KAY IG  A      F
Sbjct: 380 SKATNVDSALKA-LNAFANIRWICGGLQKEGGLAGLEPGLRNVLKAYVIGREAA----QF 434

Query: 391 GGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
             ++  T ++T      +V   + + +    VL +P  ASFDQY+NF +RG  F++QV
Sbjct: 435 ALQLTGTEAETCTTMQTAVAHAMADAKPGETVLLAPAAASFDQYDNFEKRGEDFIAQV 492


>gi|163794525|ref|ZP_02188496.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [alpha
           proteobacterium BAL199]
 gi|159180249|gb|EDP64772.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [alpha
           proteobacterium BAL199]
          Length = 472

 Score =  254 bits (648), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 175/464 (37%), Positives = 237/464 (51%), Gaps = 22/464 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEVIDFR 58
           + L   R+H+ AV GLG+SG  AA AL  +G  V AWDD    CA  Q  D G  V+D  
Sbjct: 2   LNLGFARDHTYAVMGLGKSGAVAARALAAAGATVFAWDDSADRCAALQGVD-GATVVDLA 60

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR---ERRFSSLQSPF 115
           +     +  LVLSPGI  T    H     A    V IIGD+EL +R   +RR        
Sbjct: 61  QRGLGGVDALVLSPGIPHTHPEPHPVAAAAKAVGVPIIGDVELLLRALPDRRL------- 113

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           +A+TGTNGKS+T ALI H+L      V++GGN+G P L      PN   V+E SSYQ+EL
Sbjct: 114 VAITGTNGKSTTTALIGHILASANVPVEVGGNLGRPALEFADPGPNGVVVLELSSYQLEL 173

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYD 232
           TP++ P++ V LNI+PDH+DRH +L  YV  K++I    T    A+I  +D     +A  
Sbjct: 174 TPSLAPTVAVWLNITPDHIDRHGSLAGYVAAKRRIFAHQTPRGLAVIGNDDAHSRDVADR 233

Query: 233 MNFIGHSISRISSQSLQSDSDLYIDESFLKC-SATSEVIFDFSQETK---KHNIQNLVTS 288
           +   G  I  +S            D   +   S   E +   ++      +HN QN   +
Sbjct: 234 LRRDGRRIFDLSGVGPVVGGVYAEDSELIDARSGRPETVLSLTEAPALPGEHNAQNAAAA 293

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
              C  LG++   I   + S  GL HR + IA  G V+++NDSKATN  +   A      
Sbjct: 294 FAACAALGIQRSAIADGIRSFPGLAHRQERIAEAGGVLYVNDSKATNADAAARALACYS- 352

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            IYWIAGG  K    S+L PF  +I KAY IG SA  F    G    + L +TL+ A++ 
Sbjct: 353 AIYWIAGGRGKEGGVSSLAPFFPRIRKAYLIGESAGTFAREIGDDCPTGLCRTLEMAVRQ 412

Query: 409 VVRDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              D +    P ++VL SP  ASFDQ+ NF  RG  F + V ++
Sbjct: 413 AHLDAQADPRPGAVVLLSPAAASFDQFPNFEVRGDRFRTLVRDL 456


>gi|85373184|ref|YP_457246.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erythrobacter
           litoralis HTCC2594]
 gi|84786267|gb|ABC62449.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erythrobacter
           litoralis HTCC2594]
          Length = 459

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 161/463 (34%), Positives = 238/463 (51%), Gaps = 39/463 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFREIPW 62
           ++   S AV GL RSG +AA AL  SG  V+ WD  + P A  + +     V D      
Sbjct: 6   AWSGKSFAVLGLARSGQAAAEALLASGADVMVWDRQEEPRAAFEGR---ARVGDPMSEDL 62

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP--FIAVTG 120
           + I  LV+SPG+ L   N H  V+ A  F V IIGDIELF + R   S   P   I +TG
Sbjct: 63  TGIDGLVVSPGVPL---NTHPIVERAGHFGVPIIGDIELFAQAR---SALPPHRVIGITG 116

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL++H+L++ G + ++GGNIGLPIL  E       YV+E SSYQI+LT ++ 
Sbjct: 117 TNGKSTTTALVTHLLKEAGVEARMGGNIGLPILGEEPLPEGGVYVLELSSYQIDLTRSLA 176

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM---SKHAIICINDHQCEKIAYDMNFIG 237
                LLNI+PDHLDR+   E+Y   K ++ TM    + A     D Q   +        
Sbjct: 177 CEAAALLNITPDHLDRYDGFESYAFSKGRLFTMQGSGQFACFGCEDAQTRAVCN------ 230

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
                 ++QS +++         L+    + +  D+      HN+QN+  +  +  ++G+
Sbjct: 231 ------AAQSRRAEGRAIC----LEPEQYAAMQGDWPALQGPHNLQNVAAAIALVEEMGV 280

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LNEKRRIYWI 353
              + +  L S  GL HR++ +     V+F+NDSKATN  S   A      + + R++WI
Sbjct: 281 TRGDWEAGLTSYSGLPHRMEVVCEHESVLFVNDSKATNPASTAPALAAWPADPEPRVHWI 340

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
            GGL+K D        +  I +AY IG +   F    GG++    S+ + +A+K     V
Sbjct: 341 VGGLAKEDGLGECEAQLGNIKRAYAIGEAGPRFAELLGGRVPVERSELICEAVKQA---V 397

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEM 456
            N +   IVL SP CASFDQ+ +F +RG  F   V  + G ++
Sbjct: 398 SNAEAGDIVLLSPACASFDQFRDFEKRGEHFRQLVGALSGCDI 440


>gi|222474899|ref|YP_002563314.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) [Anaplasma
           marginale str. Florida]
 gi|255002871|ref|ZP_05277835.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) [Anaplasma
           marginale str. Puerto Rico]
 gi|222419035|gb|ACM49058.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) [Anaplasma
           marginale str. Florida]
          Length = 454

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 155/458 (33%), Positives = 240/458 (52%), Gaps = 28/458 (6%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFREI 60
           L  +R   +AVFGLG +G+S  C+L  SG  V+AWDD  C +++ +++  G E +   E 
Sbjct: 4   LPHYRGRKVAVFGLGETGISTVCSLVQSGARVLAWDDDKCVLRKNRELCAGCEFVHPYEY 63

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W  IS LVLSPG+  +  N  W VKLA +    I  D+E+F R R      +  I VTG
Sbjct: 64  RWDEISELVLSPGVPHSRCNESWVVKLAKRAGCHITSDVEIFCRSR-----PARLIGVTG 118

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+TV LI  +L + G D + GGNIG  +L+L        Y++E SSYQ+EL   ++
Sbjct: 119 TNGKSTTVELIGWILNRAGIDSETGGNIGKGVLSLP--QGKAAYILELSSYQLELMRGVN 176

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND----HQCEKIAYDMNF- 235
             +GV+LNI+P+HLD +  + +Y+  K +I+  S   +    D    H CE +   + F 
Sbjct: 177 LDVGVILNITPNHLDVYSNMADYIAAKGRILEFSNLLVANCGDSNTAHLCENVGNMVEFS 236

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
            G  ++R  S     D  +Y      + +    +  D +      N +N+  S  V   L
Sbjct: 237 CGKKLARGVSVL---DGRIYFQG---RVAEIGGLKIDSAS-----NAENIAASYAVAKSL 285

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  E I  ++    GL HR Q +A + +V F+NDSKAT   SV  A ++ +  +YWIAG
Sbjct: 286 GVSDEVIMASIREFPGLRHRNQVVAEVANVTFVNDSKATTAASVAKALVS-RENVYWIAG 344

Query: 356 GLSKSDDFSTLFP-FISKIAKAYFIGNSAMLFFHHFG-GKINSTLSKTLDQALKSVVRDV 413
           G SK      +   + ++I KA+ +G +A +F       ++   +   +  A++    + 
Sbjct: 345 GKSKDGGIEPILSLYANRIRKAFLVGEAADMFAVSLQRARVEHVMCYDVYNAVQIAFAEA 404

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                 + VL SP C+S DQ+ NF ERG +F + V+E+
Sbjct: 405 IASGTKATVLLSPACSSLDQWKNFEERGDAFCAAVAEL 442


>gi|254994751|ref|ZP_05276941.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) [Anaplasma
           marginale str. Mississippi]
 gi|255004003|ref|ZP_05278804.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) [Anaplasma
           marginale str. Virginia]
          Length = 454

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 155/458 (33%), Positives = 240/458 (52%), Gaps = 28/458 (6%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFREI 60
           L  +R   +AVFGLG +G+S  C+L  SG  V+AWDD  C +++ +++  G E +   E 
Sbjct: 4   LPHYRGRKVAVFGLGETGISTVCSLVQSGARVLAWDDDKCVLRKNRELCAGCEFVHPYEY 63

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W  IS LVLSPG+  +  N  W VKLA +    I  D+E+F R R      +  I VTG
Sbjct: 64  RWDEISELVLSPGVPHSRCNESWVVKLAKRAGCHITSDVEIFCRSR-----PARLIGVTG 118

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+TV LI  +L + G D + GGNIG  +L+L        Y++E SSYQ+EL   ++
Sbjct: 119 TNGKSTTVELIGWILNRAGIDSETGGNIGKGVLSLP--QGKAAYILELSSYQLELMRGVN 176

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND----HQCEKIAYDMNF- 235
             +GV+LNI+P+HLD +  + +Y+  K +I+  S   +    D    H CE +   + F 
Sbjct: 177 LDVGVILNITPNHLDVYSNMADYIAAKGRILEFSNLLVANCGDSNTAHLCENVGNMVEFS 236

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
            G  ++R  S     D  +Y      + +    +  D +      N +N+  S  V   L
Sbjct: 237 CGKKLARGVSVL---DGRIYFQG---RVAEIGGLKIDSAS-----NAENIAASYAVAKSL 285

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  E I  ++    GL HR Q +A + +V F+NDSKAT   SV  A ++ +  +YWIAG
Sbjct: 286 GVSDEVIMASIREFPGLRHRNQVVAEVANVTFVNDSKATTAASVAKALVS-RENVYWIAG 344

Query: 356 GLSKSDDFSTLFP-FISKIAKAYFIGNSAMLFFHHFG-GKINSTLSKTLDQALKSVVRDV 413
           G SK      +   + ++I KA+ +G +A +F       ++   +   +  A++    + 
Sbjct: 345 GKSKDGGIEPILSLYANRIRKAFLVGEAADMFAVSLQRARVEHVMCYDVYNAVQIAFAEA 404

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                 + VL SP C+S DQ+ NF ERG +F + V+E+
Sbjct: 405 IASGTKATVLLSPACSSLDQWKNFEERGDAFCAAVAEL 442


>gi|288958921|ref|YP_003449262.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Azospirillum sp.
           B510]
 gi|288911229|dbj|BAI72718.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Azospirillum sp.
           B510]
          Length = 473

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 164/459 (35%), Positives = 227/459 (49%), Gaps = 17/459 (3%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
            R   +AV GLG+SGL+ A AL+DSG  V  WDD+P +   A+  G  V+D      S +
Sbjct: 7   MRELPVAVMGLGKSGLATARALRDSGAEVRVWDDNPASRAAAEAEGFSVVDLATADLSDL 66

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
           + +V SPGI  T    H   + A    +E+I DIEL  R  R       FI +TGTNGKS
Sbjct: 67  TTIVWSPGIPHTFPKPHPVAERARALGIELICDIELLGRAER----DCAFIGITGTNGKS 122

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T  LI H+L   G    +GGN+G P+L  +        V+E SSYQ+ELT +I   I V
Sbjct: 123 TTTTLIGHILAAAGRKAAVGGNLGTPVLTFDPIGAGNACVLEMSSYQLELTHSITFDIAV 182

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNFIG-HSIS 241
           LLNI+PDHL RH  ++ Y+  K  I    T  + A+I ++D  C KI   +   G   I 
Sbjct: 183 LLNITPDHLARHGGMDGYIAAKTLIFHRQTRPRTAVIGVDDEHCRKIHAGLVAAGDQRIW 242

Query: 242 RISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAVVCMQLG 296
            +S+    +   +Y  + +L      E +      T       HN QN   +   C   G
Sbjct: 243 PVSAHGPVA-GGVYAADGWLVDDTEGEAVRVVELSTLPTLLGAHNWQNAAAAFAACKAAG 301

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
           +    I  A+ S  GL HR Q +  L  V F+NDSKATN  +   A L     IYWI GG
Sbjct: 302 IPAPAIVAAMASFPGLAHRQQLVGTLDGVRFVNDSKATNADATEKA-LATFDPIYWILGG 360

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGK-INSTLSKTLDQAL-KSVVRDVE 414
            +K    + L P++ ++  A+ IG +   F      + +  T   TLD A  K+    V 
Sbjct: 361 QAKDTGLNGLEPYMGRVRHAFLIGEAQEQFAAWLDTQSVAYTRCGTLDIATAKAAEMAVA 420

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
                + VL SP CAS+DQ+ NF +RG +F + V  I G
Sbjct: 421 ERLTDACVLLSPACASWDQFANFEKRGEAFAACVVSIIG 459


>gi|146276742|ref|YP_001166901.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166224764|sp|A4WQD2|MURD_RHOS5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|145554983|gb|ABP69596.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 465

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 164/468 (35%), Positives = 236/468 (50%), Gaps = 22/468 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       +AV GLGRSGL+ A AL+  G   + WDD P A   A+  G  V D  RE
Sbjct: 2   IPVRGLEGRKVAVLGLGRSGLATARALQAGGAEPLLWDDSPEARANAEGQGFAVTDLTRE 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSL-QSP- 114
             +  ++ LV SPGI       +  +  A    V +  DI LF R    R + +  Q P 
Sbjct: 62  RAFEDVALLVTSPGIPHLYPAPNPVIARAMAAGVPVDNDIGLFFRSFATRDWDAFDQMPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + VTG+NGKS+T ALI H+L ++G   Q+ GNIG  +L+L+        V+E SSYQ +
Sbjct: 122 VVCVTGSNGKSTTTALIHHILAESGRPTQMAGNIGRGVLDLDPARDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGLYLAGQ 241

Query: 233 MNFIGHS--ISRISS-QSLQS-DSDLYIDESFL----KCSATSEV-IFDFSQETKKHNIQ 283
           ++       + RIS+ Q L+     ++  + FL    K    + + +         HN Q
Sbjct: 242 LSVAPEDDRVIRISAGQKLERFGWAVFARKGFLAEWRKGRQMASIDLRAMPGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL   +I+ AL S  GL HR Q +     V F+NDSKATN+ S   A 
Sbjct: 302 NACAAYAACRTLGLAPRQIEEALGSFKGLPHRSQLVGERNGVRFVNDSKATNVDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    +I WIAGGL K    + L P +  + KAY IG+SA  F     G  +  + +T+D
Sbjct: 361 LQAFPKIRWIAGGLGKDGGIAALRPHLDAVVKAYLIGHSARDFALQM-GATDHEICETMD 419

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +A   VVR  E  Q   +VL +P  ASFDQY NF +RG  FM +V  +
Sbjct: 420 RA---VVRAAEEAQPGEVVLLAPAAASFDQYPNFEKRGEDFMERVKAL 464


>gi|83949453|ref|ZP_00958186.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius
           nubinhibens ISM]
 gi|83837352|gb|EAP76648.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius
           nubinhibens ISM]
          Length = 466

 Score =  249 bits (637), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 167/458 (36%), Positives = 235/458 (51%), Gaps = 24/458 (5%)

Query: 9   HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWSIISF 67
             IAV GLGRSGLSAA AL++ G H I WDD+  A   A   G +V D  R+  +  I+ 
Sbjct: 10  QRIAVLGLGRSGLSAARALREGGAHPICWDDNEAARDIAAGEGFKVSDLSRQGAFDDIAL 69

Query: 68  LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSLQSP--FIAVTGTN 122
           LV SPGI       +  +  A    V +  DI LF R    + F    +P   +AVTG+N
Sbjct: 70  LVTSPGIPHLYPEPNRVIAAALAAGVPVDNDIGLFFRSFAAQGFDEFDTPPRVVAVTGSN 129

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T ALI HVL + G   QL GNIG  +L+++        V+E SSYQ EL   + P 
Sbjct: 130 GKSTTSALIHHVLSEAGRASQLAGNIGRGVLDIDPPEDGGVVVLELSSYQTELARALTPD 189

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGHS- 239
           + V  N+SPDHLDRH  +  Y   K+++ +      A+I +++ +   +A  ++ +G S 
Sbjct: 190 VAVFTNLSPDHLDRHGGMGGYFAAKRRLFSEGGPDRAVIGVDEAEGRFLANQLS-VGPSD 248

Query: 240 --ISRISSQSLQSDS--DLYIDESFLK-----CSATSEVIFDFSQETKKHNIQNLVTSAV 290
             + RISS +  +     ++  + FL        A S  + +       HN QN   +  
Sbjct: 249 DRVIRISSGTKLTGPGWQVFARKGFLSEYRKGRQAGSIDLREIKGLPGAHNHQNACAAYA 308

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C  LGL    I+    S GGL HR Q IA    V F+NDSKATN+ S   A +    RI
Sbjct: 309 ACRALGLAPRVIEAGFASFGGLPHRSQLIAEQNGVSFVNDSKATNVDSAARALMAYG-RI 367

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
            WI GGL K    + L P ++ + KAY IG  A  F     G+  + +  T+++A   V 
Sbjct: 368 RWICGGLQKEGGLAGLAPGLANVVKAYVIGREAAAFALDL-GETETEICTTMERA---VA 423

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           R +E  +    VL +P  ASFDQY+NF +RG  F ++V
Sbjct: 424 RAMEEAEPGDCVLLAPAAASFDQYDNFEQRGDDFTARV 461


>gi|157826844|ref|YP_001495908.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           bellii OSU 85-389]
 gi|157802148|gb|ABV78871.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           bellii OSU 85-389]
          Length = 450

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 158/451 (35%), Positives = 251/451 (55%), Gaps = 27/451 (5%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE--VIDFREIPWSI 64
           +  +I VFGLG++G+S    L+ S  ++IA+DD      + +++  +  +I   +I W  
Sbjct: 5   KKQNIGVFGLGKTGISVYEELQ-SKCNIIAYDDLEVNRNKFEELFSKNYIIPISDIKWQN 63

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
           +  +VLSPGI LT    H  VK+A  FN+ I  DI+LF  + +  +L    +AVTGTNGK
Sbjct: 64  LDKIVLSPGIPLT----HEIVKIAKNFNIPITSDIDLFFEKSKGLNL----LAVTGTNGK 115

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+T ALISH+L  NG D  + GNIG+P+L  +  +    YV+E SS+Q++L  T    I 
Sbjct: 116 STTTALISHILSDNGLDYPIAGNIGVPVLQAK--ASKGGYVLELSSFQLDLVKTFAAKIA 173

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI------AYDMNF 235
           VLLNI+PDHLDRH  +E Y+  K KI   +    + II I++  C +I       + +  
Sbjct: 174 VLLNITPDHLDRHENMEGYITAKSKIFDRMDKDSYGIINIDNDYCHEIFTNLQQKHHIKL 233

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
           I  S+++I  + +   +D+  D  F   S   ++I + S +   HN +N+  S  V   +
Sbjct: 234 IPFSVTKILEKGISIVNDIITDNFFEHISF--KLISNKSLQG-IHNSENIAASYAVARII 290

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL+  +I  ++ S  GL HR+Q +  +  + F NDSKATN  + + + +     IYW+AG
Sbjct: 291 GLEPVKIIESISSFQGLPHRMQYLGNIDDINFYNDSKATNAIAAVQS-IKALDNIYWLAG 349

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV-E 414
           G++K      + P+ SKI KAYF G +  +F +     I+  +   L QA +   +D  +
Sbjct: 350 GIAKEGGIEEIKPYFSKIKKAYFYGQAKEMFANTAKDIIDFVICDDLKQAFELAYKDACK 409

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           + +    +L +P C+S+DQ+ NF ERG  F+
Sbjct: 410 DNEKEKNILLAPCCSSYDQFKNFEERGELFI 440


>gi|260430914|ref|ZP_05784885.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414742|gb|EEX08001.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 464

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 160/471 (33%), Positives = 239/471 (50%), Gaps = 31/471 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFRE- 59
           + +  F    +AV GLGRSGL+ A AL+  G   + WDD+P A + A+  G    D R+ 
Sbjct: 2   IPVKGFSGQKVAVLGLGRSGLATARALRAGGAEPVCWDDNPAARETAEGEGFTCADLRKH 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSLQSP-- 114
             +  I+ L++SPGI       +  V  A    V +  DI L+ R      +++  +P  
Sbjct: 62  EAFDDIASLIVSPGIPHLYPEPNPVVAAALDAGVPVDNDIGLYFRSFAGPEWNNYDTPPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            IAVTG+NGKS+T ALI H+L + G + QL GNIG  +L+++        V+E SSYQ E
Sbjct: 122 VIAVTGSNGKSTTAALIHHILTEAGREAQLAGNIGRGVLDIDPGGDGSVVVLELSSYQTE 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICIND-------HQ 225
           L   + P + V  N+SPDHLDRH  +  Y   K+++ +      A+I +++        Q
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFSEGGPDRAVIGVDEIEGAFLAGQ 241

Query: 226 CEKIAYDMNFIGHSISR-ISSQSLQSDSDLYIDESFLK-----CSATSEVIFDFSQETKK 279
             + A D   I  S++R ++    Q    ++  + FL        A S  + D       
Sbjct: 242 LAEGAGDDRVIRVSVARKLAGPGWQ----VFARKGFLSEYRKGRQAASIDLRDIKGLPGT 297

Query: 280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV 339
           HN QN  ++   C  LGL  + I+ AL S  GL HR Q IA    V F+NDSKATN+ S 
Sbjct: 298 HNHQNACSAYAACRALGLAPKMIEDALHSYPGLPHRSQVIAEANGVTFVNDSKATNVDSA 357

Query: 340 IHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLS 399
           + A L   ++I WI GGL K    + L     ++  AY IG  A  F       + + + 
Sbjct: 358 VKA-LGAFKKIRWICGGLEKEGGIAALNDATDEVLCAYVIGREAAAFAMQL--SVETRVC 414

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            T+ +A++  +RD    +    VL +P  ASFDQY+NF +RG  F++QV +
Sbjct: 415 TTMAEAVEQAMRDAAPGE---TVLLAPAAASFDQYDNFEQRGDDFVAQVKQ 462


>gi|126729249|ref|ZP_01745063.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sagittula stellata
           E-37]
 gi|126710239|gb|EBA09291.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sagittula stellata
           E-37]
          Length = 466

 Score =  245 bits (626), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 170/466 (36%), Positives = 241/466 (51%), Gaps = 20/466 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  F   ++AV GLGRSGL+AA AL+  G  V+ WDD P A   A+  G EV +  RE
Sbjct: 2   IPVQGFEGATVAVLGLGRSGLAAARALRAGGAQVVVWDDTPRARAAAEADGFEVRELNRE 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE--RRFSSLQSP--F 115
             +  ++ LV SPGI       +     A +  V +  DI LF R     F   + P   
Sbjct: 62  SAFDDVACLVTSPGIPHLYPAPNPATAAALKAGVPVDNDIGLFFRSFGADFDRFERPPRV 121

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           +AVTG+NGKS+T ALI H+L  +    QL GNIG  +L+++        V+E SSYQ EL
Sbjct: 122 VAVTGSNGKSTTSALIHHILTASVRSSQLAGNIGRGVLDIDPPEDGGVVVLELSSYQTEL 181

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDM 233
              + P + V  N+SPDHLDRH  L  Y   K+++         +I +++ + + +A  M
Sbjct: 182 ARALTPDVAVFTNLSPDHLDRHGGLGGYFAAKRRLFAEGGPDRCVIGVDEVEGQFLAGQM 241

Query: 234 --NFIGHSISRISSQSLQSDSDL-YIDESFL----KCSATSEV-IFDFSQETKKHNIQNL 285
                   + R+++  L     + +  + FL    K    + V + D +     HN QN 
Sbjct: 242 AEGRADDRVIRVATHKLTGPGWMVFARKGFLSEWRKGRQIASVDLRDVAGLPGAHNHQNA 301

Query: 286 VTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN 345
             +   C  LGL   EI+  L S  GL HR Q IA  G VIF+NDSKATN+ S + A L 
Sbjct: 302 CAAWAACRSLGLGPREIEAGLRSFAGLPHRSQRIAEQGGVIFVNDSKATNVDSALKALLA 361

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA 405
              RI W+ GGL K    + L P ++ +AKAY IG     F    GG + + L  T+DQA
Sbjct: 362 FD-RIRWVCGGLMKEGGLAALEPGLNHVAKAYVIGREPEGFALQLGG-VEAELCGTMDQA 419

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              V R  E+ Q   +VL +P  ASFDQY+NF +RG  F++ V ++
Sbjct: 420 ---VARAAEDAQPGDVVLLAPAAASFDQYDNFEKRGEDFVANVQKV 462


>gi|91205696|ref|YP_538051.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           bellii RML369-C]
 gi|118595687|sp|Q1RI52|MURD_RICBR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|91069240|gb|ABE04962.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia bellii
           RML369-C]
          Length = 450

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 156/451 (34%), Positives = 250/451 (55%), Gaps = 27/451 (5%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE--VIDFREIPWSI 64
           +  +I VFG G++G+S    L+ S  ++IA+DD      + +++  +  +I   +I W  
Sbjct: 5   KKQNIGVFGFGKTGISVYEELQ-SKCNIIAYDDLEVNRNKFEELFSKNYIIPISDIKWQN 63

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
           +  +VLSPGI LT    H  VK+A  FN+ I  DI+LF  + +  +L    +AVTGTNGK
Sbjct: 64  LDKIVLSPGIPLT----HEIVKIAKNFNIPITSDIDLFFEKSKGLNL----LAVTGTNGK 115

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+T ALISH+L  NG D  + GNIG+P+L  +  +    YV+E SS+Q++L  T    I 
Sbjct: 116 STTTALISHILSDNGLDYPVAGNIGVPVLQAK--ASKGGYVLELSSFQLDLVKTFAAKIA 173

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI------AYDMNF 235
           VLLNI+PDHLDRH  +E Y+  K KI   +    + II I++  C +I       + +  
Sbjct: 174 VLLNITPDHLDRHENMEGYITAKSKIFDRMDKDSYGIINIDNDYCHEIFTNLQQKHHIKL 233

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
           I  S+++I  + +   +D+  D  F   S   ++I + S +   HN +N+  S  V   +
Sbjct: 234 IPFSVTKILEKGISIVNDIITDNFFEHISF--KLISNKSLQG-IHNSENIAASYAVARII 290

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL+  +I  ++ S  GL HR+Q +  +  + F NDSKA+N  + + + +     IYW+AG
Sbjct: 291 GLEPVKIIESISSFQGLPHRMQYLGNIDDINFYNDSKASNAIAAVQS-IKALDNIYWLAG 349

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV-E 414
           G++K      + P+ SKI KAYF G +  +F +     I+  +   L QA +   +D  +
Sbjct: 350 GIAKEGGIEEIKPYFSKIKKAYFYGQAKEMFANTAKDIIDFVICDDLKQAFELAYKDACK 409

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           + +    +L +P C+S+DQ+ NF ERG  F+
Sbjct: 410 DNEKEKNILLAPCCSSYDQFKNFEERGELFI 440


>gi|56696080|ref|YP_166434.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Ruegeria
           pomeroyi DSS-3]
 gi|62900661|sp|Q5LU71|MURD_SILPO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|56677817|gb|AAV94483.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ruegeria pomeroyi
           DSS-3]
          Length = 466

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 161/468 (34%), Positives = 237/468 (50%), Gaps = 25/468 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F   ++AV GLGRSGL+ A AL+  G   + WDD+P A + A+  G  + D R+ 
Sbjct: 2   IPVKGFAGANVAVLGLGRSGLATARALRAGGAEALCWDDNPAAREAAEGEGFTIRDLRKQ 61

Query: 61  P-WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
                 + L++SPGI       +  V  A +  V +  DI LF R         F +L  
Sbjct: 62  GVRDDTACLIVSPGIPHLYPAPNPVVAAALEAGVPVDNDIGLFFRSFAGPEWDGFDTLPR 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
             +AVTG+NGKS+T ALI H+L + G  VQL GNIG  +L++E        V+E SSYQ 
Sbjct: 122 -VVAVTGSNGKSTTSALIHHILSEAGRPVQLAGNIGRGVLDIEPGEEGSVVVLELSSYQT 180

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAY 231
           +L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A 
Sbjct: 181 DLARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDESEGLYLAG 240

Query: 232 DMN-------FIGHSISR-ISSQSLQS-DSDLYIDESFLKCSATSEVIFDFSQETKKHNI 282
            M+        I  S+SR ++    Q      Y+ E      A S  + D       HN 
Sbjct: 241 QMSEGPGDDRVIRVSVSRKLTGPGWQVFARKGYLSEYRKGRQAGSIDLRDIRGLPGAHNH 300

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           QN   +   C  LGL  + I+  + S  GL HR Q +A  G V ++NDSKATN+ + + A
Sbjct: 301 QNACAAYAACRALGLSPKAIEAGMRSYPGLPHRSQIVAEAGGVTYVNDSKATNVDAALKA 360

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L   +RI WI GGL K    + L   ++++ KAY IG  A  F      ++ S +  T+
Sbjct: 361 -LGAFKRIRWICGGLQKEGGIAALNGGLAEVLKAYVIGREAAGFALQL--EVESEVCTTM 417

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           D+A   V R +   +    VL +P  ASFDQY+NF  RG  FM++V +
Sbjct: 418 DEA---VARAMAEAEPGDTVLLAPAAASFDQYDNFERRGEDFMAEVQK 462


>gi|126735378|ref|ZP_01751124.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           CCS2]
 gi|126715933|gb|EBA12798.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           CCS2]
          Length = 466

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 158/469 (33%), Positives = 229/469 (48%), Gaps = 24/469 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  +   ++AV GLGRSG +AA AL+  G H + WDD   A + A D+G+ + D  ++
Sbjct: 2   IAVQGYEGKTVAVLGLGRSGRAAAVALEAGGAHPVVWDDSAVAREAADDVGLNLRDLTKL 61

Query: 61  -PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS-----LQSP 114
             +  I+ L++SPGI       +  +  A    V +  DI LF R    +S      Q  
Sbjct: 62  GAFEDIACLIVSPGIPHLYPVPNPVIAAAWDAEVPVDNDIGLFFRSFATASWDDFDTQPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            IAVTG+NGKS+T ALI H+L +NG   QL GNIG  +L++E        V+E SSYQ +
Sbjct: 122 VIAVTGSNGKSTTAALIHHILVENGRPAQLAGNIGRGVLDIEPAHDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L  ++ P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   IA  
Sbjct: 182 LARSMTPDVAVFTNLSPDHLDRHAGVGGYFAAKRRLFAEGGPDRAVIGVDEAEGRYIANQ 241

Query: 233 MNFIGHSISRI----SSQSLQSDS-DLYIDESFLKCSATSEVIFDFSQET-----KKHNI 282
           +   G    R+    S Q L      ++  + FL        +              HN 
Sbjct: 242 L-IEGPGDDRVIRVSSGQKLAGQGWTVFARKGFLSEHRKGRQVGSIDLRVITGLPGAHNH 300

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           QN   +   C  LGL  + I+ A+ S  GL HR Q +A    V F+NDSKATN+ S   A
Sbjct: 301 QNACAAYAACRTLGLGPKGIEAAMQSYPGLPHRSQVVAERDGVTFVNDSKATNVDSAAKA 360

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L    ++ WI GGL K      L P +  +AKAY IG  A  F     G   + +  T+
Sbjct: 361 -LQAFPKVRWICGGLQKEGGLDGLLPHLDHVAKAYVIGREAEDFARQLMGA-EAEVCGTM 418

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           D A+     D    Q   +VL +P  ASFDQY++F  RG  F+  V  +
Sbjct: 419 DVAVSQAAAD---AQAGEVVLLAPAAASFDQYDSFEARGDDFIQNVKAL 464


>gi|126461548|ref|YP_001042662.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|158513433|sp|A3PHS4|MURD_RHOS1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|126103212|gb|ABN75890.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 465

 Score =  243 bits (619), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 163/468 (34%), Positives = 236/468 (50%), Gaps = 22/468 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       +AV GLGRSGL+ A AL+  G   + WDD P A  +A+  G  V D  RE
Sbjct: 2   IPVRGLEGRKVAVLGLGRSGLATARALEAGGAEPLLWDDSPEARAKAEGQGFTVTDLTRE 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSL-QSP- 114
             +  ++ LV SPGI       +  +  A    V +  DI LF R    R + +  Q P 
Sbjct: 62  RAFEGVALLVTSPGIPHLYPAPNPVIARAMAAGVPVDNDIGLFFRSFATRDWDAFDQMPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + VTG+NGKS+T ALI H+L + G   Q+ GNIG  +L+L+        V+E SSYQ +
Sbjct: 122 VVCVTGSNGKSTTTALIHHILSEAGRPTQMAGNIGRGVLDLDPARDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGLYLAGQ 241

Query: 233 MNFIGHS--ISRISS-QSLQS-DSDLYIDESFL----KCSATSEV-IFDFSQETKKHNIQ 283
           ++       + RIS+ Q L+     ++  + FL    K    + + +         HN Q
Sbjct: 242 LSVAPEDDRVIRISAGQKLERFGWSVFARKGFLAEWRKGRQMASIDLRAMPGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL   +I+ AL S  GL HR QT+   G V F+NDSKATN+ S   A 
Sbjct: 302 NACAAYAACRTLGLAPRQIEAALASFAGLPHRSQTVGEKGGVRFVNDSKATNVDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    +I WIAGGL K    + L P +  + KAY IG+SA      F  +I +T  +  +
Sbjct: 361 LQAFPKIRWIAGGLGKDGGIAALQPHLGSVVKAYLIGHSA----RDFALQIGATDHEICE 416

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              ++V R  E  Q   +VL +P  ASFDQY NF +RG  FM +V  +
Sbjct: 417 TMERAVARAAEEAQPGEVVLLAPAAASFDQYPNFEKRGEDFMEKVKAL 464


>gi|332557537|ref|ZP_08411859.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhodobacter
           sphaeroides WS8N]
 gi|332275249|gb|EGJ20564.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhodobacter
           sphaeroides WS8N]
          Length = 465

 Score =  242 bits (618), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 163/468 (34%), Positives = 235/468 (50%), Gaps = 22/468 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       +AV GLGRSGL+ A AL+  G   + WDD P A  +A+  G  V D  RE
Sbjct: 2   IPVRGLEGRKVAVLGLGRSGLATARALEAGGAEPLLWDDSPEARARAEGQGFTVTDLTRE 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSL-QSP- 114
             +  ++ LV SPGI       +  +  A    V +  DI LF R    R + +  Q P 
Sbjct: 62  RAFEGVALLVTSPGIPHLYPAPNPVIARATAAGVPVDNDIGLFFRSFATRDWDAFDQMPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + VTG+NGKS+T ALI H+L + G   Q+ GNIG  +L+L+        V+E SSYQ +
Sbjct: 122 VVCVTGSNGKSTTTALIHHILSEAGRPTQMAGNIGRGVLDLDPARDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGLYLAGQ 241

Query: 233 MNFIGHS--ISRISS-QSLQS-DSDLYIDESFL----KCSATSEV-IFDFSQETKKHNIQ 283
           ++       + RIS+ Q L+     ++  + FL    K    + + +         HN Q
Sbjct: 242 LSVAPEDDRVIRISAGQKLERFGWSVFARKGFLAEWRKGRQMASIDLRAMPGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL   +I+ AL S  GL HR QT+   G V F+NDSKATN+ S   A 
Sbjct: 302 NACAAYAACRTLGLAPRQIEAALASFAGLPHRSQTVGEKGGVRFVNDSKATNVDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    +I WIAGGL K      L P +  + KAY IG+SA      F  +I +T  +  +
Sbjct: 361 LQAFPKIRWIAGGLGKDGGIVALQPHLGSVVKAYLIGHSA----RDFALQIGATDHEICE 416

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              ++V R  E  Q   +VL +P  ASFDQY NF +RG  FM +V  +
Sbjct: 417 TMERAVARAAEEAQPGEVVLLAPAAASFDQYPNFEKRGEDFMEKVKAL 464


>gi|209963948|ref|YP_002296863.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Rhodospirillum centenum SW]
 gi|209957414|gb|ACI98050.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodospirillum
           centenum SW]
          Length = 466

 Score =  242 bits (618), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 157/466 (33%), Positives = 227/466 (48%), Gaps = 21/466 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + LS      IAV GL RSGL+AA AL   G  V+AWDD       A   G+ + D    
Sbjct: 2   IDLSFLAGQRIAVMGLARSGLAAAIALSRGGAEVLAWDDAEAGRTAATAAGLPLTDLHHA 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
             + ++ LVLSPGI  T    H          + +IGD+EL  R R     ++ ++ +TG
Sbjct: 62  DLTGVTALVLSPGIPHTFPAPHPVAARVRAAGIPVIGDVELLRRARP----EATYLGITG 117

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T AL  H+L   G  +Q+GGN+G P+L  E       YV+E SSYQ+ELTP++ 
Sbjct: 118 TNGKSTTTALTGHILAAAGRRLQVGGNLGTPVLTFEPLDAGDVYVLEMSSYQLELTPSLG 177

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH-------AIICINDHQCEKIAYDM 233
                LLNI+PDHLDRH  ++ YV  K+     +         A+I ++D  C  +A  +
Sbjct: 178 FDAAALLNITPDHLDRHGGMDGYVAAKRLAFRPAPSPRPALPVAVIGVDDAHCSAMADAL 237

Query: 234 NF-IGHSISRISSQ-----SLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
               G  + RIS++      + +   + +D+S  +  A  + +        +HN QN   
Sbjct: 238 EAEGGRRVVRISAERAVAGGVSAPDGVLVDDSEGRAVAVLD-LRGCPSLPGRHNWQNACA 296

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +  +    G+  E I  A+ S  GL HR Q +A +  V F+NDSKATN        L   
Sbjct: 297 AYALARAAGVAPEAIASAIRSFAGLAHRQQAVATIDGVRFVNDSKATNA-DAAAKALGCY 355

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGK-INSTLSKTLDQAL 406
             I+WI GG  K      L  F+ ++  A+ IG +   F      + +  T   T++ A+
Sbjct: 356 DAIHWILGGKPKEGGLEGLDAFMPRVRHAFLIGAATEEFASWLAARGVPHTRCGTMETAV 415

Query: 407 KSVVRDVENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +  R       P ++VL SP CASFDQY NF  RG  F   V  +
Sbjct: 416 PTAFRSALAGGEPGAVVLLSPACASFDQYPNFEVRGDHFAKLVQAL 461


>gi|239947262|ref|ZP_04699015.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921538|gb|EER21562.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 453

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 158/460 (34%), Positives = 246/460 (53%), Gaps = 40/460 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S +   I VFGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHKKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTAIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                W  +  +VLSPGI LT    H  VK+A  FN+ I  DI+L   + R  +    FI
Sbjct: 56  LSDSRWQNLDKIVLSPGIPLT----HEIVKIAKNFNIPITSDIDLLFEKSRILN----FI 107

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           AVTGTNGKS+T ALISH+L  NG D  + GNIG+  L  +  +    YV+E SS+Q++L 
Sbjct: 108 AVTGTNGKSTTTALISHILNSNGLDYPVAGNIGVSALRAK--ASKDGYVLELSSFQLDLV 165

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI---- 229
            T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C KI    
Sbjct: 166 KTFTAKIAVLLNITPDHLDRHQDMTGYIAAKSKIFDRMDKKSYAVINIDNDYCRKIFMLL 225

Query: 230 --AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
                +  I  S+++I    +     L +D+       + ++ F+ + +   HN +N+  
Sbjct: 226 QQEQRIKLIPFSVTKILENGI-----LVVDDKIKDNDISYKLSFNKNLQG-LHNYENIAA 279

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           S  V   +G++ ++I  ++ S   L HR+Q I  + ++ F NDSKATN  S + + +   
Sbjct: 280 SYAVAKIIGVEPKKIIESISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKAL 338

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
             IYW+AGG  K      + P+ SKI KAYF G +  +F +     ++  +   L+QA  
Sbjct: 339 DNIYWLAGGTPKGGGIEEIKPYFSKIKKAYFYGQAKEIFANTAKNIVDFVICDDLEQAFD 398

Query: 408 SVVRDV--ENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
              +D   +N ++ +I+L +P C+S+DQ+ NF ERG  F+
Sbjct: 399 LAYKDAIGDNAEVKNILL-APSCSSYDQFKNFEERGELFI 437


>gi|77462655|ref|YP_352159.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           sphaeroides 2.4.1]
 gi|122063256|sp|Q3J4M6|MURD_RHOS4 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|77387073|gb|ABA78258.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           sphaeroides 2.4.1]
          Length = 465

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 162/468 (34%), Positives = 235/468 (50%), Gaps = 22/468 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       +AV GLGRSGL+ A AL+  G   + WDD P A  +A+  G  V D  RE
Sbjct: 2   IPVRGLEGRKVAVLGLGRSGLATARALEAGGAEPLLWDDSPEARAKAEGQGFTVTDLTRE 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSL-QSP- 114
             +  ++ LV SPGI       +  +  A    V +  DI LF R    R + +  Q P 
Sbjct: 62  RAFEGVALLVTSPGIPHLYPAPNPVIARAMAAGVPVDNDIGLFFRSFATRDWDAFDQMPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + VTG+NGKS+T ALI H+L + G   Q+ GNIG  +L+L+        V+E SSYQ +
Sbjct: 122 VVCVTGSNGKSTTTALIHHILSEAGRPTQMAGNIGRGVLDLDPARDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGLYLAGQ 241

Query: 233 MNFIGHS--ISRISS-QSLQS-DSDLYIDESFL----KCSATSEV-IFDFSQETKKHNIQ 283
           ++       + RIS+ Q L+     ++  + FL    K    + + +         HN Q
Sbjct: 242 LSVAPEDDRVIRISAGQKLERFGWSVFARKGFLAEWRKGRQMASIDLRAMPGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  +GL   +I+ AL S  GL HR QT+   G V F+NDSKATN+ S   A 
Sbjct: 302 NACAAYAACRTMGLAPRQIEAALASFAGLPHRSQTVGEKGGVRFVNDSKATNVDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    +I WIAGGL K      L P +  + KAY IG+SA      F  +I +T  +  +
Sbjct: 361 LQAFPKIRWIAGGLGKDGGIVALQPHLGSVVKAYLIGHSA----RDFALQIGATDHEICE 416

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              ++V R  E  Q   +VL +P  ASFDQY NF +RG  FM +V  +
Sbjct: 417 TMERAVARAAEEAQPGEVVLLAPAAASFDQYPNFEKRGEDFMEKVKAL 464


>gi|221638512|ref|YP_002524774.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhodobacter
           sphaeroides KD131]
 gi|254766055|sp|B9KNJ5|MURD_RHOSK RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|221159293|gb|ACM00273.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           sphaeroides KD131]
          Length = 465

 Score =  241 bits (614), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 163/468 (34%), Positives = 235/468 (50%), Gaps = 22/468 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       +AV GLGRSGL+ A AL+  G   + WDD P A  +A+  G  V D  R+
Sbjct: 2   IPVRGLEGRKVAVLGLGRSGLATARALEAGGAEPLLWDDSPEARAKAEGQGFTVTDLTRD 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSL-QSP- 114
             +  ++ LV SPGI       +  +  A    V +  DI LF R    R + +  Q P 
Sbjct: 62  RAFEGVALLVTSPGIPHLYPAPNPVIARAMAAGVPVDNDIGLFFRSFATRDWDAFDQMPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + VTG+NGKS+T ALI H+L + G   Q+ GNIG  +L+L+        V+E SSYQ +
Sbjct: 122 VVCVTGSNGKSTTTALIHHILSEAGRPTQMAGNIGRGVLDLDPARDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGLYLAGQ 241

Query: 233 MNFIGHS--ISRISS-QSLQS-DSDLYIDESFL----KCSATSEV-IFDFSQETKKHNIQ 283
           ++       + RISS Q L+     ++  + FL    K    + + +         HN Q
Sbjct: 242 LSVAPEDDRVIRISSGQKLERFGWSVFARKGFLAEWRKGRQMASIDLRAMPGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL   +I+ AL S  GL HR QT+   G V F+NDSKATN+ S   A 
Sbjct: 302 NACAAYAACRTLGLAPRQIEAALASFAGLPHRSQTVGEKGGVRFVNDSKATNVDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    +I WIAGGL K      L P +  + KAY IG+SA      F  +I +T  +  +
Sbjct: 361 LQAFPKIRWIAGGLGKDGGIVALQPHLGSVVKAYLIGHSA----RDFALQIGATDHEICE 416

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              ++V R  E  Q   +VL +P  ASFDQY NF +RG  FM +V  +
Sbjct: 417 TMERAVARAAEEAQPGEVVLLAPAAASFDQYPNFEKRGEDFMEKVKAL 464


>gi|15604275|ref|NP_220791.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           prowazekii str. Madrid E]
 gi|6225735|sp|Q9ZDC2|MURD_RICPR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|3860967|emb|CAA14867.1| UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE (murD) [Rickettsia
           prowazekii]
 gi|292572022|gb|ADE29937.1| UDP-N-acetylmuramoylalanine--D-glutamateligase [Rickettsia
           prowazekii Rp22]
          Length = 445

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 150/455 (32%), Positives = 245/455 (53%), Gaps = 30/455 (6%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM-GIEVID-FREI 60
           +++++   I +FGLG++G+S    LK+    +I +DD        K++ G  +I    + 
Sbjct: 1   MNAYKKQKIGIFGLGKTGISVYEELKNK-YDLIVYDDLEANRDIFKELFGNNLITVLSDS 59

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            W  +  +VLSPG+ LT    H  V++A+ FN+ II DI+LF  + +       FIA+TG
Sbjct: 60  RWQDLDKIVLSPGVPLT----HEVVRIAHHFNIPIISDIDLFFEKSK----NLKFIAITG 111

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALISH+L  NG D  + GNIG+P L  +  + N  YV+E SS+Q++L  +  
Sbjct: 112 TNGKSTTTALISHILNSNGLDYPVAGNIGVPALQAK--ASNEGYVLELSSFQLDLVKSFT 169

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI------AY 231
             + VLLNI+PDHLDR+  + +Y+  K KI   +    +A+I I++  C KI        
Sbjct: 170 VKVAVLLNITPDHLDRYQDMNDYIAAKAKIFDRMDKDSYAVINIDNDYCRKIFVLLQKDQ 229

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
            +  I  S+++I    +       +D+       T ++  + + +   HN +N+  S  V
Sbjct: 230 SIKLIPFSVTKILKNGIS-----IVDDKIHDNDLTYKLPLNKNLQG-LHNCENIAASYAV 283

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
              +GL+ ++I  ++ S   L HR+Q I  + ++ F NDSKATN  S + + +     IY
Sbjct: 284 AKIIGLESKKILESISSFQSLHHRMQYIGSINNISFYNDSKATNAISALQS-IKALDNIY 342

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           W+AGG+ K      + P+ +KI KAYF G +  +F +     I+  +   L+ A     +
Sbjct: 343 WLAGGIPKEGGIEGIKPYFNKIKKAYFYGQAKAMFANTAKNIIDFVICDNLEYAFNIAYK 402

Query: 412 D-VENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           D V +      +L +P C+S+DQ+ NF ERG  F+
Sbjct: 403 DAVSDTTEVKNILLAPSCSSYDQFKNFEERGELFI 437


>gi|114763027|ref|ZP_01442457.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pelagibaca
           bermudensis HTCC2601]
 gi|114544351|gb|EAU47359.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius sp.
           HTCC2601]
          Length = 467

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 160/467 (34%), Positives = 233/467 (49%), Gaps = 26/467 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR-E 59
           + ++ F   ++AV GLGRSGLSAA AL++ G   + WDD+P A   A+  G E  D   +
Sbjct: 2   IPVTGFNGQTVAVLGLGRSGLSAARALREGGAQALCWDDNPAARAAAEAEGFETRDLSAQ 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL------QS 113
             +  ++ LV+SPGI       +  +  A +  V +  DI LF R   F S       Q 
Sbjct: 62  GGFDGVARLVVSPGIPHLYPAPNPVIAAAWEAGVPVDNDIGLFFRS--FGSGAWEMFDQP 119

Query: 114 P-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
           P  +AVTG+NGKS+T ALI H+L+  G   QL GNIG  +L++E        V+E SSYQ
Sbjct: 120 PKVVAVTGSNGKSTTSALIHHILQSAGRGSQLAGNIGRGVLDIEPPEEGGVVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIA 230
            +L   + P + V  N+SPDHLDRH  L  Y   K+++         +I +++ +   +A
Sbjct: 180 TDLARALTPDVAVFTNLSPDHLDRHGGLGGYFAAKRRLFAEGGPDRCVIGVDEAEGRYLA 239

Query: 231 YDM--NFIGHSISRISSQSLQSDS--DLYIDESFLKCSATSEVI--FDFSQE---TKKHN 281
             +    +   + R+S+    S    D++  + FL        +   D  Q       HN
Sbjct: 240 NQLAEGAVDDRLIRVSAARKLSGPGWDVFARKGFLTEWRKGRQVASIDLRQVRGLPGAHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +      LG+    I+ A  S  GL HR Q +A  G V+++NDSKATN+ + + 
Sbjct: 300 HQNACAAYAAARALGVAPRVIEAAFHSFEGLPHRSQIVADAGGVVYVNDSKATNVDAALK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A L    RI WI GGL K      L P    +AKAY IG  A  F     G + + +   
Sbjct: 360 A-LQAFPRIRWICGGLMKEGGLEALAPGFDHVAKAYVIGREAAGFALGLAG-VEAEVCTD 417

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           +D A+   + D E  +    VL +P  ASFDQY+NF +RG  F ++V
Sbjct: 418 MDTAVARAMADAEPGE---TVLLAPAAASFDQYDNFEQRGDDFAARV 461


>gi|84501752|ref|ZP_00999924.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanicola
           batsensis HTCC2597]
 gi|84390373|gb|EAQ02932.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanicola
           batsensis HTCC2597]
          Length = 475

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 163/472 (34%), Positives = 227/472 (48%), Gaps = 28/472 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       IAV GLGRSGLSAA AL+D G   + WDD+P A  +A+  G  V D  R 
Sbjct: 10  IPVKGVEGQKIAVLGLGRSGLSAARALRDGGAEPLCWDDNPAARDRAEAEGFAVADLTRA 69

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR---ERRFSS--LQSP 114
                +  L++SPGI       +  + LA    V +  DI LF R   +R +    +Q  
Sbjct: 70  ETMESVRSLIVSPGIPHLYPEPNPVIALALDLGVPVDNDIGLFFRSAADRGWGDYDVQPR 129

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            +AVTG+NGKS+T ALI HVL   G D QL GNIG  +L+++        V+E SSYQ +
Sbjct: 130 IVAVTGSNGKSTTSALIHHVLESVGRDTQLAGNIGRGVLDIDPPGDGGVVVLELSSYQTD 189

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N++PDHLDRH  L  Y   K+++        A+I +++ +   +A  
Sbjct: 190 LARALTPDVAVFTNLTPDHLDRHGGLGGYFAAKRRLFAEGGPDRAVIGVDEAEGRYLA-- 247

Query: 233 MNFIGHS-----ISRISS-QSLQSDSDL-YIDESFLKCSATSEVIFDFSQET-----KKH 280
            N +G       + RISS Q L     L Y  + FL        +              H
Sbjct: 248 -NQLGEGPTDDRVIRISSGQKLTGPGWLVYARKGFLTEWRKGRQVGSIDLRAIPGLPGAH 306

Query: 281 NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVI 340
           N QN   +   C  LGL    I+ A  +  GL HR Q +A  G V ++NDSKATN+ +  
Sbjct: 307 NHQNACAAYAACRALGLAPRVIESAFHTFAGLPHRSQIVAERGGVRYVNDSKATNVDAAS 366

Query: 341 HAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSK 400
            A L    R+ WI GGL K      L P    + KAY IG  A  F       +    ++
Sbjct: 367 KA-LRAFDRLRWICGGLEKEGGLEALLPATGSVIKAYVIGREAAAFAM----TLRGVETE 421

Query: 401 TLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
                  +V R     Q    VL +P  ASFDQY++F +RG  F++QV ++P
Sbjct: 422 VCTDMATAVARAAAEAQPGETVLLAPAAASFDQYDSFEKRGEDFVTQVGKLP 473


>gi|56416531|ref|YP_153605.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Anaplasma
           marginale str. St. Maries]
 gi|62900477|sp|Q5PBH9|MURD_ANAMM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|56387763|gb|AAV86350.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Anaplasma
           marginale str. St. Maries]
          Length = 438

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 148/445 (33%), Positives = 232/445 (52%), Gaps = 28/445 (6%)

Query: 16  LGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFREIPWSIISFLVLSPG 73
           +G +G+S  C+L  SG  V+AWDD  C +++ +++  G E +   E  W  IS LVLSPG
Sbjct: 1   MGETGISTVCSLVQSGARVLAWDDDKCVLRKNRELCAGCEFVHPYEYRWDEISELVLSPG 60

Query: 74  IALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISH 133
           +  +  N  W VKLA +    I  D+E+F R R      +  I VTGTNGKS+TV LI  
Sbjct: 61  VPHSRCNESWVVKLAKRAGCHITSDVEIFCRSR-----PARLIGVTGTNGKSTTVELIGW 115

Query: 134 VLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDH 193
           +L + G D + GGNIG  +L+L        Y++E SSYQ+EL   ++  +GV+LNI+P+H
Sbjct: 116 ILNRAGIDSETGGNIGKGVLSLP--QGKAAYILELSSYQLELMRGVNLDVGVILNITPNH 173

Query: 194 LDRHHTLENYVNIKKKIVTMSKHAIICIND----HQCEKIAYDMNF-IGHSISRISSQSL 248
           LD +  + +Y+  K +I+  S   +    D    H CE +   + F  G  ++R  S   
Sbjct: 174 LDVYSNMADYIAAKGRILEFSNLLVANCGDSNTAHLCENVGNMVEFSCGKKLARGVSVL- 232

Query: 249 QSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLS 308
             D  +Y      + +    +  D +      N +N+  S  V   LG+  E I  ++  
Sbjct: 233 --DGRIYFQG---RVAEIGGLKIDSAS-----NAENIAASYAVAKSLGVSDEVIMASIRE 282

Query: 309 CGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFP 368
             GL HR Q +A + +V F+NDSKAT   SV  A ++ +  +YWIAGG SK      +  
Sbjct: 283 FPGLRHRNQVVAEVANVTFVNDSKATTAASVAKALVS-RENVYWIAGGKSKDGGIEPILS 341

Query: 369 -FISKIAKAYFIGNSAMLFFHHFG-GKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSP 426
            + ++I KA+ +G +A +F       ++   +   +  A++    +       + VL SP
Sbjct: 342 LYANRIRKAFLVGEAADMFAVSLQRARVEHVMCYDVYNAVQIAFAEAIASGTKATVLLSP 401

Query: 427 GCASFDQYNNFRERGFSFMSQVSEI 451
            C+S DQ+ NF ERG +F + V+E+
Sbjct: 402 ACSSLDQWKNFEERGDAFCAAVAEL 426


>gi|294085903|ref|YP_003552663.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665478|gb|ADE40579.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 451

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 156/442 (35%), Positives = 226/442 (51%), Gaps = 30/442 (6%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVI--DFREIPWSIISFL 68
           I + GLGRSG++AAC+L  +G    A+DD   +   +       I  D+++  W  +  L
Sbjct: 12  IGLLGLGRSGIAAACSLAAAGAVTYAYDDKTHSDIPSGCTADNFIWQDWQDWSWETLDAL 71

Query: 69  VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTV 128
           V+SPGI       H     A    V II ++EL +R +  + L    IA+TGTNGKS+  
Sbjct: 72  VISPGIPHLHPKPHPAAAKATSMGVPIISEVELALRAKSNARL----IAITGTNGKSTCT 127

Query: 129 ALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLN 188
           AL++H L + G  + +GGNIG    +LE    N + ++E SSYQ+E TP++ P  GV+LN
Sbjct: 128 ALLAHCLTEAGAKIAVGGNIGDAACSLEDPGTNGYIILELSSYQLETTPSLAPDFGVVLN 187

Query: 189 ISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAYDMNFIGHSISRISS 245
           I+PDHLDRH  ++ YV  K+ +VT ++   H I+  +D      AY  +F   +++   +
Sbjct: 188 ITPDHLDRHGGMDGYVAAKQLMVTATRAGGHVILGSDD------AYVRDFANTNVADTVT 241

Query: 246 QSLQSDSDLYIDESFLKCSATSEVIFDFSQETK-KHNIQNLVTSAVVCMQLGLKVEEIKR 304
               + SD                  D S   K  HN QN    A +   LG     I  
Sbjct: 242 VKTVTSSDAPKGR-------------DASPALKGAHNAQNAAAMASIMRLLGYAENMIDA 288

Query: 305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFS 364
            + S  GL HRLQ + + GH+ FINDSKATN  +   A L     IYWIAGGL+K D   
Sbjct: 289 GMASFAGLPHRLQPVGQTGHITFINDSKATNGVAAAKA-LTAFNNIYWIAGGLAKDDGIG 347

Query: 365 TLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLF 424
                +  + KAY IG +A LF     GK  + +   L  A  +   D ++V   + +L 
Sbjct: 348 AAGDALGAVKKAYLIGAAADLFAGQLDGKCATEIHHDLTSATYAAFADAQSVSHTAHILL 407

Query: 425 SPGCASFDQYNNFRERGFSFMS 446
           SP  ASFDQ+++F  RG +F +
Sbjct: 408 SPAAASFDQFDSFEARGDAFTT 429


>gi|149202237|ref|ZP_01879210.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius sp.
           TM1035]
 gi|149144335|gb|EDM32366.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius sp.
           TM1035]
          Length = 469

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 160/472 (33%), Positives = 231/472 (48%), Gaps = 24/472 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +    +AV GLGRSGLSAA AL+     V+AWDD   A   A   G  ++D  R 
Sbjct: 2   VPVRGYAGAKVAVLGLGRSGLSAARALRAGHAEVLAWDDSETARDTAAAEGFAIVDLARA 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS-----LQSP 114
             +  ++ L++SPGI       +  +  A +  V +  DI LF R           +   
Sbjct: 62  GAFDGVAALIVSPGIPHLYPVPNRVIAAAQEAGVPVDNDIGLFFRSLATDDWDGFDVTPK 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            IAVTG+NGKS+T ALI HVL + G   QL GNIG  +L+++    +   V+E SSYQ +
Sbjct: 122 VIAVTGSNGKSTTSALIHHVLTEAGRAAQLAGNIGRGVLDIDPPEDSGVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  L  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGLGGYFAAKRRLFAEGGPDRAVIGVDEAEGRYLAGQ 241

Query: 233 MNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEV----------IFDFSQETKKHNI 282
           M   G +  R+   S+      +    F +    SE           + +       HN 
Sbjct: 242 MAE-GPNDDRVIRISVDRKLSGFGWSVFARKGFLSEYRHGRQVGSIDLREVKGLPGSHNH 300

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           QN   +   C  LGL    I+    S  GL HR Q +A    VIF+NDSKATN+ S + A
Sbjct: 301 QNACAAYAACRTLGLAPRVIEAGFHSYAGLPHRSQRVAEKDGVIFVNDSKATNVDSALKA 360

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L     I WI GGL K      L P ++ + +AY IG  A  F     G +++ +  T+
Sbjct: 361 LLAFD-NIRWICGGLEKDGGLGGLAPGLAHVRRAYVIGREAAQFAIGL-GAVDTEVCTTM 418

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
            +A+   VRD E      +VL +P  ASFDQY+NF +RG  FM+QV  + G+
Sbjct: 419 SEAVARAVRDAEP---GDVVLLAPAAASFDQYDNFEKRGEDFMAQVRALLGV 467


>gi|126741293|ref|ZP_01756971.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           SK209-2-6]
 gi|126717611|gb|EBA14335.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           SK209-2-6]
          Length = 465

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 161/461 (34%), Positives = 237/461 (51%), Gaps = 23/461 (4%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWS 63
            +    +AV GLGRSGL+ A AL++ G   I WDD+P A + A+  G    D  ++  + 
Sbjct: 6   GYNGAKVAVLGLGRSGLTTARALREGGAEPICWDDNPAAREAAEAEGFTCRDLHKQGGFE 65

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSLQSP--FIAV 118
            I+ LV SPGI       +  ++ A +  V +  DI LF      + +  +  P   +A+
Sbjct: 66  DIAALVTSPGIPHLYPQPNPVIRSALEAGVPVDNDIGLFFASFAHQGWDMMDQPPKVVAI 125

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+TVAL+ H+L   G D Q+ GNIG  +L+++  +     V+E SSYQ EL   
Sbjct: 126 TGSNGKSTTVALLHHILESVGRDSQMAGNIGRGVLDIDPPADGGVVVLELSSYQTELARA 185

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMN-- 234
           + P + +L N+S DHL+RH  L  Y   K+++        AII I++ +   +A  ++  
Sbjct: 186 LTPDVAILTNLSEDHLERHAGLGGYFAAKRRLFAEGGPDRAIIGIDEDEGLFLAGQLSQA 245

Query: 235 FIGHSISRISSQSLQSDS--DLYIDESFLKCSATSEVI--FDFSQET---KKHNIQNLVT 287
            +   + RIS++   +     ++  + FL        +   D  Q T    +HN QN   
Sbjct: 246 AVDDRVIRISAKKKLTGPGWQIFARKGFLSEYRKGRQVASIDLRQMTGLPGEHNHQNACA 305

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +      LGL    I++AL S  GL HR QTIA    V ++NDSKATNL S I A L+  
Sbjct: 306 AYAAARVLGLAPRVIEQALDSYPGLPHRSQTIAEAAGVRYVNDSKATNLDSAIKA-LSAF 364

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
            +I WI GGL K    S L      + KAY IG  A  F       + + +  T++QA  
Sbjct: 365 PKIRWICGGLEKEGGLSALQGQTKNVQKAYVIGREAAGFAMQL--DVEAEVCTTMEQA-- 420

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
            V R +E+ Q    VL +P  ASFDQY+NF +RG  F +QV
Sbjct: 421 -VARAMEDAQSGETVLLAPAAASFDQYDNFEQRGDDFAAQV 460


>gi|67459026|ref|YP_246650.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           felis URRWXCal2]
 gi|75536538|sp|Q4ULT8|MURD_RICFE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|67004559|gb|AAY61485.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia felis
           URRWXCal2]
          Length = 449

 Score =  236 bits (603), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 156/460 (33%), Positives = 241/460 (52%), Gaps = 40/460 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S     I VFGLG++G+S    L+     VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQ-GKCDVIVYDD----LKANRDIFEELYTNNSIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                W  +  +VLSPGI LT    H    +A  FN+ II DI+L   + +       FI
Sbjct: 56  LSDSRWQNLDKIVLSPGIPLT----HKIAGIAKNFNIPIISDIDLLFEKSK----NLNFI 107

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           AVTGTNGKS+T ALISH+L  NG D  + GNIG+P L  +  +    Y++E SS+Q++L 
Sbjct: 108 AVTGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALQAK--ASKDGYILELSSFQLDLV 165

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI---- 229
            T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A I I+++ C +I    
Sbjct: 166 KTFTAKIAVLLNITPDHLDRHQDMTGYIAAKSKIFDRMDKDSYAAINIDNYYCREIFMLL 225

Query: 230 --AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
                +  I  S+++I    +    D   D        + ++ F+ + +   HN +N+  
Sbjct: 226 QQEQRIKLIPFSVTKILKNGISVVGDKINDNDI-----SYKLPFNKNLQG-THNCENIAA 279

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           S  V   +G++ ++I  ++ S   L HR+Q I  + ++ F NDSKATN  S + + +   
Sbjct: 280 SYAVAKIIGVESKKILESISSFQSLPHRMQYIGSINNIGFYNDSKATNAISAVQS-IKAL 338

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
             IYW+AGG+ K      + P+ SKI KAYF G +  +F       ++  +   L+QA  
Sbjct: 339 DNIYWLAGGIPKEGGIEEIKPYFSKIKKAYFYGQAKEIFAKTAKNIVDFVICDNLEQAFD 398

Query: 408 SVVRDV--ENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
              +D   +N ++ +I+L +P C+S+DQ+ NF ERG  FM
Sbjct: 399 LAYKDAVGDNAEVKNILL-APSCSSYDQFKNFEERGELFM 437


>gi|83312945|ref|YP_423209.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Magnetospirillum magneticum AMB-1]
 gi|118595663|sp|Q2W0H5|MURD_MAGSA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|82947786|dbj|BAE52650.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Magnetospirillum
           magneticum AMB-1]
          Length = 457

 Score =  236 bits (601), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 148/457 (32%), Positives = 231/457 (50%), Gaps = 29/457 (6%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
            +   + V GLG+SG + A AL  +G  V+AWDD   A K   + GI + D   +P    
Sbjct: 7   LKGKRVLVMGLGKSGTATARALLAAGAGVMAWDDGEAARKSGAEAGIPIRDPSLLPLDKA 66

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             LV SPGI  T    H   + A   N+ ++ D+EL  +    + +    +AVTGTNGKS
Sbjct: 67  DLLVWSPGIPHTHPQPHPLAEKARAANLPMVCDVELLAQALPGARM----LAVTGTNGKS 122

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T  L++HVL + G  V  GGN+G   L+L     +  YV+E SSYQ+ELT ++   + +
Sbjct: 123 TTTTLLAHVLDECGLPVAAGGNLGTAALDLPELPGDGRYVLELSSYQLELTHSLKLGVAI 182

Query: 186 LLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           LLN++PDHL RH  +  Y+  K+++   +T    A++ I+D  C  I  +++  G  + +
Sbjct: 183 LLNVTPDHLGRHGGMAGYIAAKRRVFDFLTPGGAAVVGIDDGPCRAIVAELDRRGIRVVK 242

Query: 243 ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET----------KKHNIQNLVTSAVVC 292
           IS  S+ ++            SA   V+ D ++             +HN QN        
Sbjct: 243 ISVDSVLAEG----------VSAPEGVLLDNAKPVCDLKTIPSLPGRHNWQNACAVYAAA 292

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
              GL  ++I +AL +  GL HR + +     + +INDSKATN  +V  A +     +YW
Sbjct: 293 RAEGLSPKQIAQALATYPGLAHRQELVGEDHGIAWINDSKATNADAVEKALVCYD-HVYW 351

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           I GG +K    ++L     +I  A+ IG +   F     GK+  T   TLD+A+ +    
Sbjct: 352 ILGGQAKEGGIASLEKHFGRIQHAFLIGEATEAFAATLDGKVRFTRCATLDKAVAAARNL 411

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERGFSFMSQV 448
             +  +P ++VL SP CAS+DQ+ +F  RG +F   V
Sbjct: 412 AVSDSIPGAVVLLSPACASWDQFTSFEHRGDTFRELV 448


>gi|58038641|ref|YP_190605.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Gluconobacter
           oxydans 621H]
 gi|58001055|gb|AAW59949.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Gluconobacter
           oxydans 621H]
          Length = 476

 Score =  236 bits (601), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 154/442 (34%), Positives = 220/442 (49%), Gaps = 38/442 (8%)

Query: 12  AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLS 71
           AV GLGR+G +   AL   G  V AWDD    +    ++ +  +       S ++ L+LS
Sbjct: 43  AVCGLGRNGTAVVQALLGMGAEVQAWDDRNADLPAQPNLTVAPL----TDLSGMTALILS 98

Query: 72  PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALI 131
           PGI      AH    LA    ++I+ D E+  R  R S  ++ FIAVTGTNGKS+T ALI
Sbjct: 99  PGIPHLLPKAHPVADLARAQGIQILSDAEILYRAVRKSGSKAAFIAVTGTNGKSTTTALI 158

Query: 132 SHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISP 191
           +H+    G     GGN+G   L L     +  YVIE SSY +E       +   LLN++P
Sbjct: 159 AHLFTTAGRPCAAGGNLGTASLALPLLPDDGVYVIEMSSYMLERLDRFHANAACLLNLTP 218

Query: 192 DHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSL 248
           DHLDRH  +  Y   K  +   +     A+I ++D  C  IA          S+++S+ +
Sbjct: 219 DHLDRHGDMAGYAAAKAHVFDNMGPDDLAVIGMDDDWCRAIA----------SQVASRGV 268

Query: 249 QSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLS 308
           Q           ++  A +   +D      +HN QN+  +  +   LGL    I+  L S
Sbjct: 269 Q----------VVELDADALPPYDGPALPGRHNAQNVGAALTIASHLGLDEAAIRTGLKS 318

Query: 309 CGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFP 368
             GL HRLQ +A    V FINDSKATN  +V  A L    ++ WIAGG++K+    +L P
Sbjct: 319 FPGLEHRLQKVAECDGVSFINDSKATNAEAVSKA-LAAYDKVMWIAGGVAKAGGIESLAP 377

Query: 369 FISKIAKAYFIGN-----SAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
           F   IA+A+ IG      +A L  H    +   TL K +  A K+ +   EN+    +VL
Sbjct: 378 FFRHIAQAFLIGQDADVLAATLETHGVPFQQCGTLEKAVPAAFKAALD--ENI---PVVL 432

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            SP CASFDQ+ +F +RG  F+
Sbjct: 433 LSPACASFDQFRSFEDRGSHFL 454


>gi|62900456|sp|Q5FUJ7|MURD_GLUOX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
          Length = 448

 Score =  236 bits (601), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 154/442 (34%), Positives = 220/442 (49%), Gaps = 38/442 (8%)

Query: 12  AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLS 71
           AV GLGR+G +   AL   G  V AWDD    +    ++ +  +       S ++ L+LS
Sbjct: 15  AVCGLGRNGTAVVQALLGMGAEVQAWDDRNADLPAQPNLTVAPL----TDLSGMTALILS 70

Query: 72  PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALI 131
           PGI      AH    LA    ++I+ D E+  R  R S  ++ FIAVTGTNGKS+T ALI
Sbjct: 71  PGIPHLLPKAHPVADLARAQGIQILSDAEILYRAVRKSGSKAAFIAVTGTNGKSTTTALI 130

Query: 132 SHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISP 191
           +H+    G     GGN+G   L L     +  YVIE SSY +E       +   LLN++P
Sbjct: 131 AHLFTTAGRPCAAGGNLGTASLALPLLPDDGVYVIEMSSYMLERLDRFHANAACLLNLTP 190

Query: 192 DHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSL 248
           DHLDRH  +  Y   K  +   +     A+I ++D  C  IA          S+++S+ +
Sbjct: 191 DHLDRHGDMAGYAAAKAHVFDNMGPDDLAVIGMDDDWCRAIA----------SQVASRGV 240

Query: 249 QSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLS 308
           Q           ++  A +   +D      +HN QN+  +  +   LGL    I+  L S
Sbjct: 241 Q----------VVELDADALPPYDGPALPGRHNAQNVGAALTIASHLGLDEAAIRTGLKS 290

Query: 309 CGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFP 368
             GL HRLQ +A    V FINDSKATN  +V  A L    ++ WIAGG++K+    +L P
Sbjct: 291 FPGLEHRLQKVAECDGVSFINDSKATNAEAVSKA-LAAYDKVMWIAGGVAKAGGIESLAP 349

Query: 369 FISKIAKAYFIGN-----SAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
           F   IA+A+ IG      +A L  H    +   TL K +  A K+ +   EN+    +VL
Sbjct: 350 FFRHIAQAFLIGQDADVLAATLETHGVPFQQCGTLEKAVPAAFKAALD--ENI---PVVL 404

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            SP CASFDQ+ +F +RG  F+
Sbjct: 405 LSPACASFDQFRSFEDRGSHFL 426


>gi|260576888|ref|ZP_05844871.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodobacter sp.
           SW2]
 gi|259020925|gb|EEW24238.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Rhodobacter sp.
           SW2]
          Length = 466

 Score =  235 bits (600), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 154/475 (32%), Positives = 231/475 (48%), Gaps = 32/475 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +    +AV GLGRSGL+ A AL   G   + WDD P +  +A+  G    D  R 
Sbjct: 2   IPVQGYEGRKVAVLGLGRSGLATARALLAGGAEPLLWDDSPESRAKAEAEGFSCTDLTRA 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP----- 114
             +  ++ L+ SPGI       +  +  A +  V +  DI LF     F S  +P     
Sbjct: 62  QAFDGVAALITSPGIPHLYPAPNKVIARAYEAGVPVDNDIGLF-----FRSFATPDWDNF 116

Query: 115 -----FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECS 169
                 + VTG+NGKS+T ALI H+L   G   Q+ GNIG  +L+++        V+E S
Sbjct: 117 ETAPRVVCVTGSNGKSTTTALIHHILEVAGRPTQMAGNIGRGVLDIDPAVDGEVVVLELS 176

Query: 170 SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCE 227
           SYQ +L   + P + V  N+SPDHLDRH+ +  Y   K+++        A+I +++ +  
Sbjct: 177 SYQTDLARALTPDVAVFTNLSPDHLDRHNGMGGYFAAKRRLFAEGGPDRAVIGVDEVEGR 236

Query: 228 KIAYDM--NFIGHSISRISSQSLQSD--SDLYIDESFLK-----CSATSEVIFDFSQETK 278
            +A  +        + RISS +   +    ++  + FL          S  +   +    
Sbjct: 237 YLAGQLAEGAADDRVIRISSGTKLEEFAWSVFARKGFLAEWRRGKQVASIDLRGVAGLPG 296

Query: 279 KHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHS 338
            HN QN   +   C  LG+  + I++A  S  GL HR QT+     V F+NDSKATN+ S
Sbjct: 297 AHNHQNACAAYAACRSLGVGPKLIEQAFHSFAGLPHRSQTVGEKAGVRFVNDSKATNVDS 356

Query: 339 VIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL 398
              A L    RI WIAGG+ K      L P +  +AKAY IG+SA  F     G     +
Sbjct: 357 AAKA-LQAFPRIRWIAGGMGKDGGIKALVPHLGSVAKAYLIGHSARDFALEL-GATPYEI 414

Query: 399 SKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
            +T+++A+ +  RD    Q   +VL +P  ASFDQY NF +RG  F ++V  + G
Sbjct: 415 CETMERAVAAATRD---AQAGEVVLLAPAAASFDQYPNFEKRGEDFTARVQALIG 466


>gi|326388916|ref|ZP_08210498.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206516|gb|EGD57351.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 452

 Score =  235 bits (600), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 152/454 (33%), Positives = 220/454 (48%), Gaps = 35/454 (7%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFREIP 61
           S F     AV GL RSGL++A +L   G  V  WD  + P A  + +     ++D   I 
Sbjct: 5   SRFAGQRYAVLGLARSGLASAESLLAGGAEVTVWDSREEPRAAFEGR---ATIVDPLTID 61

Query: 62  WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            +  + +V+SPG+ L   N H     A    V +IGDIELF   R         + +TGT
Sbjct: 62  LTGFAGVVVSPGVPL---NRHPITAHAAAHGVPVIGDIELFAAIRPELPPHR-VVGITGT 117

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+T AL+ H+ R+ G+  ++GGNIGLP+L  E       YV+E SSYQI+LT +++ 
Sbjct: 118 NGKSTTTALVHHICREAGFPARMGGNIGLPVLGEEALPAGGVYVLELSSYQIDLTYSLEA 177

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAYDMNFIGH 238
            +  L+NISPDHLDR+     Y   K ++  M +   HA+    D        D   I  
Sbjct: 178 DVAALINISPDHLDRYDGFAGYAASKARLFAMQRPDQHAVFGTGD-------ADTGAIAD 230

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLK 298
           +++ +         D     + L   A      D+      HN+QN   +  +   LG+ 
Sbjct: 231 AVAHVREARFVHRPD----PALLSGQA------DWPSLQGPHNLQNAAIAVAIAEALGIA 280

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLS 358
               + AL S  GL HR++ +  +  V+F+NDSKATN  S   A L    RI+WI GG+ 
Sbjct: 281 EAVWRPALASFVGLPHRMERVVEVDGVLFVNDSKATNPASTAPA-LAAYPRIHWICGGVP 339

Query: 359 KSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQL 418
           K DD     P+   + +AY IG +   F       +    S+ L  A    VRD      
Sbjct: 340 KGDDLDDCAPWFDHVVEAYTIGEAGPRFAEILRDHVPVRRSEMLCDA----VRDAMAAAK 395

Query: 419 PS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           P  +V+ SP CASFDQ+ +F  RG +F   V+ +
Sbjct: 396 PGDVVMLSPACASFDQFRDFEARGDAFREIVAAL 429


>gi|157803837|ref|YP_001492386.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           canadensis str. McKiel]
 gi|157785100|gb|ABV73601.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           canadensis str. McKiel]
          Length = 455

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 161/464 (34%), Positives = 244/464 (52%), Gaps = 44/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           + S     I +FGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MHSHTKQKIGIFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELFGKNLIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                W  +  +VLSPG+ LT    H  V++A+ FN+ I  DI+L   + R       FI
Sbjct: 56  LSDSRWQNLDKIVLSPGVPLT----HEIVRIAHHFNISITSDIDLLFEKSR----NLNFI 107

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           AV GTNGKS+T ALISH+L  NG D  + GNIG+P L  +  +    YVIE SS+Q++L 
Sbjct: 108 AVIGTNGKSTTTALISHILNSNGLDYPVAGNIGVPALKAK--NSKDGYVIELSSFQLDLV 165

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT-MSK--HAIICINDHQCEKIAYDM 233
            T    I VLLNI+PDHLDRH  +  Y+  K KI   M K  +A+I I++  C KI   +
Sbjct: 166 KTFTAKIAVLLNITPDHLDRHKDMNGYIKAKSKIFNRMDKNSYAVINIDNDYCRKIFMKL 225

Query: 234 N------FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK-HNIQNLV 286
                   I  S+++I  + +   +++ I+ SF      S     F++  +  HN +N+ 
Sbjct: 226 QQEQRIKLIPFSVTKILEKGISVVNNI-INYSFF---GNSNFKLPFNKNLQGIHNCENIA 281

Query: 287 TSAVVCMQLGL-KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN 345
            S  V   +GL +  +I  A+ S   L HR+Q I  + ++ F NDSKATN  S + + + 
Sbjct: 282 ASYAVAKIMGLEESTKIIEAISSFQSLPHRMQYIGSINNISFYNDSKATNAISALQS-IK 340

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKIN----STLSKT 401
               IYW+AGG+ K      + P++++I KAYF G +  +F       ++    + L + 
Sbjct: 341 ALDNIYWLAGGIPKEGGIKEIMPYLNRIKKAYFYGQAKEMFADTVKNIVDFVICNDLKQV 400

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
            D A K  V D   V+    +L +P C+S+DQ+ NF ERG  F+
Sbjct: 401 FDLAYKDAVGDTAAVKN---ILLAPSCSSYDQFKNFEERGELFI 441


>gi|56551725|ref|YP_162564.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|62900668|sp|Q5NPA7|MURD_ZYMMO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|56543299|gb|AAV89453.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 441

 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 159/454 (35%), Positives = 228/454 (50%), Gaps = 42/454 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI- 64
           F     AV GL RSG++   AL  S   V+AWD++P    + +    E ID   +  S  
Sbjct: 7   FSGQFYAVLGLARSGMATVAALLASDAKVMAWDNNPETRDRLQQQYQEAIDKGRLVISDP 66

Query: 65  -------ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRF---SSLQSP 114
                  IS  V+SPGI +   N H    LA +  + IIGDIELF +   F      + P
Sbjct: 67  MIADIFGISAFVVSPGIPI---NRHPIAALAKERGIPIIGDIELFAQAHGFWERHGRRCP 123

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + +TGTNGKS+T ALI H+L++ G    +GGNIGLP+L  +       YV+E SSYQI+
Sbjct: 124 VVGITGTNGKSTTTALIHHILKEAGLPTLMGGNIGLPLLAADPLPDGGVYVLELSSYQID 183

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAY 231
           LT T+D  I VL NI+PDHLDRH   E Y   K+++  +     +A+I  +D   + IA 
Sbjct: 184 LTFTLDCDIAVLTNITPDHLDRHGGFEGYRKAKERLFLLQSSPHYAVIATDDIPSQVIA- 242

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
                         QS      ++ D      SA  +V  ++      HN QN V +  V
Sbjct: 243 -------------KQSAAHLVTVHAD----NISAEDQV--NWPNLQGPHNAQNAVLAMAV 283

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
              LG+  + I +AL+S  GL HR+Q I     V+FI+DSKATN  +   A       I+
Sbjct: 284 AHILGISDDVISKALISYAGLPHRMQKIGERRGVLFIDDSKATNAMATAPALAAFP-AIH 342

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF-GGKINSTLSKTLDQALKSVV 410
           WI GG+ K+ D      F + I +AY IG +   +        +N     TL++A++   
Sbjct: 343 WILGGVPKTADLDPCKAFYNHIRQAYTIGQAGPDYAQLLREAGVNVVECGTLEKAVRLA- 401

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
              E  Q   +V+ +P CASFDQ++++  RG +F
Sbjct: 402 --AEEAQPDEVVMLTPACASFDQFSDYEARGQAF 433


>gi|260752700|ref|YP_003225593.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552063|gb|ACV75009.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 441

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 159/454 (35%), Positives = 227/454 (50%), Gaps = 42/454 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI- 64
           F     AV GL RSG++   AL  S   V+AWD++P    + +    E ID   +  S  
Sbjct: 7   FSGQFYAVLGLARSGMATVSALLASDAKVMAWDNNPETRDRLQQQYQEAIDKGRLVISDP 66

Query: 65  -------ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS---P 114
                  IS  V+SPGI +   N H    LA +  + IIGDIELF +   F        P
Sbjct: 67  MIADIFGISAFVVSPGIPI---NRHPIAALAKERGIPIIGDIELFAQAHGFWERHGRCCP 123

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + +TGTNGKS+T ALI H+L++ G    +GGNIGLP+L  +       YV+E SSYQI+
Sbjct: 124 VVGITGTNGKSTTTALIHHILKEAGLPTLMGGNIGLPLLAADPLPDGGVYVLELSSYQID 183

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAY 231
           LT T+D  I VL NI+PDHLDRH   E Y   K+++  +     +A+I  +D   + IA 
Sbjct: 184 LTFTLDCDIAVLTNITPDHLDRHGGFEGYRKAKERLFLLQSSPHYAVIATDDIPSQVIA- 242

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
                         QS      ++ D      SA  +V  ++      HN QN V +  V
Sbjct: 243 -------------KQSAAHLVAVHAD----NISAEDQV--NWPNLQGPHNAQNTVLAMAV 283

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
              LG+  + I +AL+S  GL HR+Q I     V+FI+DSKATN  +   A       I+
Sbjct: 284 AHILGISDDVISKALISYAGLPHRMQKIGERRGVLFIDDSKATNAMATAPALAAFP-AIH 342

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF-GGKINSTLSKTLDQALKSVV 410
           WI GG+ K+ D      F + I +AY IG +   +        +N     TL++A++   
Sbjct: 343 WILGGVPKTADLDPCKAFYNHIRQAYTIGQAGPDYAQLLREAGVNVVECGTLEKAVRLA- 401

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
              E  Q   +V+ +P CASFDQ++++  RG +F
Sbjct: 402 --AEEAQPDEVVMLTPACASFDQFSDYEARGQAF 433


>gi|241762283|ref|ZP_04760364.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241373186|gb|EER62816.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 441

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 228/454 (50%), Gaps = 42/454 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI- 64
           F     AV GL RSG++   AL  S   V+AWD++P    + +    E ID   +  +  
Sbjct: 7   FSGQFYAVLGLARSGMATVAALLASDAKVMAWDNNPETRDRLQQQYQEAIDKGRLVIADP 66

Query: 65  -------ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRF---SSLQSP 114
                  IS  V+SPGI +   N H    LA +  + IIGDIELF +   F      + P
Sbjct: 67  MIADIFGISAFVVSPGIPI---NRHPIAALAKERGIPIIGDIELFAQAHGFWERHGRRCP 123

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + +TGTNGKS+T ALI H+L++ G    +GGNIGLP+L  +       YV+E SSYQI+
Sbjct: 124 VVGITGTNGKSTTTALIHHILKEAGLPTLMGGNIGLPLLAADPLPDGGVYVLELSSYQID 183

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAY 231
           LT T+D  I VL NI+PDHLDRH   E Y   K+++  +     +A+I  +D   + IA 
Sbjct: 184 LTFTLDCDIAVLTNITPDHLDRHGGFEGYRKAKERLFLLQSSPHYAVIATDDIPSQVIA- 242

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
                         QS      ++ D      + ++E   ++      HN QN V +  V
Sbjct: 243 -------------KQSAAHLVTVHAD------NISAEDQINWPNLQGPHNAQNAVLAMAV 283

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
              LG+  + I +AL+S  GL HR+Q I     V+FI+DSKATN  +   A       I+
Sbjct: 284 AHILGISDDVISKALVSYAGLPHRMQKIGERRGVLFIDDSKATNAMATAPALAAFP-AIH 342

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF-GGKINSTLSKTLDQALKSVV 410
           WI GG+ K+ D      F + I +AY IG +   +        +N     TL++A++   
Sbjct: 343 WILGGVPKTADLDPCKAFYNHIRQAYTIGQAGPDYAQLLREAGVNVVECGTLEKAVRLA- 401

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
              E  Q   +V+ +P CASFDQ++++  RG +F
Sbjct: 402 --AEEAQPDEVVMLTPACASFDQFSDYEARGQAF 433


>gi|87199153|ref|YP_496410.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|118595671|sp|Q2G997|MURD_NOVAD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|87134834|gb|ABD25576.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 443

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 151/444 (34%), Positives = 218/444 (49%), Gaps = 31/444 (6%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
           +F     AV GL RSGL++  +L   G  V  WD+     + A +    + D   I  + 
Sbjct: 6   AFAGKRYAVLGLARSGLASVESLLAGGADVTVWDNRE-EPRSAFEGSCTIADPLSIDLTG 64

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
            + +V+SPG+ L   N H     A    V +IGDIELF + R         + +TGTNGK
Sbjct: 65  FAGVVVSPGVPL---NRHPIADHARAAGVPVIGDIELFAQARADLPPHR-VVGITGTNGK 120

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+T  L+ H+    G   +LGGNIGLPIL  E       YV+E SSYQI+LT ++   + 
Sbjct: 121 STTTMLVHHICAAAGLPARLGGNIGLPILGQEPLPEGGVYVLELSSYQIDLTQSLACDVA 180

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAII-CINDHQCEKIAYDMNFIGHSI 240
            L+N+SPDHLDR+     Y   K ++  M +   HA+  C ++H  E            I
Sbjct: 181 ALINLSPDHLDRYDGFAGYAASKARLFAMQRADQHAVFGCGDEHTLE------------I 228

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
           +R +S +  +     +  S L          ++      HN+QN   +  +  QLG+  +
Sbjct: 229 AREASATHDTGFVHVVQPSALHGQ------LEWPSLQGPHNLQNAAIAVEIARQLGIAED 282

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
             + AL S  GL HR++ +A    V+F+NDSKATN  S   A L    RI+WI GGL KS
Sbjct: 283 IWRSALASFVGLPHRMERVAEANGVLFVNDSKATNPASTAPA-LGAYPRIHWILGGLPKS 341

Query: 361 DDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420
           D+     P+   +  AY IG +   F       +  T S+ L  A++     +E  Q   
Sbjct: 342 DNLDECAPYFDHVVAAYTIGEAGPRFAEILEPVMPVTRSEMLCDAVRQA---MEAAQPGD 398

Query: 421 IVLFSPGCASFDQYNNFRERGFSF 444
           +V+ SP CASFDQ+ +F  RG SF
Sbjct: 399 VVMLSPACASFDQFRDFEARGDSF 422


>gi|85707193|ref|ZP_01038279.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius sp.
           217]
 gi|85668247|gb|EAQ23122.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseovarius sp.
           217]
          Length = 465

 Score =  233 bits (593), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 161/462 (34%), Positives = 228/462 (49%), Gaps = 24/462 (5%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWS 63
            +    +AV GLGR+GLSAA AL+  G  V+AWDD   A   A+  G  ++D  R     
Sbjct: 6   GYSEAKVAVLGLGRTGLSAARALRAGGAEVLAWDDTETARVAAEAEGFAIVDLSRAGALD 65

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS-----LQSPFIAV 118
            ++ L++SPGI       +  +  A    V +  DI LF R           +    IAV
Sbjct: 66  RVASLIVSPGIPHLYPAPNRVIVAAQAAGVPVDNDIGLFFRSLATDDWGGFDVTPKVIAV 125

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+T ALI HVL + G   QL GNIG  +L+++        V+E SSYQ +L   
Sbjct: 126 TGSNGKSTTSALIHHVLVEAGRTAQLAGNIGRGVLDIDPPEDGGVVVLELSSYQTDLARA 185

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFI 236
           + P + V  N SPDHLDRH  L  Y   K+++        A+I +++ + + +A  M   
Sbjct: 186 LTPDVAVFTNFSPDHLDRHAGLGGYFAAKRRLFAEGGPDRAVIGVDEPEGQYLAGQMAE- 244

Query: 237 GHSISRISSQSLQ-----SDSDLYIDESFLKCSATSEVIFDFSQETKK-----HNIQNLV 286
           G +  R+   S+      S   ++  + FL        +        K     HN QN  
Sbjct: 245 GPNDDRVIRISVDHKLTGSGWSVFARKGFLSEYRHGRQVGSIDLRGVKGLPGSHNHQNAC 304

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
            +   C  LGL    I+  L S  GL HR Q +A    +IF+NDSKATN+ S + A L  
Sbjct: 305 AAYAACRTLGLAPRVIEAGLHSYAGLPHRSQRVAEKDGIIFVNDSKATNVDSALKA-LQA 363

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
              I WI GGL K    + L P ++ + KAY IG  A  F     G + S +  T+ +A+
Sbjct: 364 FENIRWICGGLEKDGGLAGLAPGLAHVRKAYVIGREAAGFARAL-GTVESEVCTTMAKAV 422

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
            S + D E+     +VL +P  ASFDQY+NF +RG  FM+QV
Sbjct: 423 ASAMSDAES---GDVVLLAPAAASFDQYDNFEKRGEDFMAQV 461


>gi|94498175|ref|ZP_01304736.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomonas sp.
           SKA58]
 gi|94422305|gb|EAT07345.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomonas sp.
           SKA58]
          Length = 443

 Score =  233 bits (593), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 161/454 (35%), Positives = 224/454 (49%), Gaps = 42/454 (9%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           S+F   + AV GL RSGL+    L  SG  V+AWD    A  Q      E+ D  EI  +
Sbjct: 5   SAFAGKTYAVLGLARSGLATVETLVASGARVVAWDSREEARSQVAGKA-ELGDPMEIDLA 63

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
               +V+SPG+ L     +   KLA    V IIGDIELF   R         + +TGTNG
Sbjct: 64  GFDGIVVSPGVPLNRHPINMRAKLAG---VPIIGDIELFALARPTLPPHK-VVGITGTNG 119

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN----RFYVIECSSYQIELTPTI 179
           KS+T ALI H++ + GY   +GGNIGLPIL+     PN      YV+E SSYQI+LT ++
Sbjct: 120 KSTTTALIHHIIEQAGYPTVMGGNIGLPILSQPPLEPNLKGAGVYVLELSSYQIDLTHSL 179

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSK---HAIICINDHQCEKIAY---DM 233
           D  + VLLNI+PDHLDR+   E YV  K ++  M      A+I   D     ++    D 
Sbjct: 180 DCDVAVLLNITPDHLDRYDGFEGYVASKARLFAMQSAGHKAVIATEDEPSRSVSTQICDT 239

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
              G  +  ++S  + +               T ++ +   Q    HN QN+  + V   
Sbjct: 240 KGSGEDVVEVASTQVDT---------------TEQLAWPALQ--GPHNAQNVAVAMVTAA 282

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFL-----NEKR 348
            L +     K AL S   L HR+QT+  L  V+++NDSKATN  S   A       + K 
Sbjct: 283 VLDIDPVTTKAALASYASLPHRMQTVRTLNGVLYVNDSKATNAASTAPALAAWPAKDGKP 342

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           RI+WI GG++KS++     P    +A AY IG +     H F   +   ++    + L +
Sbjct: 343 RIHWILGGVAKSENLDECAPHFGNVAHAYTIGEAG----HMFADLLRPHMAVDDSEMLSA 398

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERG 441
            VR    +  P  +VL SP CASFDQ+ +F  RG
Sbjct: 399 AVRRAARIAQPGDVVLLSPACASFDQFRDFEARG 432


>gi|51473598|ref|YP_067355.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           typhi str. Wilmington]
 gi|60390366|sp|Q68WW9|MURD_RICTY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|51459910|gb|AAU03873.1| D-glutamate ligase [Rickettsia typhi str. Wilmington]
          Length = 457

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 151/473 (31%), Positives = 253/473 (53%), Gaps = 40/473 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM-----GIEVID- 56
           ++++    I +FGLG++G+S    LK+    +I +DD    +K  +D+     G ++I  
Sbjct: 1   MNAYTKQKIGIFGLGKTGISVYEELKNK-YDLIVYDD----LKAKRDIFEKLFGNKLITI 55

Query: 57  FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
             +  W  +  +VLSPG+ LT    H  V++A+ FN+ II DI+L   + +       FI
Sbjct: 56  LSDSRWQDLDKIVLSPGVPLT----HEVVRIAHHFNIPIISDIDLLFEKSK----NLKFI 107

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           A+TGTNGKS+T ALISH+L  NG D  + GNIG+P L  +  +    YV+E SS+Q++L 
Sbjct: 108 AITGTNGKSTTAALISHILNSNGLDYTVAGNIGVPALQAK--ASKDGYVLELSSFQLDLV 165

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI---- 229
                 + VLLNI+PDHLDR+  +  Y+  K KI   +    +A+I I++  C KI    
Sbjct: 166 KIFTVKVAVLLNITPDHLDRYQDMNGYIAAKAKIFDRMDKDSYAVINIDNDYCRKIFLLL 225

Query: 230 --AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
                +  I  S+++I +  +       +D+     + T ++  + + +   HN +N+  
Sbjct: 226 QREQLIKLIPFSVTKILNNGIS-----IVDDKIHDNNLTYKLPLNKNLQG-LHNCENIAA 279

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           S  V   +G++ ++I  ++ S   L HR+Q I  + ++ F NDSKATN  S + + +   
Sbjct: 280 SYAVSKIIGVESKKILESISSFQSLHHRMQYIGSINNISFYNDSKATNAISALQS-IKAL 338

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
             IYW+AGG+ K      + P+ +KI KAYF G +  +F +     I+  +   L+ A  
Sbjct: 339 DNIYWLAGGIPKEGGIEGIKPYFNKIKKAYFYGQAKTMFANTAKNIIDCVICDNLEYAFN 398

Query: 408 SVVRDV--ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
              +D   +N ++ +I+L +P C+S+DQ+ NF ERG  F+     + G   L+
Sbjct: 399 IAYKDAVSDNTEIKNILL-APSCSSYDQFKNFEERGELFIKLSKNVIGSNYLL 450


>gi|294012781|ref|YP_003546241.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Sphingobium
           japonicum UT26S]
 gi|292676111|dbj|BAI97629.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Sphingobium
           japonicum UT26S]
          Length = 444

 Score =  231 bits (590), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 153/444 (34%), Positives = 221/444 (49%), Gaps = 29/444 (6%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           F     AV GL RSGL+    L  SG  V+AWD    A +   D   E+ D  EI     
Sbjct: 11  FAGRKYAVLGLARSGLATVECLAGSGAQVVAWDSREEAREAVADKA-ELADPTEIDLKGF 69

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             +V+SPG+ L   N H     A    V +IGDIELF   R  S  +   + +TGTNGKS
Sbjct: 70  DGVVVSPGVPL---NKHPIAMHAKLAGVPVIGDIELFALARP-SLPKHRVVGITGTNGKS 125

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T AL+ H++   G   ++GGNIGLPIL          YV+E SSYQI+LT ++D  + V
Sbjct: 126 TTTALVHHIIETAGIPTRMGGNIGLPILGQTPLPEGGVYVLELSSYQIDLTQSLDCDVAV 185

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIGHSISR 242
           LLNI+PDHLDR++  E YV  K ++  M      A+I   D     I Y +         
Sbjct: 186 LLNITPDHLDRYNGFEGYVASKARLFAMQSAGHVAVIATEDEPSRGIFYSVRH------- 238

Query: 243 ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEI 302
             S+   +D  + +  S ++ SA +     +      HN QN   +  V   LG+    I
Sbjct: 239 --SREGGNDGVVEVQSSDIEPSAQA----GWPALQGPHNAQNAAVAIAVARALGIDEATI 292

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATN-----LHSVIHAFLNEKRRIYWIAGGL 357
           ++ L S   L HR+Q +  L  V+++NDSKATN          +  ++ ++R++WI GGL
Sbjct: 293 EQGLQSYASLPHRMQRVRELNGVLYVNDSKATNAASTAPALAAYPPVDGRKRLHWIVGGL 352

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           +K+D+     P+   +A+AY IG +  +F       +    S+ L  A++         Q
Sbjct: 353 AKTDNLDECAPWFGHVAQAYTIGEAGPMFAELLRPHMAVDDSEMLSAAVRRA---ARVAQ 409

Query: 418 LPSIVLFSPGCASFDQYNNFRERG 441
              +VL SP CASFDQ+ +F  RG
Sbjct: 410 PGDVVLLSPACASFDQFRDFEARG 433


>gi|103487367|ref|YP_616928.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingopyxis
           alaskensis RB2256]
 gi|118595694|sp|Q1GRX7|MURD_SPHAL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|98977444|gb|ABF53595.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingopyxis
           alaskensis RB2256]
          Length = 434

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 155/455 (34%), Positives = 225/455 (49%), Gaps = 36/455 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
           +F     AV GL RSGL+   AL  SG  V AWDD   A   A  +G ++ +  +I    
Sbjct: 6   AFAGRRYAVLGLARSGLATVEALVASGAGVTAWDDREEARDAAMALGADIGNPLDIDLIG 65

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
            + +V+SPG+ L   N H     A   +V +IGDIELF  E R        + +TGTNGK
Sbjct: 66  FAGVVVSPGVPL---NRHPIAAHARDAHVPVIGDIELFA-EARSELPPHKVVGITGTNGK 121

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+  ALI+H+L   G  V +GGNIGLPIL  E       YV+E SS+QI+L  ++   + 
Sbjct: 122 STVTALIAHMLESAGVPVLMGGNIGLPILTREPLPEAGVYVLELSSFQIDLAHSLACDVA 181

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIGHSIS 241
           VL NISPDHLDR+   E YV  K ++ ++      AII  +D   + IA  +N   H + 
Sbjct: 182 VLTNISPDHLDRYDGFEGYVASKARLFSLQHRDQVAIIATDDDPSKMIASRVN---HRLH 238

Query: 242 RISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEE 301
           R+S++ +       +D++             +      HN QN V +   C  LGL  E 
Sbjct: 239 RVSAKDIDP-----VDQA------------RWPALQGPHNAQNAVCAIAACRVLGLDDEA 281

Query: 302 IKRALLSCGGLTHRLQTIARLGHVIFINDSK----ATNLHSVIHAFLNEKRRIYWIAGGL 357
           I+R L +   L HR++ +       + NDSK    A+   ++        +R++WIAGG 
Sbjct: 282 IERGLATFRSLPHRMELVGEARGARWYNDSKATNAASAAPALAAFPPAPDQRLHWIAGGQ 341

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           +K D  +   P+   + +AY IG +   F    G  I   + ++ D  L S V       
Sbjct: 342 AKGDGLAACRPWFGHVKRAYLIGEAMAPFAAEIGDAI--AIERSGD--LASAVAQAAAAV 397

Query: 418 LPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            P  IVL SP CASFDQ+ ++  RG +F + V  +
Sbjct: 398 QPGDIVLLSPACASFDQFKDYEARGEAFRAAVEAL 432


>gi|269959054|ref|YP_003328843.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Anaplasma centrale
           str. Israel]
 gi|269848885|gb|ACZ49529.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Anaplasma centrale
           str. Israel]
          Length = 456

 Score =  231 bits (588), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 153/450 (34%), Positives = 227/450 (50%), Gaps = 26/450 (5%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM--GIEVIDFREIPWSIISFL 68
           +AVFGLG +G+SAA  L   G  V+ WDD+   +++ K +    E +   E  W  I+ L
Sbjct: 12  VAVFGLGETGISAARFLVRGGARVLVWDDNERVLREGKKLCPECEFVHPYEYDWGGIAEL 71

Query: 69  VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTV 128
           VLSPG+  +  N HW VKLA +    +  D+E+F R     S  +  I VTGTNGKS+TV
Sbjct: 72  VLSPGVLHSRHNEHWVVKLAKRVGCRVTSDVEIFCR-----SQPARLIGVTGTNGKSTTV 126

Query: 129 ALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLN 188
            LI  +L   G D + GGN+G     L        YV+E SSYQ+EL       IGV+LN
Sbjct: 127 ELIGWILNCAGIDSETGGNVGGKGA-LSLPQGKEAYVLELSSYQLELMHEASLDIGVVLN 185

Query: 189 ISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQ-----CEKIAYDMNFIGHSISRI 243
           I+PDHLD +  + +Y++ K+KI+  S   +   +D       C+ +   M F      R+
Sbjct: 186 IAPDHLDVYSGMADYISAKEKILKFSNLLVANCDDRNVTACLCKNVGQVMEF--SCEKRL 243

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIK 303
                  D  +Y     +        I D   ++   N +N+  +  V   LG+  E I 
Sbjct: 244 DKGVSVLDGRVYFHGKVMG-------IGDLKIDSAS-NAENIAAAYTVARSLGVPDEVIL 295

Query: 304 RALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDF 363
            ++    GL HR Q +A + +V F+NDSKATN  SV  A +  K  +YWIAGG SK    
Sbjct: 296 ASIREFPGLRHRNQIVAEIANVTFVNDSKATNAASVGKALMCRK-NVYWIAGGKSKDGGI 354

Query: 364 STLFP-FISKIAKAYFIGNSAMLFFHHFG-GKINSTLSKTLDQALKSVVRDVENVQLPSI 421
            +L   + + I KA+ +G +A  F       ++       +  A+++   +     + + 
Sbjct: 355 ESLLGLYANHIRKAFLVGEAANEFAVSLQRAQVEHVTCHDIYDAVRAAFVEAVADGVKAT 414

Query: 422 VLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           VL SP C+S DQ+ NF ERG +F + VSE+
Sbjct: 415 VLLSPACSSLDQWRNFEERGEAFCAAVSEL 444


>gi|260427001|ref|ZP_05780980.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Citreicella sp.
           SE45]
 gi|260421493|gb|EEX14744.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Citreicella sp.
           SE45]
          Length = 467

 Score =  230 bits (587), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 155/465 (33%), Positives = 231/465 (49%), Gaps = 22/465 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  F    +AV GLGRSGLSAA AL++ G   + WDD+P A + A   G E+ +  R 
Sbjct: 2   IPVQGFEGRVVAVLGLGRSGLSAARALREGGAVALCWDDNPAAREAAAAEGFELRELARA 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR---ERRFSSLQSP-- 114
             +  +  LV+SPGI       +  V  A    V +  DI LF R   +  +    +P  
Sbjct: 62  GGFEGVDRLVVSPGIPHLYPAPNAVVAAAWDAGVPVDNDIGLFFRSLGQGEWDMFDTPPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            +AVTG+NGKS+T ALI H+L  +G D QL GNIG  +L+++        V+E SSYQ +
Sbjct: 122 VVAVTGSNGKSTTSALIHHILTSSGRDSQLAGNIGRGVLDIDPPGDGGVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++ +       +I +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFSEGGPDRCVIGVDEAEGRYLANQ 241

Query: 233 M--NFIGHSISRISSQSLQSDS--DLYIDESFLKCSATSEVI--FDFSQE---TKKHNIQ 283
           M        + R+SS +  S    D++  + FL        +   D  Q       HN Q
Sbjct: 242 MSEGAADDRVIRVSSGTRLSGPGWDVFARKGFLTEWRKGRQVASIDLRQVRGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +      LG+    ++ A +S  GL HR Q +A  G V ++NDSKATN+ + + A 
Sbjct: 302 NACAAYAAARALGVAPRVVEAAFMSFEGLPHRSQIVAEAGGVAYVNDSKATNVDAALKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    ++ WI GGL K      L P    + KAY IG  A  F     G + + +   ++
Sbjct: 361 LQAFPKVRWICGGLMKEGGLGGLAPGFPNVVKAYVIGREAAGFALGLPG-VEAEVCTDME 419

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
            A   V R +   Q   +VL +P  ASFDQY+NF +RG  F ++V
Sbjct: 420 TA---VTRAIAEAQPGEVVLLAPAAASFDQYDNFEQRGDDFAAKV 461


>gi|310816183|ref|YP_003964147.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ketogulonicigenium
           vulgare Y25]
 gi|308754918|gb|ADO42847.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ketogulonicigenium
           vulgare Y25]
          Length = 466

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 167/469 (35%), Positives = 228/469 (48%), Gaps = 24/469 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +  H +AV GLGRSG + A AL   G  VI WDD   A + A+  G  V D  R 
Sbjct: 2   IAVKGYEGHKVAVLGLGRSGRATAKALLAGGAEVIVWDDGAPAREAAEADGFLVQDLTRA 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR---ERRFSS--LQSP 114
             W  +  LV SPGIA      H  +  A    V +  DI LF R   +R +    ++  
Sbjct: 62  DAWDGVRLLVTSPGIAHLYPKPHPVIAAAWAAFVPVDNDIGLFFRSYADREWDDFDIRPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + VTG+NGKS+T AL+ H+L + G   QL GNIG  +L+L         V+E SSYQ +
Sbjct: 122 VVTVTGSNGKSTTSALLHHILEECGRPAQLAGNIGRGVLDLPPARDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P I VL N+SPDHLDRH  +  Y   K+++        A+I +++++   +A  
Sbjct: 182 LARALTPDIAVLTNMSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAVIGVDENEGRYLANQ 241

Query: 233 MNFIGHSISRI----SSQSLQSDS-DLYIDESFLKCSATSEVI--FDFSQET---KKHNI 282
           +   G    R+    S Q L+S +  ++  + FL        I   D  Q       HN 
Sbjct: 242 L-IEGPGDDRVIFTSSGQKLESAAWSVFARKGFLTEWRKGRQIASIDLRQVVGLPGAHNH 300

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           QN   +  V   LGL  + I+ AL S  GL HR Q I     VIF+NDSKATN+ S   A
Sbjct: 301 QNACNAYAVARSLGLGPKAIEAALHSYPGLPHRSQRIGEKDGVIFVNDSKATNVDSAAKA 360

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L   + I WI GGL K      L P +  + KAY IG  A  F     G + + +  T+
Sbjct: 361 -LQAFQNIRWICGGLEKEGGLGGLLPHVGSVKKAYVIGRDAPHFALQLTG-VEAEICTTM 418

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            QA+     D E      IVL +P  ASFDQY++F  RG  F+  V  I
Sbjct: 419 GQAVAQAFADAEP---GDIVLLAPAAASFDQYDSFERRGEDFIRYVQNI 464


>gi|89067941|ref|ZP_01155385.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanicola
           granulosus HTCC2516]
 gi|89046539|gb|EAR52595.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanicola
           granulosus HTCC2516]
          Length = 464

 Score =  229 bits (584), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 160/463 (34%), Positives = 228/463 (49%), Gaps = 31/463 (6%)

Query: 10  SIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWSIISFL 68
           ++AV GLGRSG +AA AL   G  V+AWDD P     A+D  I + D  R      ++ L
Sbjct: 11  TVAVLGLGRSGRTAARALAAGGASVVAWDDGPAGRAAAEDEDIALRDLSRPGALDDVAAL 70

Query: 69  VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-----PFIAVTGTNG 123
           ++SPGI       H  +  A +  V +  DI LF R    S   S       +AVTG+NG
Sbjct: 71  IVSPGIPHLYPRPHPVIAAAWEAGVPVDNDIGLFFRSLGQSDWDSHDVAPKVVAVTGSNG 130

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T ALI HVLR+ G + QL GNIG  +L+++        V+E SSYQ EL  ++ P +
Sbjct: 131 KSTTAALIHHVLREGGRESQLAGNIGRGVLDIDPPGDGGVVVLELSSYQTELARSLTPDV 190

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGHSIS 241
            V  N+SPDHLDRH  +  Y   K+++         I+ +++ +   +A  +     + S
Sbjct: 191 AVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRCIVGVDELEGRFLANQL-----AES 245

Query: 242 RISSQSLQSDSDLYIDESF---LKCSATSEV----------IFDFSQETKKHNIQNLVTS 288
           R   + ++  +D  + E +    +    SE+          + +       HN QN   +
Sbjct: 246 RADDRVIRISADRKLAEGWSVTARKGYLSELRKGRQVGSIDLREIKGLPGAHNHQNACAA 305

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
             V   LGL   +I+ A  S  GL HR Q IA  G V F+NDSKATN+ S   A L    
Sbjct: 306 YAVARTLGLGPRQIEAAFASYPGLPHRSQLIAERGGVRFVNDSKATNVDSAAKA-LAAFG 364

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           RI WI GGL K      L      + KAY IG  A  F     G I++ +  T+  A   
Sbjct: 365 RIRWICGGLQKEGGLGGLLDAAGGVVKAYVIGREAEAFAMSLTG-IDAEVCTTMADA--- 420

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           V R     +   +VL +P  ASFDQY+NF +RG  F ++V+ +
Sbjct: 421 VARSAAEAEPGDVVLLAPAAASFDQYDNFEQRGEDFAARVAAL 463


>gi|254476425|ref|ZP_05089811.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ruegeria sp. R11]
 gi|214030668|gb|EEB71503.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ruegeria sp. R11]
          Length = 468

 Score =  229 bits (583), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 236/472 (50%), Gaps = 23/472 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + ++ F   ++AV GLGRSGL+ A AL+  G   + WDD+P A  +A+  G    D  + 
Sbjct: 2   IPVTGFEGATVAVLGLGRSGLTTARALRAGGAEPVCWDDNPGARARAEVEGFTCRDLLKS 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSL-QSP- 114
             +  ++ LV+SPGI       +  ++ A    V +  DI LF R    R +    Q+P 
Sbjct: 62  GAFDDVAALVVSPGIPHLYPKPNPVIRAALVAGVPVDNDIGLFFRSVATRGWEQYDQAPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            +AVTG+NGKS+TVAL+ H+L++ G + QL GNIG  +L+++        V+E SSYQ +
Sbjct: 122 IVAVTGSNGKSTTVALLHHILQEAGRESQLAGNIGRGVLDIDPPGSGGVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH  +  Y   K+++        AII +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAIIGVDEDEGLYLAGQ 241

Query: 233 MNFIGHS--ISRIS-SQSLQSDS-DLYIDESFLK-----CSATSEVIFDFSQETKKHNIQ 283
           ++       + RIS SQ L      ++  + FL        A S  +         HN Q
Sbjct: 242 LSEAASDDRVIRISASQKLTGPGWQVFARKGFLSEYRKGRQAASIDLRQMQGLPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +      LGL    I+ AL S  GL HR QTIA    V ++NDSKATNL S   A 
Sbjct: 302 NACAAYAAARALGLAPRLIEDALASYPGLPHRSQTIATHAGVRYVNDSKATNLDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L     I WI GGL K      L     K+ KAY IG  A  F       + + +  T+ 
Sbjct: 361 LGAFENIRWICGGLEKEGGLDALRGQAGKVRKAYVIGREAAGFAMQL--DVEAEVCITMA 418

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
           QA   V R     +    VL +P  ASFDQY+NF +RG  F+++V ++ G +
Sbjct: 419 QA---VARASAEAEPGDTVLLAPAAASFDQYDNFEQRGEDFIAEVGKLTGAD 467


>gi|119383341|ref|YP_914397.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Paracoccus
           denitrificans PD1222]
 gi|158512585|sp|A1AZK7|MURD_PARDP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|119373108|gb|ABL68701.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Paracoccus
           denitrificans PD1222]
          Length = 466

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 162/470 (34%), Positives = 233/470 (49%), Gaps = 26/470 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +   +N +IAV GLGRSG + A AL   G  V+AWDD     +QA+  G+ ++D  ++
Sbjct: 2   IPVQGVQNQTIAVLGLGRSGRATAAALAAGGARVVAWDDGVDTREQAEQEGLHLLDLTQD 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             W  IS L+ SPGI       H  +  A    V +  DI LF R        RF +   
Sbjct: 62  QNWDGISALIASPGIPHLYPKPHPVIARAYALGVPVDNDIGLFFRSFATAEWERFDTTPR 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
             IAVTG+NGKS+T ALI H+L++ G   Q+GGNIG  +L+L+        V+E SSYQ 
Sbjct: 122 -VIAVTGSNGKSTTTALIHHILKETGRPTQIGGNIGTGVLSLDPAHDGEVVVLELSSYQT 180

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAY 231
           +L   + P + V  N+SPDHLDRH  L  Y   K+++        A+I +++ +   +A 
Sbjct: 181 DLARALTPDVAVFTNLSPDHLDRHGGLGGYFAAKRRLFAEGGPDRAVIGVDEVEGRYLAG 240

Query: 232 DMNFIGHSISRI----SSQSLQS------DSDLYIDESFLKCSATSEVIFDFSQETKKHN 281
            +  +G +  R+    S Q L+           Y+ E        S  +         HN
Sbjct: 241 QLG-MGAADDRVIRVSSGQKLEGFGWSVFARKGYLAEYRKGRQVASIDLRGIQGLPGAHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +      +G+   EI+RA  S  GL HR QT+A +G V ++NDSKATN+ +   
Sbjct: 300 HQNACAAYAAARAVGIAPREIERAFHSFQGLPHRSQTVAEIGGVAWVNDSKATNVDAAAK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A      RI WIAGG+ K      L P +  + KAY IG+SA      F  +I  T  + 
Sbjct: 360 ALAAFP-RIRWIAGGMGKDGGIEALAPCLGPVVKAYLIGHSA----RDFALQIGQTPYEI 414

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           ++   ++V R     Q    VL +P  ASFDQY NF +RG  F + V  +
Sbjct: 415 VETMEQAVARAAAEAQPGETVLLAPAAASFDQYPNFEKRGEHFTALVKAL 464


>gi|307294498|ref|ZP_07574340.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sphingobium
           chlorophenolicum L-1]
 gi|306878972|gb|EFN10190.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sphingobium
           chlorophenolicum L-1]
          Length = 440

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 156/446 (34%), Positives = 225/446 (50%), Gaps = 34/446 (7%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           F     AV GL RSGL+    L  SG HV+AWD    A     D   E+ D  EI    +
Sbjct: 8   FAGKKYAVLGLARSGLATVECLAASGAHVVAWDSREEARAAVADKA-ELADPAEIDLKGL 66

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             +V+SPG+ L   N H     A    V IIGDIELF   R  +  +   + +TGTNGKS
Sbjct: 67  EGVVVSPGVPL---NKHPIAMHARLAGVPIIGDIELFALARP-ALPKHRVVGITGTNGKS 122

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T AL+ H++   G   ++GGNIGLPIL  E       YV+E SSYQI+LT ++D  + V
Sbjct: 123 TTTALVHHIIETAGIPTRMGGNIGLPILGQEPLPEGGVYVLELSSYQIDLTQSLDCDVAV 182

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMS--KH-AIICINDHQCEKIAYDMNFIGHSISR 242
           LLNI+PDHLDR++  E YV  K ++  M    H A+I   D     I  ++         
Sbjct: 183 LLNITPDHLDRYNGFEGYVASKARLFEMQSVDHVAVIATEDEPSRSIFENLR-------- 234

Query: 243 ISSQSLQSDSDLY-IDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEE 301
               S +  +D+  +  S +  +A +     +      HN QN   +  V   LG+    
Sbjct: 235 ---HSREGGNDVVEVKSSDIDPAAQAR----WPALQGPHNAQNAAVAIAVAQALGIDEAI 287

Query: 302 IKRALLSCGGLTHRLQTIARLGHVIFINDSKATN-----LHSVIHAFLNEKRRIYWIAGG 356
           I++ L S   L HR+Q +  L  V+++NDSKATN          +  ++ ++R++WI GG
Sbjct: 288 IEQGLQSYASLPHRMQRVRELNGVLYVNDSKATNAASTAPALAAYPPMDGRKRLHWIVGG 347

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENV 416
           L+K+D+     P+   +A+AY IG +     H F   +   ++    + L + VR    V
Sbjct: 348 LAKTDNLDECAPWFGNVAQAYTIGEAG----HMFADLLRPHMAVDDSEMLSAAVRRAARV 403

Query: 417 QLPS-IVLFSPGCASFDQYNNFRERG 441
             P  +VL SP CASFDQ+ +F  RG
Sbjct: 404 AQPGDVVLLSPACASFDQFRDFEARG 429


>gi|159044992|ref|YP_001533786.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Dinoroseobacter shibae DFL 12]
 gi|189082879|sp|A8LS92|MURD_DINSH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|157912752|gb|ABV94185.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Dinoroseobacter
           shibae DFL 12]
          Length = 464

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 156/467 (33%), Positives = 223/467 (47%), Gaps = 23/467 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  F   +IAV GLGRSGL+ A AL+  G   + WDD+  A  +A+  G      +  
Sbjct: 2   IPVRGFSGETIAVLGLGRSGLATARALRAGGATPLCWDDNTEARARAEAEGFACAPLKHA 61

Query: 61  -PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             +  ++ L+ SPGI       +  + LA    + +  DI LF R         F SL  
Sbjct: 62  DAFDGVAALITSPGIPHLYPTPNPTIALAMSLGIPVDNDIGLFFRSFATPDWDEFDSLPR 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
             IAVTG+NGKS+T ALI HVL   G   QL GNIG  +L+++        V+E SSYQ 
Sbjct: 122 -VIAVTGSNGKSTTSALIHHVLTAAGRPTQLAGNIGRGVLDIDPGEDGGIVVLELSSYQT 180

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAY 231
           EL   + P I V  N+SPDHLDRH  +  Y   K+++ T+     A+I  ++ +   +A 
Sbjct: 181 ELARALTPDIAVFTNLSPDHLDRHGGMGGYFAAKRRLFTIGGPDRAVIGTDEPEGLFLAS 240

Query: 232 DMNFIGHSISRISSQSLQSDSDLYI---DESFL----KCSATSEV-IFDFSQETKKHNIQ 283
            ++        I   S +     ++    + FL    K   T  + +         HN Q
Sbjct: 241 QLSVAPADDRVIRVTSAKPSGPGWVVSARKGFLAEHRKGRQTGSIDLRPIPGLPGAHNHQ 300

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL   +I+    S  GL HR Q +     V F+NDSKATN+ S   A 
Sbjct: 301 NAACAYAACRSLGLAPRQIEAGFASFKGLPHRSQIVGTANGVTFVNDSKATNVDSAAKA- 359

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L    RI WIAGGL K    + L P +  + KAY IG SA      F   I  T  +  +
Sbjct: 360 LQAFDRIRWIAGGLEKEGGLAALTPHLGGVRKAYLIGRSAA----EFALGIPDTPHEVCE 415

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
              ++V   V   +    +L +P  ASFDQY+NF  RG  F+++V++
Sbjct: 416 TMARAVAAAVAEAEPGDTILLAPAAASFDQYDNFERRGEDFIAEVAK 462


>gi|89055254|ref|YP_510705.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Jannaschia
           sp. CCS1]
 gi|118595660|sp|Q28NN2|MURD_JANSC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|88864803|gb|ABD55680.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Jannaschia sp.
           CCS1]
          Length = 460

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 156/462 (33%), Positives = 221/462 (47%), Gaps = 20/462 (4%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
            F    + V GLGRSGL++A AL++ G   + WDD      +A   G  + D        
Sbjct: 2   GFVGRKVVVLGLGRSGLASARALREGGAEALCWDDGEAGRARAAAEGFTIHDPIRDGLDG 61

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR-----ERRFSSLQSPFIAVT 119
           ++ LV SPGI       H  +  A    V +  DI LF R     +  F       +AVT
Sbjct: 62  VACLVTSPGIPHLYSTPHRAIVAAYAAGVPVDNDIGLFFRSLGQGDWAFHDTPPRVVAVT 121

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+T ALI+H+L + G  VQL GNIG  +L++E        VIE SSYQ EL   +
Sbjct: 122 GSNGKSTTSALIAHILEEAGTPVQLAGNIGRGVLDIEPPIDGEVIVIELSSYQTELARAL 181

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIA------- 230
            P I V  N+S DHL+RH  +  Y   K+++ +    + A+I +++ + + +A       
Sbjct: 182 TPDIAVFTNLSADHLERHGGMGGYFAAKRRLFSEGGPERAVIGVDEIEGQYLAGQLVEGP 241

Query: 231 YDMNFIGHSISRISSQSLQ-SDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
            D   I  S  ++S      S    ++ E      A S  +         HN QN   + 
Sbjct: 242 EDGRLIRVSSGKLSGPGWDVSTRKGWLSEFRKGRQAASIDLRGVPGLPGAHNHQNAACAY 301

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
            VC  LGL    I+ A  +  GL HR Q +A +  V ++NDSKATN+ +   A L   +R
Sbjct: 302 GVCRALGLAPRVIEAAFATFEGLPHRSQRVAEINGVFYVNDSKATNVDAATKA-LGAFKR 360

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
           I WI GGL K      L+     +AKAY IG  A  F  H  G I   +   +  A   V
Sbjct: 361 IRWICGGLEKDGGLEALWEAAGHVAKAYVIGREAEAFALHL-GDIPKDVCGDMATA---V 416

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            R   + Q    VL +P  ASFDQY++F  RG  F++QV ++
Sbjct: 417 ARASADAQPGDTVLLAPAAASFDQYDSFETRGADFIAQVEKL 458


>gi|23014458|ref|ZP_00054273.1| COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 457

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 148/447 (33%), Positives = 226/447 (50%), Gaps = 9/447 (2%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
            +   + V GLG+SG + A AL  +G  V+AWDD   A + A +  I + D   IP    
Sbjct: 7   LKGKRVLVMGLGKSGTATARALLAAGAGVMAWDDGETARRAAAETAIPIRDPALIPMEKA 66

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             +V SPGI  T    H   + A   NV ++ D+EL       +   +  +AVTGTNGKS
Sbjct: 67  DLVVWSPGIPHTHPQPHAIAEKARAANVPVVCDVELL----GLAKAGTRMLAVTGTNGKS 122

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T  L++HVL + G  V  GGN+G   L+L     +  YV+E SSYQ+ELT ++     +
Sbjct: 123 TTTTLLAHVLAECGLPVAAGGNLGTAALDLPELPGDGRYVLELSSYQLELTHSLKLGAAI 182

Query: 186 LLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           LLNI+PDHL RH  +  Y+  K+++   +T    A+I ++D  C  IA ++   G  + +
Sbjct: 183 LLNITPDHLGRHGGMNGYIAAKRRVFDFLTPGGAAVIGVDDGPCRAIAAELERRGLRVVK 242

Query: 243 ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEI 302
           IS +S+ ++     D   L        + +       HN QN           GL  ++I
Sbjct: 243 ISVESVLTEGVSAPDGVLLDNGKPVTDLKEIPSLPGSHNWQNACAVYAAARAEGLSPKDI 302

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDD 362
             AL +  GL HR + +     + +INDSKATN  +V  A +  +  IYWI GG +K   
Sbjct: 303 AAALSTYPGLAHRQELVGEDHGIAWINDSKATNADAVEKALVCYE-HIYWILGGQAKEGG 361

Query: 363 FSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLP-SI 421
            ++L     +I  A+ IG ++  F     GK+  T   TL  A+ +      +  +P ++
Sbjct: 362 IASLERHFGRIQHAFLIGEASEAFAATLEGKVRYTRCVTLANAVAAARNLAVSDDIPGAV 421

Query: 422 VLFSPGCASFDQYNNFRERGFSFMSQV 448
           VL SP CAS+DQ+ +F +RG +F   V
Sbjct: 422 VLLSPACASWDQFKSFEDRGDTFRDLV 448


>gi|259418779|ref|ZP_05742696.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Silicibacter sp.
           TrichCH4B]
 gi|259345001|gb|EEW56855.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Silicibacter sp.
           TrichCH4B]
          Length = 472

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 151/461 (32%), Positives = 234/461 (50%), Gaps = 26/461 (5%)

Query: 8   NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWSIIS 66
             ++AV GLGRSGL+ A AL++ G   I WDD+P A + A+  G    +  ++  +  IS
Sbjct: 9   GQNVAVLGLGRSGLATARALREGGAEAICWDDNPAARENAEAEGFTCRELTKQGAFEGIS 68

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSLQSP--FIAVTGT 121
            L++SPGI       +  V+ A    V +  DI LF R      +    +P   IAVTG+
Sbjct: 69  ALIVSPGIPHLYPKPNPVVRAALSAGVPVDNDIGLFFRSVATSEWDEFDTPPKVIAVTGS 128

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+TVAL+ H+L   G + Q+ GNIG  +L+++        V+E SSYQ +L   + P
Sbjct: 129 NGKSTTVALLHHILEHVGRNSQMAGNIGRGVLDIDPPVDGGVVVLELSSYQTDLARALTP 188

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGHS 239
            + V  N++PDHLDRH  +  Y   K+++        A+I I++ +   +A  M+  G+ 
Sbjct: 189 DVAVFTNLTPDHLDRHAGMGGYFAAKRRLFAEGGPDRAVIGIDEDEGLFLAGQMSE-GNG 247

Query: 240 ISRI----SSQSLQSDS--DLYIDESFLK-----CSATSEVIFDFSQETKKHNIQNLVTS 288
             R+    S Q L   +   ++  + FL        A S  + D       HN QN   +
Sbjct: 248 DDRVIRVSSGQKLSGSAGWSVFARKGFLSEYRKGRQAGSIDLRDIPGLPGAHNHQNACAA 307

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 LGL    I+ A+ +  GL HR Q +A+   V ++NDSKATN+ S   A L+  +
Sbjct: 308 YAAARTLGLAPRVIEAAMKTYPGLPHRSQRVAQANGVSYVNDSKATNVDSAAKA-LSAFK 366

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           +I WI GGL K      L     ++ KAY IG  A  F       +++ +  T+  A++ 
Sbjct: 367 KIRWICGGLEKEGGLEALKGATGEVLKAYVIGREAAQFAMQL--NVDAEVCTTMAAAVEC 424

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
            + D    +    VL +P  ASFDQY++F +RG  F+++V+
Sbjct: 425 AMADAGEGE---TVLLAPAAASFDQYDSFEKRGEDFIAEVT 462


>gi|163738713|ref|ZP_02146127.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Phaeobacter
           gallaeciensis BS107]
 gi|161388041|gb|EDQ12396.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Phaeobacter
           gallaeciensis BS107]
          Length = 465

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 162/472 (34%), Positives = 237/472 (50%), Gaps = 27/472 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ F    +AV GLGRSG + A AL++ G   + WDD+P A  +A+  G    D ++ 
Sbjct: 2   IPVTGFEGAKVAVLGLGRSGFATARALREGGAEPVCWDDNPGARARAEVEGFVCRDLQKA 61

Query: 61  -PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             +  I+ LV+SPGI       +  +  A    V +  DI LF R        RF   Q+
Sbjct: 62  GAFDDIASLVVSPGIPHLYPKPNPVIHAALVAGVPVDNDIGLFFRSVATRGWERFD--QA 119

Query: 114 P-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
           P  +AVTG+NGKS+TVAL+ H+L++ G + QL GNIG  +L+++        V+E SSYQ
Sbjct: 120 PRIVAVTGSNGKSTTVALLHHILQEAGRESQLAGNIGRGVLDIDPPGSGGIVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIA 230
            +L   + P + V  N+SPDHLDRH  +  Y   K+++        AII +++ +   +A
Sbjct: 180 TDLARALTPDVAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAIIGVDEDEGLYLA 239

Query: 231 YDMNFIGHS--ISRIS-SQSLQSDS-DLYIDESFLK-----CSATSEVIFDFSQETKKHN 281
             ++       + RIS SQ L      ++  + FL        A S  +         HN
Sbjct: 240 GQLSEAASDDRVIRISASQKLTGLGWQVFARKGFLSEYRKGRQAASIDLRQMQGLPGAHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +      LGL    I+ AL S  GL HR QTIA    V ++NDSKATNL S + 
Sbjct: 300 HQNACAAYAAARALGLAPRLIEDALASYPGLPHRSQTIATHAGVRYVNDSKATNLDSAVK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A L+    I WI GGL K      L     K+ KAY IG  A  F       + + +  T
Sbjct: 360 A-LSAFDNIRWICGGLEKDGGLEALRGQTGKVRKAYVIGREAAGFAMQL--DVEAEVCIT 416

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           + +A   V R     +    VL +P  ASFDQY+NF +RG  F+++V+++ G
Sbjct: 417 MAEA---VARASAEAETGDTVLLAPAAASFDQYDNFEQRGEDFIAEVAKLQG 465


>gi|294677022|ref|YP_003577637.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           capsulatus SB 1003]
 gi|294475842|gb|ADE85230.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacter
           capsulatus SB 1003]
          Length = 466

 Score =  226 bits (576), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 152/470 (32%), Positives = 219/470 (46%), Gaps = 24/470 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +    +AV GLGRSGL+ A AL+  G   + WDD P A  +A+  G    D  R 
Sbjct: 2   IPVQGYEGARVAVLGLGRSGLATAAALRAGGAEPVLWDDSPEARAKAEAAGYACTDLTRA 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ----SP- 114
             +  I+ L+ SPGI       +  +  A    V +  DI LF R    +       +P 
Sbjct: 62  GAFEGIAALITSPGIPHLYPRPNPVIAAAMAAGVPVDNDIGLFFRSWATAGWDDFDVTPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            + +TG+NGKS+T ALI H+L+  G   Q+ GNIG  +L+L+        V+E SSYQ +
Sbjct: 122 TVCITGSNGKSTTTALIHHILKHAGRATQMAGNIGRGVLDLDPPEDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIAYD 232
           L   + P I V  N+SPDH+DRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARALTPDIAVFTNLSPDHMDRHSGMGGYFAAKRRLFAEGAPDRAVIGVDEPEGVYLANQ 241

Query: 233 MNF--IGHSISRISSQSLQSD--SDLYIDESFLKCSATSEVIFDFSQETKK-----HNIQ 283
           M        + R+SS     D    ++  + FL        +        K     HN Q
Sbjct: 242 MAMGATDDRVIRVSSAKKLGDFGWSVFARKGFLAEWRKGRQVASIDLRGVKALPGAHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL  + I+ A  S GGL HR QTIA    V ++NDSKATN+ S   A 
Sbjct: 302 NACAAYAACRSLGLAPKLIEEAFHSFGGLPHRSQTIAEKRGVRYVNDSKATNVDSAAKA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L     I WI GG+ K    S L P +  + K YFIG+S   F         + L   + 
Sbjct: 361 LEAFSNIRWIVGGMGKEGGVSALKPLLGSVKKTYFIGHSGRDFALEL-----APLEHEIC 415

Query: 404 QALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           + ++  V        P   VL +P  ASFDQY NF +RG  F +    +P
Sbjct: 416 ETMERAVARAAEEAEPGDTVLLAPAAASFDQYPNFEKRGEHFTALAQALP 465


>gi|254510884|ref|ZP_05122951.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacteraceae
           bacterium KLH11]
 gi|221534595|gb|EEE37583.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacteraceae
           bacterium KLH11]
          Length = 469

 Score =  226 bits (576), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 160/469 (34%), Positives = 232/469 (49%), Gaps = 27/469 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFRE- 59
           + +  F  H +AV GLGRSGL+ A AL+  G   + WDD+P A + A+  G    D R  
Sbjct: 7   IPVKGFSGHKVAVLGLGRSGLTTARALRAGGAAPVCWDDNPAAREVAEAEGFSCFDLRRH 66

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSLQSP-- 114
             +  I+ L++SPGI       +  V  A +  V +  DI LF R      + +  +P  
Sbjct: 67  GAFDEIAALIVSPGIPHLYPVPNPVVAAALEAGVPVDNDIGLFFRSFAGPEWHNYDTPPR 126

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            IAVTG+NGKS+T ALI H+L + G   QL GNIG  +L+++        V+E SSYQ E
Sbjct: 127 VIAVTGSNGKSTTAALIHHILTEAGRSAQLAGNIGRGVLDIDPGGDGSVVVLELSSYQTE 186

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIA-- 230
           L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I I++ +   +A  
Sbjct: 187 LARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGIDEAEGAFLAGQ 246

Query: 231 -----YDMNFIGHSISR-ISSQSLQSDSDLYIDESFLKCSATSEV-IFDFSQETKKHNIQ 283
                 D   I  S++R ++    Q  +       + K      + + D       HN Q
Sbjct: 247 LAEGPSDDRVIRVSVARKLTGPGWQVFARKGFLSEYRKGRQAGAIDLRDIRGLPGAHNHQ 306

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +   C  LGL    I+ AL +  GL HR Q IA  G V ++NDSKATN+ S + A 
Sbjct: 307 NACAAYAACRALGLAPRVIEDALHNFPGLPHRSQIIAEAGGVTYVNDSKATNVDSALKA- 365

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF--GGKINSTLSKT 401
           LN   +I WI GGL K      L      + KAY IG  A  F        ++ +T+S  
Sbjct: 366 LNAFGKIRWICGGLEKEGGLDALNGARDHVVKAYVIGREAAGFAMQLEAEAQVCTTMSAA 425

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           ++QA+        + Q   +VL +P  ASFDQY+NF +RG  F ++V +
Sbjct: 426 VEQAMA-------DAQPGEVVLLAPAAASFDQYDNFEKRGDDFAAEVKK 467


>gi|149186204|ref|ZP_01864518.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erythrobacter sp.
           SD-21]
 gi|148830235|gb|EDL48672.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erythrobacter sp.
           SD-21]
          Length = 429

 Score =  226 bits (576), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 154/454 (33%), Positives = 219/454 (48%), Gaps = 38/454 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
           ++++   AV GL RSG +   AL+ +G  V+ WDD     ++       + D  E   + 
Sbjct: 6   AWKDTKYAVLGLARSGRATVEALRAAGADVLVWDDR-AEAREPYSGRCAIGDPLEADLTG 64

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
            + +V+SPG+ L   N H     A+ F V +I DIELF + R         + +TGTNGK
Sbjct: 65  YAGVVVSPGVPL---NTHPIKPHADSFGVPVISDIELFAQARADLPPHK-VVGITGTNGK 120

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+T AL+ H+L   G    +GGNIGLPIL  E       YV+E SSYQI+LT ++D  + 
Sbjct: 121 STTTALVHHILETAGVPTTMGGNIGLPILEQEPLPEGGVYVLELSSYQIDLTYSLDCDVA 180

Query: 185 VLLNISPDHLDRHH-TLENYVNIKKKIVTM--SKHAIICINDHQCEKIAYDMNFIGHSIS 241
           VLLNI+PDHLDR+    E Y   K ++  M  S+HA +  N H+      D+     S  
Sbjct: 181 VLLNITPDHLDRYDGNFEKYQASKLRLFEMQASQHAAVTENVHRYPDDPTDVWGPWDSED 240

Query: 242 RI-SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
           R   ++ L S                     D+      HN QN   +  V  +L L  E
Sbjct: 241 RARDARPLGSQR-------------------DWPTLQGPHNGQNAFAAIEVAYELELSEE 281

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL---HSVIHAFLNEKRRIYWIAGGL 357
            + RAL +  GL HR++ IA +  V ++NDSK TN       + AF N    I+WI GGL
Sbjct: 282 AVSRALRTFPGLPHRMERIAEIAGVAYVNDSKGTNTAASAPALAAFHN----IHWIVGGL 337

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           +K          +  +  AY IG +   F     G++     ++LD+A+ S     E   
Sbjct: 338 AKEPGLGECEAELGLVKAAYTIGKAGPDFAALLDGRVPVEQCESLDRAVTSAAAKAEAGD 397

Query: 418 LPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
               VL SP CASFDQY +F +RG  F   V  +
Sbjct: 398 ---TVLLSPACASFDQYADFEKRGDHFRELVERL 428


>gi|196019058|ref|XP_002118918.1| hypothetical protein TRIADDRAFT_62903 [Trichoplax adhaerens]
 gi|190577726|gb|EDV18596.1| hypothetical protein TRIADDRAFT_62903 [Trichoplax adhaerens]
          Length = 456

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 150/460 (32%), Positives = 240/460 (52%), Gaps = 27/460 (5%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP-----CAVKQAKDMGI---EVIDFR 58
            N  I +FGLG++G+    AL ++   V AWD++           + D  I   +VID  
Sbjct: 5   NNKKIGIFGLGKTGIGCLKALLNTNAQVTAWDNNKQRFLDLKTNISSDKKIYFSDVID-- 62

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
            I    + F+++SPGI     N H    +  + NV I+ DI+L  +    +  ++ +I +
Sbjct: 63  PIDVKKLDFVIVSPGIPYKYPNPHKIFTICQKHNVPIVTDIDLLFK----ACPKANYIGI 118

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYF-SPNRFYVIECSSYQIELTP 177
           TGTNGKS+T +LI+H+L+ N Y   LGGNIG+P+LNL  F + N  Y++E SSYQ++L  
Sbjct: 119 TGTNGKSTTTSLINHILQSNNYKSALGGNIGIPVLNLPNFNNSNEHYILELSSYQLDLML 178

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMN 234
               +I  LL+I+PDHLDR+ + E+Y N K +I     H   AII +N+H  E I Y+  
Sbjct: 179 NYKFNIAALLSITPDHLDRYASFEDYKNAKLRIFNNQNHNDFAIISLNNHINEGI-YNQL 237

Query: 235 FIGHS---ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDF-SQETKKHNIQNLVTSAV 290
            I ++   I   S Q L+    +  D+ +           D  S     HN +N+  +  
Sbjct: 238 IIKNTQTIIPTSSQQLLKKGISVIKDKIYDNYFENQAFNLDLPSSLIGPHNAENIAMAYT 297

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +   + L  ++I + L +  GL HR++   +   + F+NDSKATN+ S   A L   + I
Sbjct: 298 IAKIINLNSKQIIKNLNTYIGLPHRMELFLKTEKLSFVNDSKATNIASTKEA-LRSFKNI 356

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
           +WIAGG+ K  +   L   I+++   Y IG     F         + +  ++   +++ +
Sbjct: 357 HWIAGGVFKEKNLDELNNHITEVRHCYLIGQDYKRFISLLEK---NNIPYSICNNIENSI 413

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           ++++N      VL SP CASFDQ+ NF ERG +F + + E
Sbjct: 414 QEIKNSVKSGTVLLSPCCASFDQWENFEERGNAFKNLILE 453


>gi|163741576|ref|ZP_02148967.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Phaeobacter
           gallaeciensis 2.10]
 gi|161385310|gb|EDQ09688.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Phaeobacter
           gallaeciensis 2.10]
          Length = 465

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 162/476 (34%), Positives = 236/476 (49%), Gaps = 35/476 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + ++ F    +AV GLGRSG + A AL++ G   + WDD+P A  +A+  G    D ++ 
Sbjct: 2   IPVTGFEGAKVAVLGLGRSGFATARALREGGAEPVCWDDNPGARARAEVEGFVCRDLQKA 61

Query: 61  -PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             +  I+ L++SPGI       +  +  A    V +  DI LF R        RF   Q+
Sbjct: 62  GAFDDIASLIVSPGIPHLYPKPNPVIHAALVAGVPVDNDIGLFFRSVATRGWERFD--QA 119

Query: 114 P-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
           P  +AVTG+NGKS+TVAL+ H+L++ G + QL GNIG  +L+++        V+E SSYQ
Sbjct: 120 PRIVAVTGSNGKSTTVALLHHILQEAGRESQLAGNIGRGVLDIDPPGSGGIVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDH------ 224
            +L   + P + V  N+SPDHLDRH  +  Y   K+++        AII +++       
Sbjct: 180 TDLARALTPDVAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAIIGVDEDEGLYLA 239

Query: 225 -QCEKIAYDMNFIGHSISR-ISSQSLQSDSDLYIDESFLK-----CSATSEVIFDFSQET 277
            Q  + A D   I  S SR ++    Q    ++  + FL        A S  +       
Sbjct: 240 GQLSEAASDDRVIRISASRKLTGPGWQ----VFARKGFLSEYRKGRQAASIDLRQMQGLP 295

Query: 278 KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLH 337
             HN QN   +      LGL    I+ AL S  GL HR QTIA    V ++NDSKATNL 
Sbjct: 296 GAHNHQNACAAYAAARALGLAPRLIEDALASYPGLPHRSQTIATHEGVRYVNDSKATNLD 355

Query: 338 SVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST 397
           S + A L+    I WI GGL K      L     K+ KAY IG  A  F       + + 
Sbjct: 356 SAVKA-LSAFDNIRWICGGLEKDGGLEALRGQTGKVRKAYVIGREAAGFAMQL--DVEAE 412

Query: 398 LSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           +  T+ +A   V R     +    VL +P  ASFDQY+NF +RG  F+++V+++ G
Sbjct: 413 VCITMAEA---VARASAEAEAGDTVLLAPAAASFDQYDNFEQRGEDFIAEVAKLQG 465


>gi|99080520|ref|YP_612674.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ruegeria sp.
           TM1040]
 gi|118595693|sp|Q1GIV4|MURD_SILST RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|99036800|gb|ABF63412.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ruegeria sp.
           TM1040]
          Length = 467

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 155/461 (33%), Positives = 230/461 (49%), Gaps = 26/461 (5%)

Query: 8   NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWSIIS 66
             ++AV GLGRSGLSAA AL++ G   I WDD+P A   A+  G    +  ++  +  IS
Sbjct: 9   GQNVAVLGLGRSGLSAARALREGGAEAICWDDNPAARATAEAEGFTCRELTKQGAFDGIS 68

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ----SP-FIAVTGT 121
            L++SPGIA      +  ++ A    V +  DI LF R    S       +P  IAVTG+
Sbjct: 69  ALIVSPGIAHLYPKPNPVIRAALVAGVPVDNDIGLFFRSVATSEWDEFDTAPKVIAVTGS 128

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+TVAL+ H+L   G + Q+ GNIG  +L+++        V+E SSYQ +L   + P
Sbjct: 129 NGKSTTVALLHHILEHVGRNSQMAGNIGRGVLDIDPPVDGGVVVLELSSYQTDLARALTP 188

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGHS 239
            + V  N++PDHLDRH  +  Y   K+++        A+I +++ +   +A  ++  G S
Sbjct: 189 DVAVFTNLTPDHLDRHAGMGGYFAAKRRLFAEGGPDRAVIGVDEDEGLFLAGQLSE-GES 247

Query: 240 ISRI----SSQSLQSDSD--LYIDESFLK-----CSATSEVIFDFSQETKKHNIQNLVTS 288
             R+    + Q L   +   ++  + FL        A S  + D       HN QN   +
Sbjct: 248 DDRVIRISARQKLSGGAGWTVFARKGFLSEYRKGRQAGSIDLRDIPGLPGAHNHQNACAA 307

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                 LGL    I+ A+ +  GL HR Q IA    V ++NDSKATN+ S   A L+  +
Sbjct: 308 YAAARTLGLAPRVIEAAMRTYPGLPHRSQRIAEADGVSYVNDSKATNVDSAAKA-LSAFK 366

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
            I WI GGL K      L      + KAY IG  A  F       + + +  T+ QA   
Sbjct: 367 NIRWICGGLEKEGGLEALKGATDDVLKAYVIGREAAQFAMQL--DVEAEVCTTMAQA--- 421

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
           V R +        VL +P  ASFDQY++F +RG  F+++V+
Sbjct: 422 VSRAMAEAGPGETVLLAPAAASFDQYDSFEKRGEDFIAEVT 462


>gi|254463263|ref|ZP_05076679.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacterales
           bacterium HTCC2083]
 gi|206679852|gb|EDZ44339.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 466

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 154/464 (33%), Positives = 221/464 (47%), Gaps = 21/464 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  ++   + V GLGRSGL AA AL   G   I WDD+  A   A+  G E       
Sbjct: 2   IPVQGYKGARVGVLGLGRSGLCAARALHAGGAIPICWDDNEAARAIAEGEGFETAKLTGQ 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS-----LQSPF 115
             + ++ L+ SPGI       +  +K A Q  V +  DI LF R    S      +    
Sbjct: 62  TLANLALLITSPGIPHLYPTPNPVIKEALQMGVPVDNDISLFFRSFATSEWDNLDVTPRV 121

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           +AVTG+NGKS+T ALI HVL       QL GNIG  +L+++        V+E SSYQ +L
Sbjct: 122 VAVTGSNGKSTTSALIHHVLEHANRPTQLAGNIGRGVLDIDPAIDGEVVVLELSSYQTDL 181

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDM 233
              + P + V  N+SPDHLDRH  +  Y   K+++      + AII I++ +   +A  M
Sbjct: 182 ARALTPDVAVFTNLSPDHLDRHQGMGGYFAAKRRLFAEGGPERAIIGIDEDEGLYLAGQM 241

Query: 234 --NFIGHSISRISSQSLQSDSD--LYIDESFLKCSATSEVIFDFSQETKK-----HNIQN 284
                   + RIS +   +D    ++ ++ FL        I        K     HN QN
Sbjct: 242 AEGPQDDRVIRISVERKLTDFGWAVFANKGFLSEYRKGRQIGSIDLRAIKGLPGAHNHQN 301

Query: 285 LVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFL 344
              +  VC  LGL    I+    S  GL HR Q +A +  V ++NDSKATN+ S   A L
Sbjct: 302 ACCAYAVCRTLGLAPRVIEAGFASYPGLPHRSQIVADVDGVTYVNDSKATNVDSAAKA-L 360

Query: 345 NEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ 404
              ++I WI GGL K      L     ++ KAY IG  A  F     G + + +  ++++
Sbjct: 361 GAFKKIRWICGGLEKEGGVEALANAADEVLKAYVIGREASRFAMQLAG-VKTEVCTSMEE 419

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           A   V R +E+      VL +P  ASFDQY++F +RG  F   V
Sbjct: 420 A---VARAMEDSSEGETVLLAPAAASFDQYDSFEKRGEHFAQLV 460


>gi|254441842|ref|ZP_05055335.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Octadecabacter
           antarcticus 307]
 gi|198251920|gb|EDY76235.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Octadecabacter
           antarcticus 307]
          Length = 465

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 159/470 (33%), Positives = 224/470 (47%), Gaps = 27/470 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  F   ++AV GLGRSGL+A  AL+  G +V+ WDD P A  +A D G+ + D  + 
Sbjct: 2   IPVQGFSGKTVAVLGLGRSGLAAVAALQAGGANVVVWDDAPDAETKAGDAGVTLKDLTKH 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             +  I+ L+ SPGIA      H  +  A      +  DI LF R         F S+  
Sbjct: 62  GAFKDIACLITSPGIAHLYPAPHPAIARAMAEGCPVDNDIGLFFRSFATSEWDEFDSIPK 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
             IAVTG+NGKS+T ALI H+L   G  VQLGGNIG  +L+L+        V+E SSYQI
Sbjct: 122 -VIAVTGSNGKSTTSALIYHILEHAGRPVQLGGNIGRGVLDLDEAHDGEVIVLELSSYQI 180

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAY 231
           +L   + P + V  N++PDHLDRH     Y   K+++        A+I +++ +   IA 
Sbjct: 181 DLARALTPDVAVFTNLTPDHLDRHAGHGGYFAAKRRLFAEGGPDRAVIGVDEAEGHYIAN 240

Query: 232 DMNFIGHSISRI----SSQSLQSDS-DLYIDESFLKCSATSEVIFDFSQET-----KKHN 281
            ++  G S  R+    S Q L      ++  + FL        +              HN
Sbjct: 241 QLSE-GPSDDRVIRVSSGQKLDGIGWSVFARKRFLNEYRKGRQVGSIDLRAIAGLPGVHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +   C  LG+    I+ AL+S  GL HR Q IA    V F+NDSKATN+ +   
Sbjct: 300 HQNACAAYAACRALGIGPRVIEAALISFKGLPHRSQLIAEHAGVRFVNDSKATNVDAAAK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A      ++ WI GGL K      L P    + KAY IG  A  F      K+     + 
Sbjct: 360 ALAAFD-KVRWICGGLEKDGGLDALLP-APTVVKAYVIGREAAAFAM----KLKGLDVEV 413

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                 +V +   + Q    VL +P  ASFDQY+NF  RG  F + V+ +
Sbjct: 414 CGDMATAVTQAAADAQAGETVLLAPAAASFDQYDNFERRGDDFAACVAGL 463


>gi|254465031|ref|ZP_05078442.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacterales
           bacterium Y4I]
 gi|206685939|gb|EDZ46421.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacterales
           bacterium Y4I]
          Length = 463

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 149/469 (31%), Positives = 226/469 (48%), Gaps = 33/469 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +  +    +AV GLGRSGL+ A A++  G   + WDD+P A + A+  G    D  + 
Sbjct: 2   IPVKGYEGAKLAVLGLGRSGLATARAVRAGGAEALCWDDNPAAREAAEAEGFTCRDLHKA 61

Query: 61  -PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL------QS 113
             +  ++ L+ SPGI       +  ++ A +  V +  DI LF R   F+        Q 
Sbjct: 62  GAFDDVAALITSPGIPHLYPKPNPVIRAALEAGVPVDNDIGLFFRS--FADADWQMHDQP 119

Query: 114 P-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
           P  +AVTG+NGKS+TVAL+ H+L++ G + QL GNIG  +L+++        V+E SSYQ
Sbjct: 120 PRVVAVTGSNGKSTTVALLHHILQEAGRESQLAGNIGRGVLDIDPPGEGGVVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCE----- 227
            EL   + P + V  N+SPDHLDRH  +  Y   K+++   +          +       
Sbjct: 180 TELARALTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEADRTAPSSASTRTRGCFWR 239

Query: 228 ---KIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLK-----CSATSEVIFDFSQETKK 279
              + A D   I     +++    Q    ++  + FL        A S  + + +     
Sbjct: 240 PAVRRASDDRVIASRARKLTGPGWQ----VFARKGFLSEYRKGRQAASIDLREMTGLPGA 295

Query: 280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV 339
           HN QN   +      LGL    I  A+ +  GL HR QTIA    V ++NDSKATNL S 
Sbjct: 296 HNHQNACAAYAAARTLGLAPRVIGDAMATFPGLPHRSQTIAEAAGVRYVNDSKATNLDSA 355

Query: 340 IHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLS 399
           + A L+  + I WI GGL K      L      + KAY IG  A  F       + + + 
Sbjct: 356 VKA-LSAFKNIRWICGGLEKDGGLEALKGQTGNVQKAYVIGREAAGFALQL--DVEAEVC 412

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
            T+  A++   R + + Q    VL +P  ASFDQY+NF +RG  F+++V
Sbjct: 413 TTMAAAVE---RAMADAQAGDTVLLAPAAASFDQYDNFEQRGEDFVAEV 458


>gi|157825688|ref|YP_001493408.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           akari str. Hartford]
 gi|157799646|gb|ABV74900.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           akari str. Hartford]
          Length = 492

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 152/497 (30%), Positives = 244/497 (49%), Gaps = 73/497 (14%)

Query: 9   HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM------GIEVIDFREIPW 62
             I VFGLG++G+S    L      +I +DD    +K  +D+         ++   ++ W
Sbjct: 7   QKIGVFGLGKTGMSVYEELH-GKCDIIIYDD----LKANRDIFEKLYSKSAIVALSDLRW 61

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
             +  ++LSPG+ LT    H  V +A  FN+ +I DI+L   + +       FIA+TGTN
Sbjct: 62  QNLDKIILSPGVPLT----HKIVGIAKNFNIPVISDIDLLFEKSK----NLNFIAITGTN 113

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T ALISH+L  +G D Q+ GNIG+P L  +  +    YV+E SS+Q++L       
Sbjct: 114 GKSTTTALISHILNSSGLDYQVAGNIGVPALQAK--ASKDGYVLELSSFQLDLVKIFTAK 171

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI------AYDM 233
           I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C +I         +
Sbjct: 172 IAVLLNITPDHLDRHQHMNGYIAAKSKIFDRMDKDSYAVINIDNDYCREIFITLQQEQRI 231

Query: 234 NFIGHSISRISSQSL----QSDSDLYIDESFLKCSATSEVIF--DFSQETKK-------- 279
             +  S+++I    +       +D + D+   +C   SE     +F  E  +        
Sbjct: 232 KLVPFSVTKILENCISVVDNKINDNFFDDIRFECQYNSESFRQNEFQGEPAERIKVCEHR 291

Query: 280 -------------------------HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTH 314
                                    HN +N+  S  V   +G++ ++I  ++     L H
Sbjct: 292 LDLQNSLVSNFLNDAVPFNNNLQGTHNDENIAASYAVAKIIGVEPKKILESISGFQSLPH 351

Query: 315 RLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIA 374
           R+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      + P+ SKI 
Sbjct: 352 RMQYICSINNINFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKDGGIECIKPYFSKIK 410

Query: 375 KAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVLFSPGCASFD 432
           KAYF G +  +F +     ++  +   L+QA     +D   +N +L +I+L +P C+S+D
Sbjct: 411 KAYFYGQAKEIFANTTKNIVDFVICDNLEQAFDLAYKDAVGDNAELKNILL-APSCSSYD 469

Query: 433 QYNNFRERGFSFMSQVS 449
           Q+ NF ERG  F+   S
Sbjct: 470 QFKNFAERGELFIKLCS 486


>gi|157964491|ref|YP_001499315.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           massiliae MTU5]
 gi|157844267|gb|ABV84768.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia
           massiliae MTU5]
          Length = 498

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 156/500 (31%), Positives = 248/500 (49%), Gaps = 75/500 (15%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S     I VFGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTAIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIEL-FVRERRFSSLQSPF 115
                W  +  +VLSPGI LT    H  V +A  FN+ I  DI+L F + +        F
Sbjct: 56  LSDSRWQNLDTIVLSPGIPLT----HEIVNIAKNFNIPITSDIDLLFAKSKNLK-----F 106

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TGTNGKS+T ALISH+L  +G D  + GNIG+  L  +  +    YV+E SS+Q++L
Sbjct: 107 IAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAK--ASKDGYVLELSSFQLDL 164

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKI--- 229
             T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C ++   
Sbjct: 165 VKTFTAKIAVLLNITPDHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIK 224

Query: 230 ---AYDMNFIGHSISRIS-------------------SQSLQSDSDLYIDESFLKCSATS 267
                 +  I  S+++I                    S  LQ +S+ +  + F    A  
Sbjct: 225 LQQEQRIKLIPFSVTKILENGISVVDDKISANFFDDISFELQRNSESFRQDEFQGEPAER 284

Query: 268 EVIFDFSQETKK--------------------HNIQNLVTSAVVCMQLGLKVEEIKRALL 307
             I +  ++ +                     HN +N+  S  V   +G++ ++I  ++ 
Sbjct: 285 IKIREHRRDLQNSLVSSFMHYAVPFNKNLQGVHNCENIAASYAVAKIIGVEPKKILESIS 344

Query: 308 SCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLF 367
           S   L HR+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      + 
Sbjct: 345 SFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKEGGIEEIK 403

Query: 368 PFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVLFS 425
           P+ S+I KAYF G +  +F +     ++  +   L+QA     +D   +N ++ +I+L +
Sbjct: 404 PYFSQIKKAYFYGQAKEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNAEVKNILL-A 462

Query: 426 PGCASFDQYNNFRERGFSFM 445
           P C+S+DQ+ NF ERG  F+
Sbjct: 463 PSCSSYDQFKNFEERGELFI 482


>gi|114327095|ref|YP_744252.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315269|gb|ABI61329.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 462

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 158/450 (35%), Positives = 223/450 (49%), Gaps = 19/450 (4%)

Query: 12  AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI--ISFLV 69
            V GLGR+GL AA AL   G  V  WDD   A  +A + G+ V      P S+  +  L+
Sbjct: 15  GVLGLGRNGLPAAQALVAMGADVTVWDDGEAARSEAGNAGLTVS-----PLSVEGLDALI 69

Query: 70  LSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVA 129
           LSPGI       H     A    V ++ D EL  +  R S  ++ F+ +TGTNGKS+T A
Sbjct: 70  LSPGIPHRLPKPHPVAVAALLAGVPVLSDAELLYQAVRLSGSRARFVGITGTNGKSTTTA 129

Query: 130 LISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNI 189
           L +H+LR+ G  V  GGN+G   L L     N  YV+E SSY +E   T+      +LN+
Sbjct: 130 LTAHILREAGCPVAAGGNLGPAALALPLLPDNGVYVLEMSSYMLERLQTLRFDAAAMLNL 189

Query: 190 SPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNFIGHSISRIS-- 244
           SPDH+DRH  +  Y   K++I    T +  A+I I+D     +A  +   GH  +RI+  
Sbjct: 190 SPDHIDRHGDMAGYETAKREIFQRQTGADLAVIGIDDPLSAAMAETLRKDGHP-ARIALV 248

Query: 245 SQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGLKVEE 301
           S +L  D+       F   +     I    Q       HN QN   +A + + LG+K E+
Sbjct: 249 SGALCGDTQAEYGMQFGTLTDMQGPILPMVQAAALPGAHNAQNAAVAAAITLFLGVKREQ 308

Query: 302 IKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSD 361
           +   + S  GL HR + IA    +++INDSKATN  S   A +  + RI WIAGG++K  
Sbjct: 309 VAAGVASFPGLPHRQERIAEADGILWINDSKATNADSTARALICHE-RILWIAGGIAKEG 367

Query: 362 DFSTLFPFISKIAKAYFIGNSAMLFFHHFGG-KINSTLSKTLDQALKSVVRDVENVQLPS 420
               L P + ++  A  IG  A +         +  T + TLD A+      V+     +
Sbjct: 368 GIEDLAPLLPRVTHALLIGRDAPILAETLRAHGVPHTDAGTLDNAVTMAAALVKESG-SN 426

Query: 421 IVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           IVL SP CASFDQ+ +F  RG  F S V +
Sbjct: 427 IVLLSPACASFDQFAHFEARGDHFRSLVQQ 456


>gi|238650901|ref|YP_002916757.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           peacockii str. Rustic]
 gi|238624999|gb|ACR47705.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           peacockii str. Rustic]
          Length = 500

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 249/502 (49%), Gaps = 77/502 (15%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S     I VFGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTAIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIEL-FVRERRFSSLQSPF 115
                W  +  +VLSPGI LT    H  V +A  FN+ I  DI+L F + +        F
Sbjct: 56  LSDSRWQNLDTIVLSPGIPLT----HEIVNIAKSFNIPITSDIDLLFAKSKNLK-----F 106

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TGTNGKS+T ALISH+L  +G D  + GNIG+  L  +  +    YV+E SS+Q++L
Sbjct: 107 IAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAK--ASKDGYVLELSSFQLDL 164

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYD 232
             T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C ++   
Sbjct: 165 VKTFTAKIAVLLNITPDHLDRHQDMPCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIK 224

Query: 233 MN------FIGHSISRIS-------------------SQSLQSDSDLYIDESFLKCSATS 267
           +        I  S+++I                    S  LQ +S+ +  + F    A  
Sbjct: 225 LQQEQRIKLIPFSVTQILENGISVVDDKISANFFDDISFELQHNSESFRQDEFQGEPAEP 284

Query: 268 EVI---------------------FDFSQETKK-HNIQNLVTSAVVCMQLGLKVEEIKRA 305
           E I                       F++  +  HN +N+  S  V   +G++ ++I  +
Sbjct: 285 ECIKIREHRQDLQNSLVSSFMHYAVPFNKNLQGIHNCENIAASYAVAKIIGVEPKKILES 344

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFST 365
           + S   L HR+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      
Sbjct: 345 ISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKEGGIEE 403

Query: 366 LFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVL 423
           + P+ S+I KAYF G +  +F +     ++  +   L+QA     +D   +N ++ +I+L
Sbjct: 404 IKPYFSQIKKAYFYGQAKEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNSEVKNILL 463

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            +P C+S+DQ+ NF ERG  F+
Sbjct: 464 -APSCSSYDQFKNFEERGELFI 484


>gi|34580522|ref|ZP_00142002.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia
           sibirica 246]
 gi|28261907|gb|EAA25411.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia
           sibirica 246]
          Length = 500

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 249/502 (49%), Gaps = 77/502 (15%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIE------VID 56
           ++S     I VFGLG++G+S    L++    VI +DD    +K  +D+  E      ++ 
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTVIVA 55

Query: 57  FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIEL-FVRERRFSSLQSPF 115
             +  W  +  +VLSPGI LT    H  V +A  FN+ I  DI+L F + +        F
Sbjct: 56  LSDSRWQNLDTIVLSPGIPLT----HEIVNIAKSFNIPITSDIDLLFAKSKNLK-----F 106

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TGTNGKS+T ALISH+L  +G D  + GNIG+  L  +  +    YV+E SS+Q++L
Sbjct: 107 IAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAK--ASKDGYVLELSSFQLDL 164

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYD 232
             T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C ++   
Sbjct: 165 VKTFTAKIAVLLNITPDHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIK 224

Query: 233 MN------FIGHSISRIS-------------------SQSLQSDSDLYIDESFLKCSATS 267
           +        I  S+++I                    S  LQ +S+ +  + F    A  
Sbjct: 225 LQQEQRIKLIPFSVAQILENGISVVDDKISANFFDDISFELQHNSESFRQDEFQGEPAEP 284

Query: 268 EVI---------------------FDFSQETKK-HNIQNLVTSAVVCMQLGLKVEEIKRA 305
           E I                       F++  +  HN +N+  S  V   +G++ ++I  +
Sbjct: 285 ECIKIRKHRQDLQNSLVSSFMHYAVPFNKNLQGVHNCENIAASYAVAKIIGVEPKKILES 344

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFST 365
           + S   L HR+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      
Sbjct: 345 ISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKEGGIEE 403

Query: 366 LFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVL 423
           + P+ S I KAYF G +  +F +     ++  +   L+QA     +D   +N ++ +I+L
Sbjct: 404 IKPYFSHIKKAYFYGQAKEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNAEVKNILL 463

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            +P C+S+DQ+ NF ERG  F+
Sbjct: 464 -APSCSSYDQFKNFEERGELFI 484


>gi|15892483|ref|NP_360197.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           conorii str. Malish 7]
 gi|30316098|sp|Q92I60|MURD_RICCN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|15619640|gb|AAL03098.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia conorii
           str. Malish 7]
          Length = 500

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 248/502 (49%), Gaps = 77/502 (15%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S     I VFGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTAIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIEL-FVRERRFSSLQSPF 115
                W  +  +VLSPGI LT    H  V +A  FN+ I  DI+L F + +        F
Sbjct: 56  LSDSRWQNLDTIVLSPGIPLT----HEIVNIAKSFNIPITSDIDLLFAKSKNLK-----F 106

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TGTNGKS+T ALISH+L  +G D  + GNIG+  L  +  +    YV+E SS+Q++L
Sbjct: 107 IAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAK--ASKDGYVLELSSFQLDL 164

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYD 232
             T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C ++   
Sbjct: 165 VKTFTAKIAVLLNITPDHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIK 224

Query: 233 MN------FIGHSISRIS-------------------SQSLQSDSDLYIDESFLKCSATS 267
           +        I  S+++I                    S  LQ +S+ +  + F    A  
Sbjct: 225 LQQEQRIKLIPFSVAQILENGISVVDDKISANFCDDISFELQHNSESFRQDEFQGEPAEP 284

Query: 268 EVI---------------------FDFSQETKK-HNIQNLVTSAVVCMQLGLKVEEIKRA 305
           E I                       F++  +  HN +N+  S  V   +G++ ++I  +
Sbjct: 285 ECIKIREHRQDLQNSLVSSFMHYAVPFNKNLQGVHNCENIAASYAVAKIIGVEPKKILES 344

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFST 365
           + S   L HR+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      
Sbjct: 345 ISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKEGGIEE 403

Query: 366 LFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVL 423
           + P+ S I KAYF G +  +F +     ++  +   L+QA     +D   +N ++ +I+L
Sbjct: 404 IKPYFSHIKKAYFYGQAKEIFANTAKNIVDFVICDNLEQAFDLAYKDAVGDNAEIKNILL 463

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            +P C+S+DQ+ NF ERG  F+
Sbjct: 464 -APSCSSYDQFKNFEERGELFI 484


>gi|332187168|ref|ZP_08388908.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomonas sp.
           S17]
 gi|332012868|gb|EGI54933.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomonas sp.
           S17]
          Length = 429

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 154/453 (33%), Positives = 212/453 (46%), Gaps = 34/453 (7%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQ-AKDMGIEVIDFREIPW 62
           S +   + AV GL RSG +   AL   G  V+AWD  P   +  A   G+ +    ++  
Sbjct: 5   SDWAGKTFAVLGLARSGAATVSALFAGGGRVVAWDSEPAKREAFAAHDGLSIAPLDDM-- 62

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
           S    LV+SPG+ L   N H     A    V +IGDIELF + R+        + +TGTN
Sbjct: 63  SGFDALVVSPGVPL---NTHPLAAAARAAGVPVIGDIELFAQARKNLPPHK-VVGITGTN 118

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T AL+ H+L+  G    +GGNIGLPIL          YV+E SSYQI+LT ++D  
Sbjct: 119 GKSTTTALVHHILKTAGVPTLMGGNIGLPILGQAPLPEGGVYVLELSSYQIDLTQSLDCD 178

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIAYDMNFIGHS 239
           + VLLNI+PDHLDR+     Y   K ++  M      A++   D     IA  +      
Sbjct: 179 VAVLLNITPDHLDRYDGFAGYAASKARLFAMQTAGHVAVVGTGDEASANIAQGLAGRTDD 238

Query: 240 ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           +  I+        D  ID+              +      HN QN   +  V   LG+  
Sbjct: 239 LVTIA-------PDTVIDQR------------RWPALHGPHNAQNAQAAIAVTRALGIDE 279

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK 359
             I+  L S   L HR+Q +A    V F+NDSKATN  S   A L    R++WI GG  K
Sbjct: 280 AAIEAGLASYASLPHRMQHVATRNGVAFVNDSKATNPESTAPA-LAAFPRVHWIVGGKRK 338

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST-LSKTLDQALKSVVRDVENVQL 418
            DD       +  +  AY IG +A LFF     K+     S TL+ A+          + 
Sbjct: 339 GDDLDACAAHLDHVVAAYTIGEAAPLFFDLLKDKVPVVEQSGTLEAAVVHA---AAAARP 395

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              VL SP CASFDQ+ ++  RG +F + V  +
Sbjct: 396 GDTVLLSPACASFDQFRDYEARGDAFRAAVEAL 428


>gi|157828435|ref|YP_001494677.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933147|ref|YP_001649936.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           rickettsii str. Iowa]
 gi|157800916|gb|ABV76169.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908234|gb|ABY72530.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia
           rickettsii str. Iowa]
          Length = 500

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 158/502 (31%), Positives = 249/502 (49%), Gaps = 77/502 (15%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S     I VFGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTAIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIEL-FVRERRFSSLQSPF 115
                W  +  +VLSPGI LT    H  V +A  FN+ I  DI+L F + +        F
Sbjct: 56  LSDSRWQNLDTIVLSPGIPLT----HEIVNIAKSFNIPITSDIDLLFAKSKNLK-----F 106

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TGTNGKS+T ALISH+L  +G D  + GNIG+  L  +  +    YV+E SS+Q++L
Sbjct: 107 IAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAK--ASKDGYVLELSSFQLDL 164

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYD 232
             T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C ++   
Sbjct: 165 VKTFTAKIAVLLNITPDHLDRHQDMPCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIK 224

Query: 233 MN------FIGHSISRIS-------------------SQSLQSDSDLYIDESFLKCSATS 267
           +        I  S+++I                    S  LQ +S+ +  + F    A  
Sbjct: 225 LQQEQRIKLIPFSVTQILENGISVVDDKISANFFDDISFELQHNSESFRQDEFQGEPAEP 284

Query: 268 EVI---------------------FDFSQETKK-HNIQNLVTSAVVCMQLGLKVEEIKRA 305
           E I                       F++  +  HN +N+  S  V   +G++ ++I  +
Sbjct: 285 ECIKIREHRQNLHNSLVSSFMHYTVPFNKNLQGVHNCENIAASYAVAKIIGVEPKKILES 344

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFST 365
           + S   L HR+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      
Sbjct: 345 ISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKEGGIEE 403

Query: 366 LFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVL 423
           + P+ S+I KAYF G +  +F +     ++  +   L+QA     +D   +N ++ +I+L
Sbjct: 404 IKPYFSQIKKAYFYGQAKEIFANTAKHIVDFVICDNLEQAFDLAYKDAVGDNAEVKNILL 463

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            +P C+S+DQ+ NF ERG  F+
Sbjct: 464 -APSCSSYDQFKNFEERGELFI 484


>gi|163732135|ref|ZP_02139581.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter
           litoralis Och 149]
 gi|161394433|gb|EDQ18756.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter
           litoralis Och 149]
          Length = 464

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 154/469 (32%), Positives = 232/469 (49%), Gaps = 27/469 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +   R   +AV GLGR+G+SAA ALK+ G   + WDD+P A  +A++ G +   FR +
Sbjct: 2   IPVQGLRGAKVAVLGLGRTGMSAARALKEGGALALCWDDNPDARARAQNEGFDCTPFRSV 61

Query: 61  P-WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS-------LQ 112
             +  I+ L++SPGI       +  V+LA Q  V +  DI LF +   F++       + 
Sbjct: 62  SDFDDIARLIVSPGIPHLYPAPNPVVRLALQAGVPVDNDIGLFFQS--FATEDWSNFDIA 119

Query: 113 SPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
              +AVTG+NGKS+T ALI H+L   G    L GNIG  +L+++        V+E SSYQ
Sbjct: 120 PRVVAVTGSNGKSTTSALIHHILEHVGRPATLAGNIGRGVLDIDPPHDGEVVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIA 230
            +L  ++ P + V  N+S DHLDRH  +  Y   K+++        AI+ +++ +   +A
Sbjct: 180 TDLARSLTPDVAVFTNLSEDHLDRHGGMGGYFAAKRRLFAEGGPDRAIVGVDEDEGLSLA 239

Query: 231 YDM--NFIGHSISRIS-SQSLQSDS-DLYIDESFLKCSATSEVIFDFSQETKK-----HN 281
             +        + RIS +Q L      ++  + FL      + I      +       HN
Sbjct: 240 GQLAEGRADDRVIRISVAQKLTGPGWQVFARKGFLSEYRKGKQIASIDLRSVPGLPGVHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +  VC  LGL  + I+ AL S  GL HR Q +     V F+NDSKATN  +   
Sbjct: 300 HQNACAAYAVCRSLGLAPKVIEAALHSFQGLPHRSQLVGEKDGVRFVNDSKATNADAAAK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A       I WI GGL K      L    + + KAY IG  A  F       + + +  T
Sbjct: 360 ALAAFP-SIRWICGGLEKDGGMDALRDASASVVKAYVIGREAAAFAMKL--PVEAEICTT 416

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           + QA++   R+ E      +VL +P  ASFDQY+NF +RG  F  +V++
Sbjct: 417 MAQAVEKAAREAE---AGDVVLLAPAAASFDQYDNFEQRGDDFTQEVAK 462


>gi|148556850|ref|YP_001264432.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomonas
           wittichii RW1]
 gi|148502040|gb|ABQ70294.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sphingomonas
           wittichii RW1]
          Length = 495

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 234/500 (46%), Gaps = 63/500 (12%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM-------------- 50
           +F     AV GL RSGL+   AL  SG  V AWD +  A ++   M              
Sbjct: 6   AFAGKHYAVLGLARSGLATVEALLASGAKVTAWDSNEAARQKILPMRSMGRGTGEAGGGG 65

Query: 51  ------------------------GIEVI--DFREIPWSIISFLVLSPGIALTGENAHWC 84
                                   G +++  D  EI  +  + +V+SPG+ L   N H  
Sbjct: 66  DSEAGAARHPLHHPADGPPPPAARGEDLVLADPIEIDLTGYAGVVVSPGVPL---NRHPI 122

Query: 85  VKLANQFNVEIIGDIELFVRERRFSSLQS-PFIAVTGTNGKSSTVALISHVLRKNGYDVQ 143
              A  F V +I DIELF + R  +SL +   + +TGTNGKS+T ALI+H+L   G    
Sbjct: 123 AGHAASFGVPVISDIELFAQAR--ASLPAHKVVGITGTNGKSTTTALIAHILETAGVPTL 180

Query: 144 LGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENY 203
           +GGNIGLPIL  +       YV+E SSYQI++T ++D  + VL NI+PDHLDR+     Y
Sbjct: 181 MGGNIGLPILGRDPLPAGGVYVLELSSYQIDITQSLDCDVAVLTNITPDHLDRYDGFAGY 240

Query: 204 VNIKKKIVTMSKHAIICI---NDHQCEKIAYDMNFIGHSISRISSQSLQSD-----SDLY 255
              K ++ TM    I  I   ++   E I    N   H  S   + + Q +     S + 
Sbjct: 241 AASKLRLFTMQGKGISVIAGDDEPSVEIINALRNRPIHPASLSWATTEQGEQRPVISRVE 300

Query: 256 IDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHR 315
           +       S++ +   ++      HN QN   +   C  LGL   +I + L S  GL HR
Sbjct: 301 MGRVMRVMSSSLQGQENWPALQGPHNAQNAALAIETCRLLGLSYSQIDQGLRSYPGLPHR 360

Query: 316 LQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK 375
           +Q +A    V+F+NDSKATN  +     L    +I+WI GGL K+DD     P+   +  
Sbjct: 361 MQRVAEKRGVLFVNDSKATNA-TATAPALGAYPKIHWILGGLPKTDDLDDCAPWFGHVVA 419

Query: 376 AYFIGNSAMLF---FHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFD 432
            Y IG +  +F       G  +  T S TLDQA+          +   +V+ SP CASFD
Sbjct: 420 GYTIGQAGPMFARILREAGKPV--TESGTLDQAVADAAAAARPGE---VVMLSPACASFD 474

Query: 433 QYNNFRERGFSFMSQVSEIP 452
           Q++++  RG +F   V  +P
Sbjct: 475 QFSDYEARGDAFRRAVEGLP 494


>gi|218679971|ref|ZP_03527868.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhizobium
           etli CIAT 894]
          Length = 319

 Score =  219 bits (557), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 129/308 (41%), Positives = 184/308 (59%), Gaps = 8/308 (2%)

Query: 140 YDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHT 199
           YD QLGGNIG  +L L+     R+YV+ECSSYQI+L PT+DPS G+LLN++PDHLDRH T
Sbjct: 1   YDTQLGGNIGTAVLTLDPPKAERYYVVECSSYQIDLAPTLDPSAGILLNLTPDHLDRHGT 60

Query: 200 LENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDES 259
           +++Y ++K+++V  S  AI+ I+D     IA  +   G  + RIS +++ + S +Y + S
Sbjct: 61  MQHYADVKERLVAGSDTAIVGIDDSHSALIADRVERAGVKVVRISRRNVVA-SGIYAEGS 119

Query: 260 FLKCSATSEVI----FDFSQETK-KHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTH 314
            L  +    ++     D  Q  +  HN QN   +   C+ +G+  ++I+  L S  GL H
Sbjct: 120 KLVQAGGGAMLPFADLDGIQTLRGSHNAQNAAAAVAACLAVGVSADDIRAGLASFPGLKH 179

Query: 315 RLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIA 374
           R+Q + + G V+F+NDSKATN        L+   RIYWIAGGL KS   +TL P+   IA
Sbjct: 180 RMQPVGKRGRVVFVNDSKATNA-DAAAPALSSYDRIYWIAGGLPKSGGITTLAPYFPHIA 238

Query: 375 KAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQL-PSIVLFSPGCASFDQ 433
           KAY IG +A  F    G  +   +S TL++A+     D E  +   S V+ SP CASFDQ
Sbjct: 239 KAYLIGEAAAEFAATLGEAVPYEISGTLERAVAHAAADAERDESGSSAVMLSPACASFDQ 298

Query: 434 YNNFRERG 441
           Y NFR +G
Sbjct: 299 YKNFRSQG 306


>gi|255264765|ref|ZP_05344107.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thalassiobium sp.
           R2A62]
 gi|255107100|gb|EET49774.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Thalassiobium sp.
           R2A62]
          Length = 468

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 160/470 (34%), Positives = 239/470 (50%), Gaps = 26/470 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +   ++AV GLGRSGL+AA AL + G  V+ WDD   + + A+  G+ V D  ++
Sbjct: 2   IPVRGYNGTTVAVLGLGRSGLAAAAALAEGGAQVVVWDDGAASREAAEAEGLTVRDLTKQ 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             +  +S L++SPGI       +  +  A    V +  DI LF R        RF  +  
Sbjct: 62  GGFDGVSALIVSPGIPHLYPEPNKTIAAAWAAGVPVDNDIGLFFRSYATGDWDRFD-VAP 120

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
             +AVTG+NGKS+T ALI H+L + G   QL GNIG  +L+++        V+E SSYQ 
Sbjct: 121 QVVAVTGSNGKSTTSALIHHILTEVGRPTQLAGNIGRGVLDIDPAIDGEVVVLELSSYQT 180

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAY 231
           +L  ++ P I V  N+SPDHLDRH  +  Y   K+++      + A+I +++ + + ++ 
Sbjct: 181 DLARSLTPDIAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPERAVIGVDEVEGQYLSN 240

Query: 232 DMNFIGHSISRI----SSQSLQSDS-DLYIDESFLK-----CSATSEVIFDFSQETKKHN 281
            M   G   SRI      + LQ    +++  + FL        A S  + D       HN
Sbjct: 241 QM-MDGMDPSRIIQISVDRKLQGPGWNIFARKGFLSEYRNGRQAGSIDLRDIIGLPGAHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +   C  LGL  + I++AL S GGL HR Q IA    V ++NDSKATN+ S   
Sbjct: 300 HQNACAAYAACRSLGLAPKVIEQALHSFGGLPHRSQQIADQDGVRYVNDSKATNVDSAAK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A L   + I WI GGL K    + L   +  + KAY IG  A  F     G + + +  T
Sbjct: 360 A-LAAFKNIRWICGGLEKEGGLTGLKDQLGAVRKAYVIGREAASFARQLEG-VETQICTT 417

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           + +A+ +  +D E       VL +P  ASFDQY++F +RG  F  QV  +
Sbjct: 418 IQEAVAAAYQDAE---AGDTVLLAPAAASFDQYDSFEKRGDDFAEQVQSV 464


>gi|86137685|ref|ZP_01056262.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           MED193]
 gi|85826020|gb|EAQ46218.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           MED193]
          Length = 465

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 161/471 (34%), Positives = 234/471 (49%), Gaps = 33/471 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  F   ++AV GLGRSGL+ A AL   G   I WDD   A + A+  G E+ D  R+
Sbjct: 2   IPVQGFEGANVAVLGLGRSGLATARALLAGGATPICWDDQLQARETAEAEGFELRDLHRQ 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL-------- 111
             +  I+ LV SPGI       +  ++ A +  V +  DI LF     F+SL        
Sbjct: 62  GAFDDIAALVTSPGIPHLYPQPNPVIRAALEVGVPVDNDIGLF-----FASLPAQGWDML 116

Query: 112 -QSP-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECS 169
            Q P  +A+TG+NGKS+TVAL+ H+L   G D Q+ GNIG  +L+++        V+E S
Sbjct: 117 DQPPKVVAITGSNGKSTTVALLHHILESVGRDSQMAGNIGRGVLDIDPPGEAGVVVLELS 176

Query: 170 SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCE 227
           SYQ EL   + P + +L N+SPDHLDRH  L  Y   K+++        AII +++ +  
Sbjct: 177 SYQTELARALTPDVAILTNLSPDHLDRHAGLGGYFAAKRRLFAEGGPDRAIIGVDEDEGL 236

Query: 228 KIAYDMNFIGHS---ISRISSQSLQSDS-DLYIDESFLKCSATSEVI--FDFSQET---K 278
            +A  M+        I   S + L      ++  + FL        +   D  Q T    
Sbjct: 237 FLAGQMSQAASDDRVIRVASGRKLTGPGWQVFARKGFLSEMRKGRQVASIDLRQMTGLPG 296

Query: 279 KHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHS 338
            HN QN   +      LGL    I+ AL +  GL HR QT+A +  V ++NDSKATNL S
Sbjct: 297 AHNHQNACAAYAAARVLGLAPRVIEAALATYPGLPHRSQTVAEVAGVRYVNDSKATNLDS 356

Query: 339 VIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL 398
            I A L+  + I WI GGL K      L      + KAY IG  A  F       + + +
Sbjct: 357 AIKA-LSAFKNIRWICGGLEKEGGLGALTGQTGAVRKAYVIGREAAGFAMQL--DVEAEV 413

Query: 399 SKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
             T++   ++V   V   +   +VL +P  ASFDQY+NF +RG  F+++V+
Sbjct: 414 CTTME---RAVACAVAEAEPGDVVLLAPAAASFDQYDNFEQRGDDFIAEVT 461


>gi|229586685|ref|YP_002845186.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rickettsia
           africae ESF-5]
 gi|228021735|gb|ACP53443.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsia africae
           ESF-5]
          Length = 500

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 155/502 (30%), Positives = 250/502 (49%), Gaps = 77/502 (15%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP- 61
           ++S     I VFGLG++G+S    L++    VI +DD    +K  +D+  E+     I  
Sbjct: 1   MNSHTKQKIGVFGLGKTGISVYEELQNK-YDVIVYDD----LKANRDIFEELYSKTAIAA 55

Query: 62  -----WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIEL-FVRERRFSSLQSPF 115
                W  +  +VLSPGI LT    H  V +A  F++ I  DI+L F + +        F
Sbjct: 56  LSDSRWQNLDTIVLSPGIPLT----HEIVNIAKSFSIPITSDIDLLFAKSKNLK-----F 106

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TGTNGKS+T ALISH+L  +G D  + GNIG+  L  +  +    YV+E SS+Q++L
Sbjct: 107 IAITGTNGKSTTTALISHILNSSGLDYPVAGNIGVSALQAK--ASKDGYVLELSSFQLDL 164

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI---VTMSKHAIICINDHQCEKIAYD 232
             T    I VLLNI+PDHLDRH  +  Y+  K KI   +    +A+I I++  C ++   
Sbjct: 165 VKTFTAKIAVLLNITPDHLDRHQDMTCYIAAKSKIFDRMDQESYAVINIDNDYCREVFIK 224

Query: 233 MN------FIGHSISRISSQSL-----QSDSDLYIDESF-LKCSATSEVIFDFSQETKK- 279
           +        I  S+++I    +     +  ++ + D SF L+ ++ S   ++F  E  + 
Sbjct: 225 LQQEQRIKLIPFSVAQILENGISVVDDKISANFFDDISFELQHNSESLRQYEFQGEPVEP 284

Query: 280 ----------------------------------HNIQNLVTSAVVCMQLGLKVEEIKRA 305
                                             HN +N+  S  V   +G++ ++I  +
Sbjct: 285 ECIKIREHRQDLQNSLVSSFMHYAVPFNKNLQGVHNCENIAASYAVAKIIGVEPKKILES 344

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFST 365
           + S   L HR+Q I  + ++ F NDSKATN  S + + +     IYW+AGG+ K      
Sbjct: 345 ISSFQSLPHRMQYIGSINNISFYNDSKATNAISAVQS-IKALDNIYWLAGGIPKEGGIEE 403

Query: 366 LFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV--ENVQLPSIVL 423
           + P+ S I KAYF G +  +F +     ++  +   L+QA     +D   +N ++ +I+L
Sbjct: 404 IKPYFSHIKKAYFYGQAKEIFANTAKNIVDFIICDNLEQAFDLAYKDAVGDNAEVKNILL 463

Query: 424 FSPGCASFDQYNNFRERGFSFM 445
            +P C+S+DQ+ NF ERG  F+
Sbjct: 464 -APSCSSYDQFKNFEERGELFI 484


>gi|84686334|ref|ZP_01014228.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665517|gb|EAQ11993.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacterales
           bacterium HTCC2654]
          Length = 466

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 150/466 (32%), Positives = 232/466 (49%), Gaps = 24/466 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +    +AV GLGRSGL+ A AL+  G   + WDD   A  +A+  G+ + D  R 
Sbjct: 2   IPVHGYEGEKVAVLGLGRSGLATARALQAGGAIPLCWDDGAEARARAEAAGLTLHDLGRR 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE---RRFSSLQSP-- 114
             +  ++ L+ SPGI       +  +  A +  + +  DI LF R      +  +  P  
Sbjct: 62  EAFEGVAALITSPGIPHLYPETNKHIARAYKAGIPVDNDIGLFFRSLGSGAWDEMDQPPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            +AVTG+NGKS+T ALI H+L+  G   QL GNIG  +L++E        V+E SSYQ +
Sbjct: 122 VVAVTGSNGKSTTSALIHHILKVAGKPAQLAGNIGRGVLDIEPPIDGEVIVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L   + P + V  N+SPDHLDRH     Y   K+++        A++ +++ +   +A  
Sbjct: 182 LARALTPDVAVFTNLSPDHLDRHGGPGGYFAAKRRLFAEGGPDRAVVGVDEPEGLFLAGQ 241

Query: 233 MNFIGHSISRISSQSLQSDSD-----LYIDESFLKCSATSEVIFDFSQET-----KKHNI 282
           +  +G    R+   S+          +Y  + FL  +   + +      T       HN 
Sbjct: 242 LA-MGPGDDRVIRVSVDEKLTGPGWLVYARKGFLSETRKGKQVGSIDLRTIASLPGTHNH 300

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           QN   +  VC  LGL  + I++A  S  GL HR Q +A  G V ++NDSKATN+ + + A
Sbjct: 301 QNACCAYAVCRTLGLSPKVIEQAFHSFAGLPHRSQLVAEAGGVRYVNDSKATNVDAALMA 360

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L   R I WI GGL K    S L   +  +AKAY IG  A  F     G + + +  T+
Sbjct: 361 LL-AFRNIRWIVGGLQKEGGLSGLAEGLPNVAKAYVIGREAEAFARDL-GAVEAQVCTTM 418

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           + A+ +    + + Q    VL +P  ASFDQY++F +RG  F+++V
Sbjct: 419 EAAVAAA---MADAQSGDTVLLAPAAASFDQYDSFEKRGEDFIARV 461


>gi|85707764|ref|ZP_01038830.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erythrobacter sp.
           NAP1]
 gi|85689298|gb|EAQ29301.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erythrobacter sp.
           NAP1]
          Length = 460

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 150/461 (32%), Positives = 220/461 (47%), Gaps = 36/461 (7%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           S+F +   A+ GL RSG +AA AL  SG  +  WD    A +   +   ++ D  E   +
Sbjct: 5   SAFADKRFAILGLARSGAAAAEALLASGAKLTVWDRQDVA-RAPFEGRCDIADPLETELT 63

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
               +V+SPG+ L   N H     A QF+V +IGDIELF R R    L    + +TGTNG
Sbjct: 64  GFDGVVVSPGVPL---NTHPIAGHAAQFSVPVIGDIELFARARA-DLLPHKVVGITGTNG 119

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR----FYVIECSSYQIELTPTI 179
           KS+TVAL+ H+L+  G    LGGNIG PI+  E  +P       YV+E SSYQI+LT ++
Sbjct: 120 KSTTVALVHHILQMAGIPSLLGGNIGEPIMAQEPLAPGEGGEGVYVLELSSYQIDLTTSL 179

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIA--YDMNFIG 237
           D  +  L NI+PDHLDR+     Y   K+++  M     + +     E +   Y      
Sbjct: 180 DCEVAALTNITPDHLDRYDGFAAYAAAKERLFKMQSPRNLAVFGSLEEPVGAIYRRQIEF 239

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
               R  +  L +  D   +   L+                 HN++N+  +  +  +LG+
Sbjct: 240 RGEGRAQAADLDALRDRQANWPSLQ---------------GPHNLENVAVAVAIVEELGV 284

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR------RIY 351
              +   A+    GL HR++ +     V+FINDSKATN  +   A     R      RI+
Sbjct: 285 TEAQWSHAIPRFRGLPHRMEIVCEEEGVLFINDSKATNTDASAPALAAYPRGEADRPRIH 344

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           WI GGL+K D        +  IA AY +G +   F     G++       L   +   VR
Sbjct: 345 WIVGGLAKEDGLGKCAEHLGDIAVAYTVGEAGPRFAELLEGEVPKVERCEL---VSEAVR 401

Query: 412 DVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             ++  +   +VLFSP CASFDQ+ ++ +RG  F   V  I
Sbjct: 402 RAKDAAVAGDVVLFSPACASFDQFRDYEKRGEHFRQLVGVI 442


>gi|163746127|ref|ZP_02153486.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanibulbus
           indolifex HEL-45]
 gi|161380872|gb|EDQ05282.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanibulbus
           indolifex HEL-45]
          Length = 466

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 162/471 (34%), Positives = 231/471 (49%), Gaps = 31/471 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +       +AV GLGRSGLSAA AL+  G  V  WDD P A  +A+  G   +D    
Sbjct: 2   IPVQGLEGARVAVLGLGRSGLSAARALQAGGAKVSCWDDDPAARARAEGEGFACVDLNS- 60

Query: 61  PWSI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ------ 112
           P ++  I+ L++SPGI       +  V  A    V +  DI LF +   F++L       
Sbjct: 61  PGALDKITRLIVSPGIPHLYPAPNPVVAAALVAGVPVDNDIGLFFQS--FATLAWDHYDV 118

Query: 113 SP-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSY 171
           +P  +AVTG+NGKS+T ALI H+L   G   QL GNIG  +L+L+        V+E SSY
Sbjct: 119 APRVVAVTGSNGKSTTSALIHHILEHVGRPCQLAGNIGRGVLDLDPAVDGEVVVLELSSY 178

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKI 229
           Q EL   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +
Sbjct: 179 QTELARALTPDVAVFTNLSPDHLDRHAGMGGYYAAKRRLFAEGGPDRAVIGVDEAEGRFL 238

Query: 230 AYDMNFIGHS---ISRISSQSLQSDS--DLYIDESFLKCSATSEVIFDFSQET-----KK 279
           A  ++  G S   + RIS+++  S     ++  + FL      + +      +       
Sbjct: 239 AGQLSE-GPSDDRVIRISAETKLSGPGWQVFARKGFLSEYRRGKQVGSIDLRSIQGLPGA 297

Query: 280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV 339
           HN QN   +   C  LGL    I+ A  S GGL HR QT+A    V ++NDSKATN+ S 
Sbjct: 298 HNHQNACAAYAACRALGLAPRVIEAAFHSFGGLPHRSQTVAEANGVRYVNDSKATNVDSA 357

Query: 340 IHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLS 399
             A L   R I WI GGL K      L      + KAY IG  A  F         +T +
Sbjct: 358 AKA-LAAFRNIRWICGGLEKEGGLKGLAEAQGSVRKAYVIGREAAHFAMQL-----TTEA 411

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           +      K+V R     +   +VL +P  ASFDQY+NF  RG  F++QV +
Sbjct: 412 EVCGTMEKAVARAAAEAEEGDVVLLAPAAASFDQYDNFERRGEDFVAQVQK 462


>gi|189183580|ref|YP_001937365.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Orientia
           tsutsugamushi str. Ikeda]
 gi|189180351|dbj|BAG40131.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Orientia
           tsutsugamushi str. Ikeda]
          Length = 472

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 232/472 (49%), Gaps = 37/472 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           ++L S RN  I VFGL R+GL A C        +I +DD P +        I   D++ I
Sbjct: 2   IRLYSQRNKKIGVFGLSRTGL-AVCKSLAGLADLIVYDDSPDSRNSFYKHNISSKDYKMI 60

Query: 61  -----PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPF 115
                 W +  F++LSPGI       H  +K A ++N+ I  DI+L   E         +
Sbjct: 61  NIDQPEWQVCDFIILSPGIPYY-TTPHPIIKHAQKYNIPIKSDIDLLYNEYP----NRKY 115

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           I +TGTNGKS+T  LI H+L        LGGNIG  +L+L   +    YV+E SS+Q++L
Sbjct: 116 IGITGTNGKSTTSTLIHHILTLTNGKFDLGGNIGKAVLSLR--NNVEGYVLELSSFQLDL 173

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIA-YDMN 234
              +   I VLLNI+ DH+DR+++ + Y+  K+KI++++      +   +C  I+  + N
Sbjct: 174 ITDLKLDIAVLLNITADHIDRYYSFDQYILSKQKILSLATKNGYALISKECSIISNANYN 233

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET----------------- 277
            +  S  R ++ SL+      I+   L  S   E I   SQ T                 
Sbjct: 234 TLYASKFRNTTCSLELIKKA-INTDELNKSIADESINCQSQPTLVKFSSHLPQHINFTSL 292

Query: 278 --KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATN 335
              KHN QN+  +   C  LG    +I  A+     L HR+Q I +  ++   NDSKATN
Sbjct: 293 LLGKHNNQNIAAAFYACKILGRNEYDITSAINQFQPLPHRMQYIGKKNNIHIYNDSKATN 352

Query: 336 LHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKIN 395
             +   A L     IYWIAGG++K    +++   + ++ KAY  G S         G + 
Sbjct: 353 ADAASKALL-SLSNIYWIAGGVAKEGGVNSIVNTLYEVKKAYLYGQSRYALAETLKGVVA 411

Query: 396 STLSKTLDQALKSVVRDVENVQ--LPSIVLFSPGCASFDQYNNFRERGFSFM 445
            +++ T+++A    + D E+ Q  L   +LF+P CASFDQ+ NF +RG  F+
Sbjct: 412 FSINNTMEEAFNQAIIDAESDQSGLDKNILFAPACASFDQFKNFEDRGNQFI 463


>gi|254488363|ref|ZP_05101568.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           GAI101]
 gi|214045232|gb|EEB85870.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter sp.
           GAI101]
          Length = 464

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 163/471 (34%), Positives = 230/471 (48%), Gaps = 35/471 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +       +A+ GLGRSGLSAA AL   G   + WDD+P A  +A   G E +D  + 
Sbjct: 2   IPVQGLAGAKVAILGLGRSGLSAARALAAGGATPVCWDDNPAARDKAGAEGFECLDLMKA 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL------QS 113
             +  ++ L++SPGI       +  +  A    V +  DI LF +   F++       Q 
Sbjct: 62  GAFDDVARLIVSPGIPHLYPAPNPVIVAAQDAGVAVDNDIGLFFQS--FATQDWDGFDQM 119

Query: 114 P-FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
           P  IAVTG+NGKS+T ALI H+L+  G   QL GNIG  +L++E        V+E SSYQ
Sbjct: 120 PKIIAVTGSNGKSTTSALIHHILKHAGRPTQLAGNIGRGVLDIEPAIDGEVVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICIND------- 223
            +L   + P I V  N+SPDHLDRH  +  Y   K+++        AII +++       
Sbjct: 180 TDLARNLTPDIAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAIIGVDEAEGRYLA 239

Query: 224 HQCEKIAYDMNFIGHSISR-ISSQSLQSDSDLYIDESFLKCSATSEVI--FDFSQET--- 277
            Q  + A D   I  S+ R +S    Q    ++  + FL      + +   D    T   
Sbjct: 240 GQLSEGAADDRVIRVSVDRKLSGPGWQ----VFARKGFLSEYRKGKQVGSIDLRGVTGLP 295

Query: 278 KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLH 337
             HN QN   +   C  LG   + I+ A  S GGL HR QTI  L  + F+NDSKATN+ 
Sbjct: 296 GAHNHQNACAAYAACRSLGFAPKVIEAAFASFGGLPHRSQTIGELRGIRFVNDSKATNVD 355

Query: 338 SVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST 397
           S + A L   R I WI GGL K      L   +  + KAY IG  A  F    G  + + 
Sbjct: 356 SAVKA-LAAFRNIRWICGGLEKDGGLGVLTAPLETVRKAYVIGREAAQFAMKLG--VEAE 412

Query: 398 LSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           +  T+D A+      V   +   +VL +P  ASFDQY++F  RG  F++QV
Sbjct: 413 VCGTMDVAVARA---VAEAEAGDVVLLAPAAASFDQYDSFERRGEDFIAQV 460


>gi|254450302|ref|ZP_05063739.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Octadecabacter
           antarcticus 238]
 gi|198264708|gb|EDY88978.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Octadecabacter
           antarcticus 238]
          Length = 465

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 158/470 (33%), Positives = 224/470 (47%), Gaps = 27/470 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  F   ++AV GLGRSGL+A  AL+  G  V+ WDD P A  +A D G+ + +  + 
Sbjct: 2   IPVQGFSGKTVAVLGLGRSGLAAVAALQAGGAEVVVWDDSPDAETKAADAGVTLTNLTKH 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE------RRFSSLQS 113
             +  I+ L+ SPGI       H  +  A      +  DI LF R         F S+  
Sbjct: 62  GSFKDIATLITSPGIPHLYPEPHPVIARALAEGCPVDNDIGLFFRSFATSEWDEFDSIPK 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
             IAVTG+NGKS+T ALI H+L   G   QL GNIG  +L+L+        V+E SSYQ 
Sbjct: 122 -VIAVTGSNGKSTTSALIHHILEHAGRPAQLAGNIGRGVLDLDEAHDGEVIVLELSSYQT 180

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAY 231
           +L   + P + V  N+SPDHLDRH  L  Y   K+++        A+I +++ +   IA 
Sbjct: 181 DLARALTPDVAVFTNLSPDHLDRHAGLGGYFAAKRRLFAEGGPDRAVIGVDEMEGRYIAN 240

Query: 232 DMNFIGHSISRISSQSLQSDSD-----LYIDESFL----KCSATSEV-IFDFSQETKKHN 281
            ++  G S  R+   S     D     ++  + FL    K      + +   S     HN
Sbjct: 241 QLSE-GPSDDRVIRVSAGQKIDGIGWSVFARKGFLSEYRKWRQVGSIDLRAISGLPGVHN 299

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN   +   C  LG+    I+ AL+S  GL HR Q IA    V ++NDSKATN+ +   
Sbjct: 300 HQNACAAYAACRALGIGPRVIEAALISFKGLPHRSQLIAEKVGVRYVNDSKATNVDAAAK 359

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT 401
           A      ++ WI GGL K      L P    + KAY IG  A  F     G +N  +   
Sbjct: 360 ALAAFS-KVRWICGGLEKEGGLDALLP-APTVVKAYVIGREAAAFAMKLKG-LNVEVCGD 416

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +  A+     + E       VL +P  ASFDQY+NF  RG  F + V+E+
Sbjct: 417 MATAVAKAGAEAEAGD---TVLLAPAAASFDQYDNFERRGDDFAACVAEL 463


>gi|84516392|ref|ZP_01003751.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Loktanella
           vestfoldensis SKA53]
 gi|84509428|gb|EAQ05886.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Loktanella
           vestfoldensis SKA53]
          Length = 470

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 155/459 (33%), Positives = 227/459 (49%), Gaps = 28/459 (6%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-REIPWSIISFLV 69
           +AV G+G SG +AA AL+  G HV+ WDD       A+  G  + D  + + +  ++ L+
Sbjct: 12  VAVLGMGLSGRAAAQALQAGGAHVVVWDDGQAGRDLAQTAGYALRDLTKAVSYDGVAALI 71

Query: 70  LSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS-------LQSPFIAVTGTN 122
           +SPGIA      H  +  A    V +  DI LF R   F++            +AVTG+N
Sbjct: 72  VSPGIAHLYPAPHPAIAAAWAAGVPVDNDIGLFFRS--FATDDWDGFETTPRVVAVTGSN 129

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T ALI H+L ++G   QL GNIG  +L++         V+E SSYQ +L   + P 
Sbjct: 130 GKSTTSALIHHILAESGRPAQLAGNIGRGVLDIAPARDGEVVVLELSSYQTDLARALTPD 189

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGHSI 240
           + VL N+SPDHLDRH     Y   K+++        A+I +++++   +A  +   G   
Sbjct: 190 VAVLTNLSPDHLDRHAGHGGYFAAKRRLFAEGGPDRAVIGVDENEGRYLANQLA-QGVGD 248

Query: 241 SRI----SSQSLQSDS-DLYIDESFLKCSATSEVIFDFSQET-----KKHNIQNLVTSAV 290
            R+    S Q L   +  ++  + FL        +              HN QN   +  
Sbjct: 249 DRVVLVSSGQKLTEAAWSVFARKGFLSEYRHGRQVGSIDLRAIAGLPGAHNHQNACAAYA 308

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           VC  LGL    I+ A+ S  GL HR Q +A  G V F+NDSKATN+ S   A L    RI
Sbjct: 309 VCRTLGLGPRAIEAAMQSYPGLPHRSQLVADRGGVRFVNDSKATNVDSAAKA-LQAFARI 367

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
            WI GGL K      L P ++++AKAY IG  A  F     G + + +  T+ +A+    
Sbjct: 368 RWICGGLQKEGGLDGLLPHLAQVAKAYVIGREAADFARQLPG-VPTEVCTTMARAVALAA 426

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
            + E      +VL +P  ASFDQY+NF +RG  F++ V 
Sbjct: 427 AEAEP---GDVVLLAPAAASFDQYDNFEQRGADFITCVG 462


>gi|126726619|ref|ZP_01742459.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacterales
           bacterium HTCC2150]
 gi|126703948|gb|EBA03041.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rhodobacterales
           bacterium HTCC2150]
          Length = 465

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 146/468 (31%), Positives = 229/468 (48%), Gaps = 22/468 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  ++   +AV GLGRSGLSAA A+   G   I WDD+  A   A   G E +D  R+
Sbjct: 2   IPVQGYKGQRLAVLGLGRSGLSAARAIAAGGGTPICWDDNEVARDAALAEGFECVDLSRD 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL----QSP- 114
             ++ I+ L++SPGI     + +  +  A    V +  DI LF +     S     Q P 
Sbjct: 62  GAFTDIARLIVSPGIPHLYPSPNKVIAAAWAAGVPVDNDIGLFFQSFATQSWDNFDQIPK 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            IA+TG+NGKS+T AL+ H+L + G   QL GNIG  +L+++        V+E SSYQ +
Sbjct: 122 VIAITGSNGKSTTSALMHHILTRVGRPSQLAGNIGRGVLDIDPAIDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L  ++ P + V  N+SPDHLDRH  +  Y   K+++        A+I +++ +   +A  
Sbjct: 182 LARSLTPDVAVFTNLSPDHLDRHGGMGGYFAAKRRLFAEGGPDRAVIGVDEAEGRMLANQ 241

Query: 233 M--NFIGHSISRISSQSLQSDS--DLYIDESFLKCSATSEVIFDFSQETKK-----HNIQ 283
           +    +   + R+S     +    ++++ + FL  +   + +      +       HN Q
Sbjct: 242 LAEGPVDDRVIRVSVAGKLTGMGWNIFVKKGFLAETRKGKQVASIDLRSVAALPGVHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N          LGL  + I+       GL HR Q +  +  V +INDSKATN+ S   A 
Sbjct: 302 NAAMVYAALRTLGLAPKVIEAGFHDFAGLPHRSQPVGEIDGVKYINDSKATNVDSAAMA- 360

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
           L   + I WI GG +K    S+L P +  + +AY IG     F      +I+  +  T+D
Sbjct: 361 LKAFKNIRWIVGGQAKEGGISSLVPLMGDVTRAYVIGTDPKPFLADL-TEIDHVICNTMD 419

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +A+K    D        +VL +P  ASFDQY +F +RG  F+  V  +
Sbjct: 420 EAVKQAASD---ANAGDVVLLAPASASFDQYPDFEKRGEDFIRCVEAL 464


>gi|114773353|ref|ZP_01450557.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [alpha
           proteobacterium HTCC2255]
 gi|114546287|gb|EAU49198.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [alpha
           proteobacterium HTCC2255]
          Length = 468

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 156/466 (33%), Positives = 233/466 (50%), Gaps = 23/466 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDF-RE 59
           + +  +    +AV GLGRSGL+AA AL+  G   I WDD+  +   A      ++D  + 
Sbjct: 2   IPVRGYTGCKVAVLGLGRSGLTAARALRAGGAEPIVWDDNEKSRIAADAEDFVILDLNKN 61

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVR-----ERRFSSLQSP 114
             W  I  L++SPGI       H  V  A Q  V +  D+ LF R     E     +   
Sbjct: 62  SSWQDIVCLIVSPGIPHLYPAPHPIVLKAWQNGVVVDNDVGLFFRSFATQEWDNFDVMPK 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            I VTG+NGKS+T ALI+H+L  +   V + GNIG  +L++         V+E SSYQI+
Sbjct: 122 VICVTGSNGKSTTTALIAHLLEGSNRKVVVAGNIGRGVLDIPPAQDGTIVVLELSSYQID 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKK--IVTMSKHAIICINDHQCE----K 228
           L   + P I V +N+SPDHLDRH+ +  Y   K++  I      AII +++ + +    +
Sbjct: 182 LARALAPDIAVFINLSPDHLDRHNGMGGYFYAKRRLFIDGNPDRAIIGVDEIEGQFLENQ 241

Query: 229 IAYDMNFIGHSISRISSQSLQSDS-DLYIDESFL----KCSATSEV-IFDFSQETKKHNI 282
           +  D       IS   +  LQ++   ++  + FL    K    + + +   S    +HN 
Sbjct: 242 LRQDAKSGEPVISVSVNSKLQNNGWSVFSRKGFLAEWRKGRQVASIDLRSMSGLPGEHNH 301

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           QN   +  VC  +GL  + I+  L S  GLTHR QT+     V+++NDSKATN+ +   A
Sbjct: 302 QNACCAYAVCRSIGLAPKLIEEKLNSYVGLTHRCQTVGTFNGVMYVNDSKATNVDAAKKA 361

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            L  K  I WI GG SK      L P+ ++I KAY IG             I+  ++ ++
Sbjct: 362 LLAFK-SILWIVGGESKEAGVLPLKPYFNRIKKAYLIGTDVSDLIKDL-SSIDFVIAGSI 419

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
            +A++    D E      +VL +P CASFDQY NF +RG  F++ V
Sbjct: 420 SEAVRLASLDAEK---NDVVLLAPACASFDQYENFEKRGDDFINNV 462


>gi|148284827|ref|YP_001248917.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Orientia
           tsutsugamushi str. Boryong]
 gi|146740266|emb|CAM80615.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Orientia
           tsutsugamushi str. Boryong]
          Length = 472

 Score =  209 bits (533), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 150/472 (31%), Positives = 231/472 (48%), Gaps = 37/472 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           ++L S RN  I VFGL R+GL A C        +I +DD   +        I   D++ I
Sbjct: 2   IRLYSQRNKKIGVFGLSRTGL-AVCKSLAGLADLIVYDDSHDSRNSFYKHNISSKDYKMI 60

Query: 61  -----PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPF 115
                 W +  F++LSPGI       H  VK A ++N+ I  DI+L   E         +
Sbjct: 61  NIDQPEWQVCDFIILSPGIPYY-TTPHPIVKHAQKYNIPIKSDIDLLYNEYP----NRKY 115

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           I +TGTNGKS+T  LI H+L        +GGNIG  +L+L        YV+E SS+Q++L
Sbjct: 116 IGITGTNGKSTTSTLIHHILTFTNGKFDIGGNIGKAVLSLR--DNVEGYVLELSSFQLDL 173

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIA-YDMN 234
              +   + VLLNI+ DH+DR+++ + Y+  K+KI++++      + + +C  I+  + N
Sbjct: 174 ITDLKLDVAVLLNITADHIDRYYSFDQYILSKQKILSLATKNGYALINKECSIISNANYN 233

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET----------------- 277
            +  S  R ++ SL+      I+   L  S   E I   SQ T                 
Sbjct: 234 TLYASKFRNTTCSLELIKKA-INTDELNKSIADESINCQSQPTLVKFSSHIPQHINFTSL 292

Query: 278 --KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATN 335
              KHN QN+  +   C  LG    +I  A+     L HR+Q I +  ++   NDSKATN
Sbjct: 293 LLGKHNNQNIAAAFYACKILGRNEYDITSAINQFQPLPHRMQYIGKKNNIHIYNDSKATN 352

Query: 336 LHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKIN 395
             +   A L     IYWIAGG++K    +++   + ++ KAY  G S         G + 
Sbjct: 353 ADAASKALL-SLSNIYWIAGGVAKEGGVNSIVNTLYEVKKAYLYGQSRYALAETLKGVVA 411

Query: 396 STLSKTLDQALKSVVRDVENVQ--LPSIVLFSPGCASFDQYNNFRERGFSFM 445
            +++ T+++A    + D E+ Q  L   +LF+P CASFDQ+ NF +RG  F+
Sbjct: 412 FSINNTMEEAFNQAIIDAESDQSGLDKNILFAPACASFDQFKNFEDRGNQFI 463


>gi|219870389|ref|YP_002474764.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           parasuis SH0165]
 gi|219690593|gb|ACL31816.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           parasuis SH0165]
          Length = 432

 Score =  209 bits (531), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 149/454 (32%), Positives = 236/454 (51%), Gaps = 41/454 (9%)

Query: 4   SSFRNHSIAVFGLGRSGLSAA--CALKDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREI 60
           + ++  +I + GLG +GLS     A K + V VI    +P  A K +KD+ +       +
Sbjct: 3   NQYQGKTITIIGLGTTGLSCVEFFADKQAQVRVIDTRANPAGADKLSKDIPLHTGSLN-L 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +V+SPG+AL    A   ++ A Q  VE++GDIELF RE +     +P IA+T
Sbjct: 62  EWLLSSDLIVISPGLAL----ATAEIQQAIQAGVEVVGDIELFYREAK-----APIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L + + ++ G  V +GGNIG+P L+L        YV+E SS+Q+E T ++
Sbjct: 113 GSNGKSTVTTLTTEMAKQAGVKVGMGGNIGVPALSL-LKGDYELYVLELSSFQLETTYSL 171

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHS 239
                 +LNIS DH+DR+ ++E+Y   K KI   +++ I+   D Q     +    +G S
Sbjct: 172 KAKAATILNISEDHMDRYESIEDYRQAKLKIYHHAENVIVNGEDPQT----FPEQAVG-S 226

Query: 240 ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           + + +    + D++       L     + +  D  + T +HN+ N + S  +    G+  
Sbjct: 227 LKKFA----EKDAEYTACNGELYSGDEAVIAIDELKITGRHNVMNALASMSLAEAAGVDR 282

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGL 357
             I +AL S  GL HR Q +     V +INDSKATN+ S + A   L  +  +Y + GG 
Sbjct: 283 SGIVKALQSYSGLDHRFQLVPTNDGVRWINDSKATNVGSTVAALNGLQVEGTLYLLLGGD 342

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTLDQALKSVVRD 412
            K  DFS L PFI++        N+    F   G ++     NS L +T++QA+  +   
Sbjct: 343 GKDADFSELKPFINQP-------NTVCYCFGKDGAELAALTQNSVLVETMEQAVAQIRL- 394

Query: 413 VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
              ++   +VL SP CAS DQ+ NF ERG  F++
Sbjct: 395 --RLKAGDMVLLSPACASLDQFKNFEERGRQFVA 426


>gi|258542968|ref|YP_003188401.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634046|dbj|BAI00022.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637106|dbj|BAI03075.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640158|dbj|BAI06120.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643215|dbj|BAI09170.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646270|dbj|BAI12218.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649323|dbj|BAI15264.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652309|dbj|BAI18243.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655367|dbj|BAI21294.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 471

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 144/462 (31%), Positives = 217/462 (46%), Gaps = 21/462 (4%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQ--------AKDMGIEVI 55
           S F     AVFGLG++GL A   L  +G  V  WDD     K         A D+   + 
Sbjct: 7   SLFSGQRFAVFGLGKNGLPAVLMLTSTGATVQVWDDGEAGRKGLADALSTLAPDVAARIT 66

Query: 56  --DFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
              F  +  +    L+LSPGI       H     A    + I+ D EL  R  R S  ++
Sbjct: 67  CKPFESL--NGFEALILSPGIPHVLPKPHPIALKAKAAGIPILSDAELLYRAVRQSGSKA 124

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
            F+ +TGTNGKS+T  L++H+L +    V  GGN+G   L L + S N  YV+E SSY +
Sbjct: 125 RFVGITGTNGKSTTTTLLAHILAEAKLPVAAGGNLGPAALALPFLSDNGVYVLEMSSYML 184

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIA 230
           E   T+      LLN++PDHLDRH  ++ Y   KK++ T       A+I ++D  C  IA
Sbjct: 185 ERLDTLHFDAACLLNLTPDHLDRHAGMDGYAQAKKRVFTGQTDKDLAVIGVDDTWCRAIA 244

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            ++    H  ++  + S  + +  Y  +       ++ +          HN +N   +  
Sbjct: 245 AELE---HDPAKCETISGTNPACSYYGKDGAIWHHSTRIAQTGPSLPGTHNAENAAAAIA 301

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +   LG+    I +A+ S  GL HR + +A    V F++DSKATN        L    ++
Sbjct: 302 IARFLGVPDATIAQAVASFPGLPHRQKLVASCNGVDFVDDSKATNA-DAAARALGCYEKL 360

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGG-KINSTLSKTLDQALKSV 409
            WIAGG +K    ++L P+   IA  + IG  A L         +  T+++TL+ A+ + 
Sbjct: 361 VWIAGGTAKEGGIASLTPYFPHIAHTFLIGRDAPLLAQTLKEHNVPFTMAETLENAVPAA 420

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             +      P +VL SP CASFDQ++ F  RG  F     E+
Sbjct: 421 YTEAHRTHTP-VVLLSPACASFDQFSGFEARGLRFQELADEV 461


>gi|167856476|ref|ZP_02479193.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           parasuis 29755]
 gi|167852399|gb|EDS23696.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           parasuis 29755]
          Length = 432

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 149/454 (32%), Positives = 235/454 (51%), Gaps = 41/454 (9%)

Query: 4   SSFRNHSIAVFGLGRSGLSAA--CALKDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREI 60
           + ++  +I + GLG +GLS     A K + V VI    +P  A K +KD+ +       +
Sbjct: 3   NQYQGKTITIIGLGTTGLSCVEFFADKQAQVRVIDTRANPAGADKLSKDIPLHTGSLN-L 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +V+SPG+AL    A   ++ A Q  VE++GDIELF RE +     +P IA+T
Sbjct: 62  EWLLSSDLIVISPGLAL----ATAEIQQAIQAGVEVVGDIELFCREAK-----APIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L + + ++ G  V +GGNIG+P L+L        YV+E SS+Q+E T ++
Sbjct: 113 GSNGKSTVTTLTTEMAKQAGVKVGMGGNIGVPALSL-LKGDYELYVLELSSFQLETTYSL 171

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHS 239
                 +LNIS DH+DR+ ++E+Y   K KI   +++ I+   D Q     +    +G S
Sbjct: 172 KAKAATILNISEDHMDRYESIEDYRQAKLKIYHHAENVIVNGEDPQT----FPEQAVG-S 226

Query: 240 ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           + + +    + D++       L     + +  D  + T +HN+ N + S  +    G+  
Sbjct: 227 LKKFA----EKDAEYTACNGELYSGDEAVIAIDELKITGRHNVMNALASMSLAEATGVDR 282

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGL 357
             I +AL S  GL HR Q +     V +INDSKATN+ S + A   L  +  +Y + GG 
Sbjct: 283 SGIVKALQSYSGLDHRFQLVPTNDGVRWINDSKATNVGSTVAALNGLQVEGTLYLLLGGD 342

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTLDQALKSVVRD 412
            K  DFS L PFI++        N+    F   G ++     NS L +T+ QA+  +   
Sbjct: 343 GKDADFSELKPFINQP-------NTVCYCFGKDGAELAALTPNSVLVETMAQAVAQIRL- 394

Query: 413 VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
              ++   +VL SP CAS DQ+ NF ERG  F++
Sbjct: 395 --RLKAGDMVLLSPACASLDQFKNFEERGRQFVA 426


>gi|148259082|ref|YP_001233209.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acidiphilium
           cryptum JF-5]
 gi|146400763|gb|ABQ29290.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acidiphilium
           cryptum JF-5]
          Length = 461

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 146/452 (32%), Positives = 211/452 (46%), Gaps = 6/452 (1%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           F     AV GLG +GL AA AL   G  VIAWDD+      A  +GI +   R    S +
Sbjct: 12  FAGRRYAVLGLGVNGLPAAQALVAMGASVIAWDDNEARRGAAAAVGITI--GRPSDASKL 69

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             L+LSPGI       H          V I  D EL  R  R S   + F+ +TGTNGKS
Sbjct: 70  DGLILSPGIPHALPVPHPEAAAVMARGVPIFTDAELLFRAVRDSGSSARFVGITGTNGKS 129

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T AL++H+L   G +V  GGN+G   L L     +  YV+E SSY +E    +  S G 
Sbjct: 130 TTTALLAHILADAGIEVAAGGNLGPAALALPRLGDDGVYVLEMSSYMLERIVNMRFSAGA 189

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISS 245
           +LN++PDHLDRH  +  Y   K ++    +   + +        A           RI  
Sbjct: 190 MLNLTPDHLDRHGNMAGYEAAKSRLFVGQEAGDVAVFGIDDAATAAMATRFEDGKRRIVR 249

Query: 246 QSLQSDSDLYI-DESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKR 304
            S    +D++      +  S     +   +     HN QN   +A + +  G+  E I R
Sbjct: 250 ISGCQRADIFARGRKLVDHSGVIADLDAAAALPGTHNAQNAAAAAALALAFGVPREVIGR 309

Query: 305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFS 364
           A+ S  GL HR + +A +  V FI+DSKATN  S   A L+   R+ WIAGG+ K    +
Sbjct: 310 AMASFPGLPHRQRVVASVAGVTFIDDSKATNADSAARA-LDCHERLVWIAGGIGKDGGIT 368

Query: 365 TLFPFISKIAKAYFIGNSAMLFFHHFG-GKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
            L P+ S++A A  IG  A  F        ++  ++ T++ A+ S       + +   VL
Sbjct: 369 PLAPWFSRVAHAVLIGRDAPEFAATLASAGVSCEIAGTIENAVPSAFAAARRIGV-DTVL 427

Query: 424 FSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
            SP  ASFDQ+ ++  RG  F    + +  +E
Sbjct: 428 LSPAAASFDQFADYAARGRRFAELAARLVSME 459


>gi|296284500|ref|ZP_06862498.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Citromicrobium
           bathyomarinum JL354]
          Length = 433

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 139/446 (31%), Positives = 217/446 (48%), Gaps = 28/446 (6%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
            +++    AV GL R+G +   AL  +G  V AWD +  A ++A    + + D  E   +
Sbjct: 5   PAWKGRKYAVLGLARTGRATVEALLAAGAEVTAWDSNEDA-REAFAGRVTLADPVETDLT 63

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
               ++++PG+ L   N H     A++F V +IGDIELF + R         + +TGTNG
Sbjct: 64  GFEAVLVTPGVPL---NTHPIKPHADKFGVPVIGDIELFAQAREHLPPHK-VVGITGTNG 119

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+T AL  H+L+  G    +GGNIGLPIL  E       YV+E SSYQI+LT ++D  +
Sbjct: 120 KSTTTALTHHILKTAGVPTTMGGNIGLPILGQEPLPEGGVYVLELSSYQIDLTFSLDCDV 179

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
            V+LNI+PDHLDR+ + E Y   K ++  +                A     IG  +  +
Sbjct: 180 AVILNITPDHLDRYESFEAYAEAKLRLSDLQS--------------AGRPTVIGDEVLGL 225

Query: 244 SSQSLQ-SDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEI 302
            +     +  DL++ +        S    ++      HN +N+  +  +  QLG++   I
Sbjct: 226 WNPGRNVAPEDLWVCDREYPLPGQS----NWPTLQGPHNSENVDAAGCLASQLGIEDAVI 281

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDD 362
            +AL +  GL HR++ +     V+++NDSKATN  +   A    + +I+WI GG +K   
Sbjct: 282 DQALRTFPGLPHRMERVGERAGVLYVNDSKATNTAAAAPALAAFE-KIHWIVGGQAKEPG 340

Query: 363 FSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIV 422
                  I  +  AY IG +   F          +   TLD A+ +     +  +    V
Sbjct: 341 LGETEQHIGHVTAAYTIGEAGDAFADALAPHCPVSRCGTLDIAVHTAALAAKPGE---TV 397

Query: 423 LFSPGCASFDQYNNFRERGFSFMSQV 448
           L SP CASFDQ+ +F +RG  F + V
Sbjct: 398 LLSPACASFDQFRDFEDRGDRFRALV 423


>gi|83942754|ref|ZP_00955215.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sulfitobacter sp.
           EE-36]
 gi|83846847|gb|EAP84723.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sulfitobacter sp.
           EE-36]
          Length = 467

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 234/473 (49%), Gaps = 35/473 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +       +A+ GLGRSGLSAA AL   G   I WDD+P A   A+  G + +D  + 
Sbjct: 2   IPVQGLTGAKVAILGLGRSGLSAARALAAGGAVPICWDDNPAARAAAQAEGFDCVDLGKA 61

Query: 61  P-WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ------- 112
             +  I+ L++SPGI       +  +  A    V +  DI LF +   F++L        
Sbjct: 62  GVFDDIARLIVSPGIPHLYPAPNPVIVAAQDAGVPVDNDIGLFFQS--FATLAWDNFDVV 119

Query: 113 SPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQ 172
              IA+TG+NGKS+T AL+ H+L+  G   QL GNIG  +L++E        V+E SSYQ
Sbjct: 120 PKIIAITGSNGKSTTSALVHHILKHAGRPTQLAGNIGRGVLDIEPAIDGEVVVLELSSYQ 179

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICIND------- 223
            +L   + P + V  N+SPDHLDRH  +  Y   K+++        A+I +++       
Sbjct: 180 TDLARNLTPDVAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGRFLA 239

Query: 224 HQCEKIAYDMNFIGHSISR-ISSQSLQSDSDLYIDESFLKCSATSEVI--FDFSQET--- 277
            Q  + A D   I  S+ R ++    Q    ++  + FL      + I   D    T   
Sbjct: 240 GQLSEGAADDRVIRVSVDRKLTGLGWQ----VFARKGFLSEYRGGKQIGSIDLRSITGLP 295

Query: 278 KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLH 337
             HN QN   +   C  LG   + I+ A  S GGL HR QT+   G V F+NDSKATN+ 
Sbjct: 296 GAHNHQNACAAYAACRTLGFAPKIIEAAFHSFGGLPHRSQTVGEAGGVRFVNDSKATNVD 355

Query: 338 SVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST 397
           S + A L   R I WI GGL K     +L   +  + KAY IG  A  F    G  + + 
Sbjct: 356 SAVKA-LAAFRNIRWICGGLEKEGGLGSLSEPLETVRKAYVIGREAAQFAMKLG--VEAE 412

Query: 398 LSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           +  T+D A   V R VE+ +   +VL +P  ASFDQY++F  RG  F++QV +
Sbjct: 413 VCGTMDIA---VARAVEDAEAGDVVLLAPAAASFDQYDSFERRGEDFVAQVQK 462


>gi|320106152|ref|YP_004181742.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Terriglobus
           saanensis SP1PR4]
 gi|319924673|gb|ADV81748.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Terriglobus
           saanensis SP1PR4]
          Length = 452

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/464 (29%), Positives = 226/464 (48%), Gaps = 34/464 (7%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-----VKQAKDMG--IEVIDFR 58
            +   + V G+G+SGL+AA  L+  G  V   D  P       + +   MG  +E     
Sbjct: 3   LKGKRVLVVGMGKSGLAAARFLRARGAIVTVSDARPSTLLSGPIAELLAMGAAVETGGHG 62

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
            + +     +V+SPG+ +        +K      VE+IG++EL     RF  L    +A+
Sbjct: 63  LLTFRRQDLIVVSPGVPMDTPE----LKQVRALGVEMIGEVEL---ASRF--LNGSVVAI 113

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFY-VIECSSYQIELTP 177
           TG+NGK++T +LI  +LR  G    +GGNIGLP++ +   S +  + V+E SS+Q+E   
Sbjct: 114 TGSNGKTTTTSLIGEILRGAGVPTLVGGNIGLPVVEMVAESTDTTWSVLEISSFQLETVE 173

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHA---IICINDHQCEKIAYDM- 233
           T  P I V+LNI+PDHLDRH T E Y   K +I  M   A   ++   D   + +A    
Sbjct: 174 TFAPKIAVVLNITPDHLDRHGTFEKYAEAKTRITEMQTPADFLVLNAEDKPTQMVAAKTK 233

Query: 234 -NFIGHSISRISSQS--LQSDSDLYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTS 288
                 S  R   Q   +  DS L++     +    +E +   S+      HN++N++ +
Sbjct: 234 AQIFWFSPRRPIKQGAFVHGDSILFLP----REGGKAEPVMPVSEIPLVGAHNVENVLAA 289

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
              C   G+  E+I+  +     + HRLQ +A +  V + NDSKATN+ +   A  + + 
Sbjct: 290 VCACRLAGVSSEKIREGVRGFKAVDHRLQFVAEVAGVKYYNDSKATNVDATAKALASFEG 349

Query: 349 RIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
            +  I GG  K  D++ L   +  ++   Y IG++A        G +    ++TL++A  
Sbjct: 350 NVLLILGGKDKGSDYTELNDLLRERVVTVYTIGSAAEKIETQLAGVMTLKHAETLERA-- 407

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            V    E+ +    VL +P CASFDQ+ ++  RG  F+  V+EI
Sbjct: 408 -VALATEDAKAGDTVLLAPACASFDQFESYEHRGREFVRFVTEI 450


>gi|296116435|ref|ZP_06835049.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977028|gb|EFG83792.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 466

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 146/453 (32%), Positives = 211/453 (46%), Gaps = 14/453 (3%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           F    IAV GLGR+G++AA AL   G  V AWDD   +     D    V     +  +  
Sbjct: 9   FTGQHIAVLGLGRNGMAAARALGAMGARVQAWDDT-LSGHAPPDAPAGVSFAPLVDMAGF 67

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             LV+SPGI       H    +A    V I+ D E   R  R +   + F+ VTGTNGKS
Sbjct: 68  DALVMSPGIPHILPAPHPVAAMARAAGVPIVSDAEFLFRAVRRAGSHARFVGVTGTNGKS 127

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T  L++H+L   G     GGN+G   L+L     N  YV+E SSY +E    +      
Sbjct: 128 TTTVLLAHLLDHAGIPAIAGGNLGPAALSLPLLPDNGVYVLEMSSYMLERLDRMHFDAAC 187

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           LLN++PDHLDRH  +  Y   K  I         A++      C  +  D+   G  I  
Sbjct: 188 LLNLTPDHLDRHGDMAGYSRAKLHIFDRQGTGDLAVLGDTLPDCAGLTADLRARG--IDV 245

Query: 243 ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGLKV 299
           + +       D+ + +  L+    + VI D +        HN +N  T+  + + LG   
Sbjct: 246 MVAGGGADAPDMSVHDGLLRDR--TGVIADLAHAPSLPGAHNAENAATATAIALWLGCPR 303

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSK 359
             I  A+ S  GL HR +TI  +  + FI+DSKATN        ++   R+ WIAGG++K
Sbjct: 304 TIIGAAMASFDGLAHRQKTIGTIDGIRFIDDSKATNA-DAAARAMSCHERMIWIAGGIAK 362

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGK-INSTLSKTLDQALKSVVRDVENVQL 418
           +   + L P   ++A A+ IG  A    H    + +  T+  TLD A+ + +     +  
Sbjct: 363 AGGIADLVPLFDRVAHAFLIGRDAPELAHTLRAQGVAHTIVGTLDHAVPAALSAARTLHT 422

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           P +VL SP CASFDQ+  F  RG  F   VS +
Sbjct: 423 P-VVLLSPACASFDQFTGFEARGQHFAGLVSAL 454


>gi|110680536|ref|YP_683543.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter
           denitrificans OCh 114]
 gi|118595688|sp|Q163I6|MURD_ROSDO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|109456652|gb|ABG32857.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Roseobacter
           denitrificans OCh 114]
          Length = 464

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 153/467 (32%), Positives = 230/467 (49%), Gaps = 23/467 (4%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +   R  ++AV GLGR+G+SAA AL+  G   + WDD+P A  +A+  G        +
Sbjct: 2   IPVQGLRGATVAVLGLGRTGMSAARALRAGGALPLCWDDNPDARARAQQEGFTCTQLSRV 61

Query: 61  P-WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ----SP- 114
             +  I+ L++SPGI       +  V+LA Q  V +  DI LF R    ++      +P 
Sbjct: 62  ADFDDIACLIVSPGIPHLYPAPNPVVRLALQAGVPVDNDIGLFFRSFATNAWANFDTAPR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            +AVTG+NGKS+T ALI H+L   G    L GNIG  +L+++        V+E SSYQ +
Sbjct: 122 VVAVTGSNGKSTTSALIHHILEHVGRPATLAGNIGRGVLDIDPPHDGEVVVLELSSYQTD 181

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYD 232
           L  ++ P + V  N+S DHLDRH  +  Y   K+++        AI+ +++ +   +A  
Sbjct: 182 LARSLTPDVAVFTNLSEDHLDRHGGMGGYFAAKRRLFAEGGPDRAIVGVDEDEGLFLAGQ 241

Query: 233 M--NFIGHSISRIS-SQSLQSDS-DLYIDESFLKCSATSEVIFDFSQETKK-----HNIQ 283
           +        + RIS +Q L      ++  + FL      + I      +       HN Q
Sbjct: 242 LAEGRADDRVIRISFAQKLTGPGWQVFARKGFLSEYRKGKQIASVDLRSVPGLPGVHNHQ 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N   +  VC  LGL  + I+ AL S  GL HR Q + +   V F+NDSKATN  +   A 
Sbjct: 302 NACAAYAVCRSLGLAPKVIEAALHSFQGLPHRSQLVGQKDGVRFVNDSKATNADAAAKAL 361

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
                 I WI GGL K      L    + + KAY IG  A  F       + + +  T+ 
Sbjct: 362 AAFP-SIRWICGGLEKDGGMDALRNASASVVKAYVIGREAAAFAMKL--PVEAEICTTMA 418

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           QA++   R+ E      +VL +P  ASFDQY+NF +RG  FM +V++
Sbjct: 419 QAVEKAAREAE---AGDVVLLAPAAASFDQYDNFEQRGDDFMQEVAK 462


>gi|83953993|ref|ZP_00962714.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sulfitobacter sp.
           NAS-14.1]
 gi|83841938|gb|EAP81107.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Sulfitobacter sp.
           NAS-14.1]
          Length = 461

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 231/463 (49%), Gaps = 35/463 (7%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP-WSIISFLV 69
           +A+ GLGRSGLSAA AL   G   I WDD+P A   A+  G + +D  +   +  I+ L+
Sbjct: 6   VAILGLGRSGLSAARALAAGGAVPICWDDNPAARAAAQAEGFDCVDLGKAGVFDDIARLI 65

Query: 70  LSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ-------SPFIAVTGTN 122
           +SPGI       +  +  A    V +  DI LF +   F++L           IA+TG+N
Sbjct: 66  VSPGIPHLYPAPNPVIVAAQDAGVPVDNDIGLFFQS--FATLAWDNFDVVPKIIAITGSN 123

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+T AL+ H+L+  G   QL GNIG  +L++E        V+E SSYQ +L   + P 
Sbjct: 124 GKSTTSALVHHILKHAGRPTQLAGNIGRGVLDIEPAIDGEVVVLELSSYQTDLARNLTPD 183

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICIND-------HQCEKIAYDM 233
           + V  N+SPDHLDRH  +  Y   K+++        A+I +++        Q  + A D 
Sbjct: 184 VAVFTNLSPDHLDRHAGMGGYFAAKRRLFAEGGPDRAVIGVDEPEGRFLAGQLSEGAADD 243

Query: 234 NFIGHSISR-ISSQSLQSDSDLYIDESFLKCSATSEVI--FDFSQET---KKHNIQNLVT 287
             I  S+ R ++    Q    ++  + FL      + I   D    T     HN QN   
Sbjct: 244 RVIRVSVDRKLTGLGWQ----VFARKGFLSEYRGGKQIGSIDLRSITGLPGAHNHQNACA 299

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +   C  LG   + I+ A  S GGL HR QT+   G V F+NDSKATN+ S + A L   
Sbjct: 300 AYAACRTLGFAPKIIEAAFHSFGGLPHRSQTVGEAGGVRFVNDSKATNVDSAVKA-LAAF 358

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
           + I WI GGL K     +L   +  + KAY IG  A  F    G  + + +  T+D A  
Sbjct: 359 KNIRWICGGLEKEGGLGSLSEPLETVRKAYVIGREAAQFAMKLG--VEAEVCGTMDVA-- 414

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            V R + + +   +VL +P  ASFDQY++F  RG  F++QV +
Sbjct: 415 -VARAINDAEAGDVVLLAPAAASFDQYDSFERRGEDFVAQVQK 456


>gi|237807298|ref|YP_002891738.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Tolumonas auensis
           DSM 9187]
 gi|237499559|gb|ACQ92152.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Tolumonas auensis
           DSM 9187]
          Length = 430

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 140/451 (31%), Positives = 223/451 (49%), Gaps = 34/451 (7%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKDMGIEVIDFREIPWSIISF 67
           + + GLG++GLS     +  G+  +  D   + P       D  +             S 
Sbjct: 4   VVIIGLGKTGLSCVTYFRQRGITPLVMDTRENPPGKESLPADCRLITGPLDAEVLCSASL 63

Query: 68  LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSST 127
           +V SPGIAL    A   ++ A    VEI+GDIELF RE +     +P +A+TG+NGKS+ 
Sbjct: 64  IVASPGIAL----ATPALQAAQMAGVEIVGDIELFAREAK-----APVVAITGSNGKSTV 114

Query: 128 VALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLL 187
             L+  +  + G+ V +GGNIG P L+L    P   YV+E SS+Q+E T ++ P+  V+L
Sbjct: 115 TTLVGLMAEQAGFKVGIGGNIGTPALDL-LLQPADLYVLELSSFQLETTSSLQPAAAVIL 173

Query: 188 NISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC--EKIAYDMNFIGHSISRISS 245
           N+S DHLDR+  +  Y+  K++I   +KH ++  +D      + AY  +F    ++  S 
Sbjct: 174 NLSEDHLDRYDGMAGYLAAKQRIFANAKHIVVNRDDAATLPPQHAYWQSF---GLNSESY 230

Query: 246 QSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRA 305
             +Q D  L++        + +E+          HN  N + +  +   +G+        
Sbjct: 231 GRVQQDDGLWLSVDGKPVLSVAELNI-----VGAHNQMNALAAMALADAVGIPQAAQLTV 285

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFL----NEKRRIYWIAGGLSKSD 361
           L S  GL+HR Q +  +  V +INDSKATN+ S + A      + + R++ +AGG  K  
Sbjct: 286 LRSFTGLSHRCQFVRDVNGVRWINDSKATNVGSTLAAVAGVGESVQGRLWLLAGGQGKGQ 345

Query: 362 DFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS 420
           DFS L P ++ +I +    G  A +         N+     LD+A++SV  +   VQ   
Sbjct: 346 DFSPLQPLLANQIYRMVCFGQDAGILMEL---ADNTQRVADLDEAVRSVAAE---VQPGD 399

Query: 421 IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            VL +P CAS DQ+ NF +RG  F   V+ +
Sbjct: 400 WVLLAPACASLDQFRNFEQRGQRFADLVNAL 430


>gi|225872736|ref|YP_002754193.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Acidobacterium
           capsulatum ATCC 51196]
 gi|254766033|sp|C1F460|MURD_ACIC5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|225794452|gb|ACO34542.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Acidobacterium
           capsulatum ATCC 51196]
          Length = 461

 Score =  200 bits (508), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 144/460 (31%), Positives = 225/460 (48%), Gaps = 32/460 (6%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD---------DHPCAVKQAKDMGIEVID 56
            +   + V GLG+SGL+AA  L+  G  V   D         D P  ++Q   + +E   
Sbjct: 3   LKGKKVLVVGLGKSGLAAALFLRRRGAQVTVSDIRSAEALSKDIPALIEQG--IAVEAGG 60

Query: 57  FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
              + +     +V+SPG+ L   +    V++  +F + IIG++EL  R      L+   +
Sbjct: 61  HGLLTFRRQDLIVVSPGVPL---DTPELVQV-RKFGLPIIGEVELAAR-----FLKGKTL 111

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIEL 175
           A+TG+NGK++T +L   +L +    VQ+GGNIGLP++ L +    + + V+E SS+Q+E 
Sbjct: 112 AITGSNGKTTTTSLCGAILERAHQHVQVGGNIGLPVIALVDDSRDDGWSVLEISSFQLET 171

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF 235
           T    P I V+LNI+PDHLDRH + ENYV  K++I     H    I +   +  +     
Sbjct: 172 TERFRPGIAVILNITPDHLDRHGSFENYVAAKERIFAAQTHDDALILNADDDAASRAAAR 231

Query: 236 IGHSISRISSQSLQSDSDLYIDESFL---KCSATSEVIFDFSQETKK--HNIQNLVTSAV 290
               I   S   +        + + L      A +E I   S+   K  HN++N++ +  
Sbjct: 232 ASSRIFWFSRNRVIRQGAFVHEGNILFRAAEDAATEPILPLSEIPLKGAHNVENVLAAVC 291

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
                G+  E I+ A+     + HRL+ +A +G V F NDSKATN+ +   A       I
Sbjct: 292 AARLAGVSAEAIRDAVRDFRAVEHRLEFVAEIGGVSFYNDSKATNVDAARKAIEAFPGGI 351

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
           + I GG  K+ D+ TL P ++   KA Y IG++A     H  G +    + TLD A    
Sbjct: 352 HLILGGKDKNSDYRTLRPLMAGRVKAVYTIGSAAEKIMTHLDGAVPLIAAGTLDLA---- 407

Query: 410 VRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQV 448
           V        P  +VL +P C+SFDQ+ N+ +RG  F   V
Sbjct: 408 VNLAGGAASPGDVVLLAPACSSFDQFENYEQRGQVFKDLV 447


>gi|218459619|ref|ZP_03499710.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Rhizobium
           etli Kim 5]
          Length = 183

 Score =  199 bits (507), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 92/182 (50%), Positives = 124/182 (68%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           + +++ ++  +A+FGLG SG + A AL   G  V AWDD+P +V +A   GI   D   I
Sbjct: 2   IPVTTLKDRKVALFGLGGSGFATARALIAGGADVTAWDDNPDSVAKASAEGIGTEDLHMI 61

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            WS  +  VLSPG+ LT    HW V LA    V+I+GD+ELFVRERR  +   PFIA+TG
Sbjct: 62  DWSQQALFVLSPGVPLTHPKPHWTVDLARAAGVDIVGDVELFVRERRAHAPDCPFIAITG 121

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           TNGKS+T ALI+H+L+ +GYD QLGGNIG  +L L+     R++V+ECSSYQI+L PT++
Sbjct: 122 TNGKSTTTALIAHILKSSGYDTQLGGNIGTAVLTLDPPKAGRYFVVECSSYQIDLAPTLN 181

Query: 181 PS 182
           PS
Sbjct: 182 PS 183


>gi|326402233|ref|YP_004282314.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acidiphilium
           multivorum AIU301]
 gi|325049094|dbj|BAJ79432.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acidiphilium
           multivorum AIU301]
          Length = 461

 Score =  199 bits (506), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 147/452 (32%), Positives = 213/452 (47%), Gaps = 6/452 (1%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSII 65
           F     AV GLG +GL AA AL   G  VIAWDD+      A  +GI +   R    S +
Sbjct: 12  FAGRRYAVLGLGVNGLPAAQALAAMGASVIAWDDNEARRGAAAAVGITI--GRPSDASKL 69

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             L+LSPGI       H          V I  D EL  R  R S   + F+ +TGTNGKS
Sbjct: 70  DGLILSPGIPHALPVPHPEAAAVMARGVPIFTDAELLFRAVRDSGSSARFVGITGTNGKS 129

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T AL++H+L   G +V  GGN+G   L L     +  YV+E SSY +E    +  S G 
Sbjct: 130 TTTALLAHILADAGIEVAAGGNLGPAALALPRLGDDGVYVLEMSSYMLERIVNMRFSAGA 189

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISS 245
           +LN++PDHLDRH  +  Y   K ++    +   + +        A           RI  
Sbjct: 190 MLNLTPDHLDRHGNMAGYEAAKSRLFVGQEAGDVAVFGIDDAATAAMATRFEDGKRRIVR 249

Query: 246 QSLQSDSDLYI-DESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKR 304
            S    +D++      +  S     +   +     HN QN   +A + + LG+  E I R
Sbjct: 250 ISGCQRADIFARGRKLVDHSGVIADLDAAAALPGTHNAQNAAAAAALALALGVPREVIGR 309

Query: 305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFS 364
           A++S  GL HR + +A +  V FI+DSKATN  S   A L+   R+ WIAGG+ K    +
Sbjct: 310 AMVSFPGLPHRQRVVASVAGVTFIDDSKATNADSAARA-LDCHERLVWIAGGIGKDGGIA 368

Query: 365 TLFPFISKIAKAYFIGNSAMLFFHHFG-GKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
            L P+ S++A A  IG  A  F        ++  ++ T++ A+ S       + +   VL
Sbjct: 369 PLAPWFSRVAHAVLIGRDAPEFAATLASAGVSCEIAGTIENAVPSAFAAARRIGV-DTVL 427

Query: 424 FSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
            SP  ASFDQ+ ++  RG  F    + +  +E
Sbjct: 428 LSPAAASFDQFTDYAARGRRFAELAARLVSME 459


>gi|165975474|ref|YP_001651067.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|303251838|ref|ZP_07338009.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307249139|ref|ZP_07531146.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|165875575|gb|ABY68623.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302649268|gb|EFL79453.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306854427|gb|EFM86623.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
          Length = 436

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 153/486 (31%), Positives = 237/486 (48%), Gaps = 92/486 (18%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP-- 61
           + +++  I V GLG++GLS    L D               KQAK   ++VID RE P  
Sbjct: 3   NQYKDKVITVIGLGKTGLSCVEFLAD---------------KQAK---VQVIDTRETPAG 44

Query: 62  ------------------WSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF 102
                             W + S  +V+SPG+AL    A   ++ A    VE++GDIELF
Sbjct: 45  ADQLPADVPLHTGGLNSEWLLASDLIVISPGLAL----ATPEIQQAINAGVEVVGDIELF 100

Query: 103 VRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFS 159
           VRE +     +P IA+TG NGKS+   L++ + ++ G  V +GGNIG+P+L+L   EY  
Sbjct: 101 VREAK-----APIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEY-- 153

Query: 160 PNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAI 218
               +V+E SS+Q+E T +++     +LNIS DH+DR+ ++LE Y   K +I   +++ I
Sbjct: 154 --ELFVLELSSFQLETTSSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVI 211

Query: 219 ICINDH-----QCEKIAYDMNFIGHSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFD 272
           +   D      + + +   + F  H+    + +  L S  D  I         T E++  
Sbjct: 212 VNGEDRLTYPLETQAVKKLIRFAEHNAEYTMRNGILYSGDDAII--------PTKEMLI- 262

Query: 273 FSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSK 332
               + +HN  N + +  +    G+  E I +AL   GGL HR Q +     V ++NDSK
Sbjct: 263 ----SGRHNEMNSLAAMALAEAAGIPREGIVKALQVYGGLNHRFQAVKTNDGVRWVNDSK 318

Query: 333 ATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF 390
           ATN+ S + A   L     +Y + GG  K+ DFS L P I+K        N     F   
Sbjct: 319 ATNVGSTVAALNGLQVAGTLYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQD 371

Query: 391 GGKI-----NSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           G ++      S L +T+ QA++ +   ++      +VL SP CAS DQ+ NF ERG  F+
Sbjct: 372 GAQLAALSSQSVLVETMQQAIEQIRPQLKK---GDMVLLSPACASLDQFKNFEERGQVFV 428

Query: 446 SQVSEI 451
               E+
Sbjct: 429 KLAQEV 434


>gi|329115575|ref|ZP_08244297.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pomorum DM001]
 gi|326695003|gb|EGE46722.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Acetobacter
           pomorum DM001]
          Length = 499

 Score =  197 bits (500), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 142/462 (30%), Positives = 218/462 (47%), Gaps = 21/462 (4%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQ-AKDMG---------IE 53
           S F     AVFGLG++GL A   L  +G  V  WDD     K  AK +          I+
Sbjct: 35  SLFSGQRFAVFGLGKNGLPAVLMLAGTGATVQVWDDGEGGRKGLAKALSTLAPNVATRIQ 94

Query: 54  VIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
              F  +  +    L+LSPGI       H    +A +  + I+ D EL  R  R S  ++
Sbjct: 95  CKPFESL--NGFEALILSPGIPHVLPKPHPIALMAKEAGIPILSDAELLYRAVRKSGSKA 152

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
            F+ +TGTNGKS+T  L++H+L +    V  GGN+G   L L     N  YV+E SSY +
Sbjct: 153 RFVGITGTNGKSTTTTLLAHILAEAKLPVAAGGNLGPAALALPLLPDNGVYVLEMSSYML 212

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH---AIICINDHQCEKIA 230
           E   T+      LLN++PDHLDRH  ++ Y   KK++ T       A++ ++D  C  IA
Sbjct: 213 ERLDTLRFDAACLLNLTPDHLDRHAGMDGYAQAKKRVFTGQTGKDMAVVGMDDTWCRTIA 272

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            ++    H  ++  + S  + +  Y  +       ++ +          HN +N   +  
Sbjct: 273 AELE---HEPAKCETISGTNPTCSYYGKDGAIWHHSTCIAQTGLSLPGAHNAENAAAAIA 329

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +   L +    I +A+ S  GL HR + +A    V F++DSKATN  +   A L    ++
Sbjct: 330 IARFLDVPDATIAQAVASFPGLPHRQKLVASCNGVDFVDDSKATNADAASRA-LGCYEKL 388

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGG-KINSTLSKTLDQALKSV 409
            WIAGG +K    ++L P+   IA  + IG  A           +  T+++TL+ A+ + 
Sbjct: 389 VWIAGGTAKEGGIASLTPYFPHIAHTFLIGRDAPQLAQTLKEHNVPFTMAETLENAVPAA 448

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             +      P +VL SP CASFDQ++ F  RG  F     E+
Sbjct: 449 YTEAHLTHTP-VVLLSPACASFDQFSGFEARGLRFQELADEV 489


>gi|190149285|ref|YP_001967810.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307262598|ref|ZP_07544228.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189914416|gb|ACE60668.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306872021|gb|EFN03735.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 436

 Score =  196 bits (497), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 152/486 (31%), Positives = 237/486 (48%), Gaps = 92/486 (18%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP-- 61
           + +++  I V GLG++GLS    L D               KQAK   ++VID RE P  
Sbjct: 3   NQYKDKVITVIGLGKTGLSCVEFLAD---------------KQAK---VQVIDTRETPAG 44

Query: 62  ------------------WSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF 102
                             W + S  +V+SPG+AL    A   ++ A    +E++GDIELF
Sbjct: 45  ADQLPADVPLHTGGLNSEWLLASDLIVISPGLAL----ATPEIQQAINAGMEVVGDIELF 100

Query: 103 VRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFS 159
           VRE +     +P IA+TG NGKS+   L++ + ++ G  V +GGNIG+P+L+L   EY  
Sbjct: 101 VREAK-----APIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEY-- 153

Query: 160 PNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAI 218
               +V+E SS+Q+E T +++     +LNIS DH+DR+ ++LE Y   K +I   +++ I
Sbjct: 154 --ELFVLELSSFQLETTSSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVI 211

Query: 219 ICINDH-----QCEKIAYDMNFIGHSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFD 272
           +   D      + + +   + F  H+    + +  L S  D  I         T E++  
Sbjct: 212 VNGEDRLTYPLETQAVKKLIRFAEHNAEYTMRNGILYSGDDAII--------PTKEMLI- 262

Query: 273 FSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSK 332
               + +HN  N + +  +    G+  E I +AL   GGL HR Q +     V ++NDSK
Sbjct: 263 ----SGRHNEMNSLAAMALAEAAGIPREGIVKALQMYGGLNHRFQAVKTNDGVRWVNDSK 318

Query: 333 ATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF 390
           ATN+ S + A   L     +Y + GG  K+ DFS L P I+K        N     F   
Sbjct: 319 ATNVGSTVAALNGLQVAGTLYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQD 371

Query: 391 GGKI-----NSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           G ++      S L +T+ QA++ +   ++      +VL SP CAS DQ+ NF ERG  F+
Sbjct: 372 GAQLAALSSQSVLVETMQQAIEQIRPQLKK---GDMVLLSPACASLDQFKNFEERGQVFV 428

Query: 446 SQVSEI 451
               E+
Sbjct: 429 KLAQEV 434


>gi|307244817|ref|ZP_07526916.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307253771|ref|ZP_07535625.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258228|ref|ZP_07539971.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307260467|ref|ZP_07542162.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306854262|gb|EFM86468.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306863255|gb|EFM95195.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867688|gb|EFM99533.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306869870|gb|EFN01652.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 436

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 152/486 (31%), Positives = 237/486 (48%), Gaps = 92/486 (18%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP-- 61
           + +++  I V GLG++GLS    L D               KQAK   ++VID RE P  
Sbjct: 3   NQYKDKVITVIGLGKTGLSCVEFLAD---------------KQAK---VQVIDTRETPAG 44

Query: 62  ------------------WSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF 102
                             W + S  +V+SPG+AL    A   ++ A    +E++GDIELF
Sbjct: 45  ADQLPADVPLHTGGLNSEWLLASDLIVISPGLAL----ATPEIQQAINAGMEVVGDIELF 100

Query: 103 VRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFS 159
           VRE +     +P IA+TG NGKS+   L++ + ++ G  V +GGNIG+P+L+L   EY  
Sbjct: 101 VREAK-----APIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEY-- 153

Query: 160 PNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAI 218
               +V+E SS+Q+E T +++     +LNIS DH+DR+ ++LE Y   K +I   +++ I
Sbjct: 154 --ELFVLELSSFQLETTSSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVI 211

Query: 219 ICINDH-----QCEKIAYDMNFIGHSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFD 272
           +   D      + + +   + F  H+    + +  L S  D  I         T E++  
Sbjct: 212 VNGEDRLTYPLETQAVKKLIRFAEHNAEYTMRNGILYSGDDAII--------PTKEMLI- 262

Query: 273 FSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSK 332
               + +HN  N + +  +    G+  E I +AL   GGL HR Q +     V ++NDSK
Sbjct: 263 ----SGRHNEMNSLAAMALAEAAGIPREGIVKALQVYGGLNHRFQAVKTNDGVRWVNDSK 318

Query: 333 ATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF 390
           ATN+ S + A   L     +Y + GG  K+ DFS L P I+K        N     F   
Sbjct: 319 ATNVGSTVAALNGLQVAGTLYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQD 371

Query: 391 GGKI-----NSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           G ++      S L +T+ QA++ +   ++      +VL SP CAS DQ+ NF ERG  F+
Sbjct: 372 GAQLAALSSQSVLVETMQQAIEQIRPQLKK---GDMVLLSPACASLDQFKNFEERGQVFV 428

Query: 446 SQVSEI 451
               E+
Sbjct: 429 KLAQEV 434


>gi|53729121|ref|ZP_00134085.2| COG0771: UDP-N-acetylmuramoylalanine-D-glutamate ligase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207504|ref|YP_001052729.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae L20]
 gi|307249215|ref|ZP_07531212.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|126096296|gb|ABN73124.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|306858739|gb|EFM90798.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
          Length = 436

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 148/469 (31%), Positives = 235/469 (50%), Gaps = 58/469 (12%)

Query: 4   SSFRNHSIAVFGLGRSGLSAA--CALKDSGVHVIAWDDHPCAVKQ-AKDMGIEVIDFREI 60
           + +++  I V GLG++GLS     A K + V VI   + P    Q   D+ +        
Sbjct: 3   NQYKDKVITVIGLGKTGLSCVEFLADKQAKVQVIDTREKPAGADQLPADVPLHTGGLNS- 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +V+SPG+AL    A   ++ A    +E++GDIELFVRE +     +P IA+T
Sbjct: 62  EWLLASDLIVISPGLAL----ATPEIQQAINAGMEVVGDIELFVREAK-----APIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFSPNRFYVIECSSYQIELT 176
           G NGKS+   L++ + ++ G  V +GGNIG+P+L+L   EY      +V+E SS+Q+E T
Sbjct: 113 GANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEY----ELFVLELSSFQLETT 168

Query: 177 PTIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDH-----QCEKIA 230
            +++     +LNIS DH+DR+ ++LE Y   K +I   +++ I+   D      + + + 
Sbjct: 169 SSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVIVNGEDRLTYPLETQAVK 228

Query: 231 YDMNFIGHSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
             + F  H+    + +  L S  D  I         T E++      + +HN  N + + 
Sbjct: 229 KLIRFAEHNAEYTMRNGILYSGDDAII--------PTKEMLI-----SGRHNEMNSLAAM 275

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEK 347
            +    G+  E I +AL   GGL HR Q +     V ++NDSKATN+ S + A   L   
Sbjct: 276 ALAEAAGIPREGIVKALQVYGGLNHRFQAVKTNDGVRWVNDSKATNVGSTVAALNGLQVA 335

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTL 402
             +Y + GG  K+ DFS L P I+K        N     F   G ++      S L +T+
Sbjct: 336 GTLYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQDGAQLAALSSQSVLVETM 388

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            QA++ +   ++      +VL SP CAS DQ+ NF ERG  F+    E+
Sbjct: 389 QQAIEQIRPQLKK---GDMVLLSPACASLDQFKNFEERGQVFVKLAQEV 434


>gi|325954319|ref|YP_004237979.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Weeksella virosa
           DSM 16922]
 gi|323436937|gb|ADX67401.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Weeksella virosa
           DSM 16922]
          Length = 443

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 142/464 (30%), Positives = 233/464 (50%), Gaps = 47/464 (10%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS------- 63
           + + G G SG+ AA   K  G  V   D         KD    ++D  +I +        
Sbjct: 4   LVILGGGESGVGAAILGKKEGYQVFLSDRGVL-----KDNYKRILDEHQIEYEFAHHTEA 58

Query: 64  -IIS--FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            I+S   +V SPGI    EN    + L  +  +E+I +IE      RF+  +S  IA+TG
Sbjct: 59  KIMSADLVVKSPGIP---ENVPLIMALKAK-QIEVISEIEF---ASRFT--ESKIIAITG 109

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           +NGK++T +L+ H++++ G DV L GNIG     L    P+ +YVIE SS+Q++      
Sbjct: 110 SNGKTTTTSLMYHIMKEAGLDVGLCGNIGKSFAQLVAEDPHEYYVIEISSFQLDDIRFFK 169

Query: 181 PSIGVLLNISPDHLDRH-HTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNFI 236
           P I ++LNI+PDHLDR+ +  + Y + K +I    T  ++ +  ++D +  ++  ++   
Sbjct: 170 PYIAIILNITPDHLDRYENNFDKYAHSKFRITENQTDKEYFVYNVDDEKINELIKELKIK 229

Query: 237 GHSIS---RISSQSLQSDSDLYI----DESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
            +  S   +   Q   ++  ++     D SFL   A   +I        KHN+ N + +A
Sbjct: 230 ANKTSFSMKDKKQKAYANEKIFEIKDNDNSFLMPIADLGLI-------GKHNVSNSLAAA 282

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                L ++ + IKR+L     + HRL+ + ++G + FINDSKATN+++   A  + K  
Sbjct: 283 TAANILKIRKDVIKRSLSDFKSVEHRLENVLKIGGIEFINDSKATNVNATYFALESMKNP 342

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINS-TLSKTLDQALK 407
           + WI GG  K +D+S L PF+ K  KA   +G         F G +   T +KT+  A++
Sbjct: 343 VIWIVGGTDKGNDYSELMPFVKKKVKAIVCLGVDNHKIIEAFSGVVEKITETKTMKDAVR 402

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +     E       VL SP CASFD + ++++RG  F  +V E+
Sbjct: 403 AAYMYGEK---GDTVLLSPACASFDLFTSYQDRGNQFKKEVKEL 443


>gi|322513881|ref|ZP_08066960.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Actinobacillus
           ureae ATCC 25976]
 gi|322120280|gb|EFX92227.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Actinobacillus
           ureae ATCC 25976]
          Length = 436

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 149/486 (30%), Positives = 236/486 (48%), Gaps = 92/486 (18%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP-- 61
           + +++  + + GLG++GLS      D               KQAK   ++VID RE P  
Sbjct: 3   NQYKDKVVTIIGLGKTGLSCVEFFAD---------------KQAK---VQVIDTREKPAG 44

Query: 62  ------------------WSIISFLVLS-PGIALTGENAHWCVKLANQFNVEIIGDIELF 102
                             W + S L++S PG+AL    A   ++ A    VE++GDIELF
Sbjct: 45  TVLLPVDVPLHTGGLNSEWLLASDLIVSSPGLAL----ATPEIQQAINAGVEVVGDIELF 100

Query: 103 VRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFS 159
           VRE +     +P IA+TG NGKS+   L++ + ++ G  V +GGNIG+P+L+L   EY  
Sbjct: 101 VREAK-----APIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNEEY-- 153

Query: 160 PNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAI 218
               +V+E SS+Q+E T ++   +  +LNIS DH+DR+ +++E Y   K +I   +++ I
Sbjct: 154 --ELFVLELSSFQLETTSSLKAVVATILNISEDHMDRYNNSVEEYRLAKLRIYDNAENVI 211

Query: 219 ICINDH-----QCEKIAYDMNFIGHSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFD 272
           +   D      + + +   + F  H+    + +  L S  D  I         T E++  
Sbjct: 212 VNGEDRLTYPLETQAVKKLIRFAEHNAEYTMRNGILYSGDDAII--------PTKEMLI- 262

Query: 273 FSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSK 332
               + +HN  N + +  +    G+  E I +AL   GGL HR Q +     V ++NDSK
Sbjct: 263 ----SGRHNEMNALVAMALAETAGIPREGIVKALQVYGGLEHRFQAVKTNDGVRWVNDSK 318

Query: 333 ATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF 390
           ATN+ S + A   L     +Y + GG  K+ DFS L P I+K        N     F   
Sbjct: 319 ATNVGSTVAALNGLQVVGTLYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQD 371

Query: 391 GGKI-----NSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           G ++      S L +T+ QA++ +   ++      +VL SP CAS DQ+ NF ERG  F+
Sbjct: 372 GAQLAALSNQSVLVETMQQAIEQIRPQLKK---GDMVLLSPACASLDQFKNFEERGHVFV 428

Query: 446 SQVSEI 451
               E+
Sbjct: 429 KLAQEV 434


>gi|303250495|ref|ZP_07336692.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307251537|ref|ZP_07533444.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307256037|ref|ZP_07537825.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|302650483|gb|EFL80642.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306861001|gb|EFM93007.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306865459|gb|EFM97354.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 436

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 151/486 (31%), Positives = 237/486 (48%), Gaps = 92/486 (18%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP-- 61
           + +++  I V GLG++GLS    L D               KQAK   ++VID RE P  
Sbjct: 3   NQYKDKVITVIGLGKTGLSCVEFLAD---------------KQAK---VQVIDTRETPAG 44

Query: 62  ------------------WSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF 102
                             W + S  +V+SPG+AL    A   ++ A    +E++GDIELF
Sbjct: 45  ADQLPADVPLHTGGLNSEWLLASDLIVISPGLAL----ATPEIQQAINAGMEVVGDIELF 100

Query: 103 VRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFS 159
           VRE +     +P IA+TG NGKS+   L++ + ++ G  V +GGNIG+P+L+L   EY  
Sbjct: 101 VREAK-----APIIAITGANGKSTVTTLVTEMAKQAGIKVGMGGNIGVPVLSLLNDEY-- 153

Query: 160 PNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAI 218
               +V+E SS+Q+E T +++     +LNIS DH+DR+ ++LE Y   K +I   +++ I
Sbjct: 154 --ELFVLELSSFQLETTSSLNAVAATILNISEDHMDRYNNSLEEYRLAKLRIYDNAENVI 211

Query: 219 ICINDH-----QCEKIAYDMNFIGHSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFD 272
           +   D      + + +   + F  ++    + +  L S  D  I         T E++  
Sbjct: 212 VNGEDRLTYPLETQAVKKLIRFAEYNAEYTMRNGILYSGDDAII--------PTKEMLI- 262

Query: 273 FSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSK 332
               + +HN  N + +  +    G+  E I +AL   GGL HR Q +     V ++NDSK
Sbjct: 263 ----SGRHNEMNALAAMALAEAAGIPREGIVKALQVYGGLDHRFQAVKTNDGVRWVNDSK 318

Query: 333 ATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF 390
           ATN+ S + A   L     +Y + GG  K+ DFS L P I+K        N     F   
Sbjct: 319 ATNVGSTVAALNGLQVAGTLYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQD 371

Query: 391 GGKI-----NSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           G ++      S L +T+ QA++ +   ++      +VL SP CAS DQ+ NF ERG  F+
Sbjct: 372 GAQLAALSSQSVLVETMQQAIEQIRPQLKK---GDMVLLSPACASLDQFKNFEERGQVFV 428

Query: 446 SQVSEI 451
               E+
Sbjct: 429 KLAQEV 434


>gi|330994425|ref|ZP_08318350.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Gluconacetobacter
           sp. SXCC-1]
 gi|329758425|gb|EGG74944.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Gluconacetobacter
           sp. SXCC-1]
          Length = 450

 Score =  193 bits (490), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 144/450 (32%), Positives = 210/450 (46%), Gaps = 21/450 (4%)

Query: 15  GLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI-ISFLVLSPG 73
           GLGR+G +A  AL   G  V AWDD+  A  +      E +        + ++ LVLSPG
Sbjct: 3   GLGRNGNAAVGALLAMGASVQAWDDN--AASRDALPAHERLTLAPFTGMVGLAGLVLSPG 60

Query: 74  IALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISH 133
           I     + H   ++A +  V I+ D EL  R  R +  ++ F  +TGTNGKS+T  L++H
Sbjct: 61  IPHILPSPHPLARMAVEAGVPIVSDAELLFRAVRAAGSRARFAGITGTNGKSTTTVLLAH 120

Query: 134 VLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDH 193
           +L   G  V  GGN+G   L L     +  YV+E SSY +E    +  S   LLN++PDH
Sbjct: 121 MLACCGIPVAAGGNLGPAALALPLLPDDGVYVLEMSSYMLERLEQLHFSAACLLNLTPDH 180

Query: 194 LDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRIS--SQSLQSD 251
           LDRH  +  Y   K  +        + +        A     +  +  RI+  S +    
Sbjct: 181 LDRHGDMAGYTAAKLHVFDHQHAGDLAVLGATLPDYARIHRGLAATRVRIACVSGADVEQ 240

Query: 252 SDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQLGLKVEEIKRALLS 308
            D Y  +  L C   S VI      T     HN +N   +  + + LG+    ++ AL +
Sbjct: 241 CDYYCTDHAL-CD-HSGVIAGLDGATDLPGTHNRENAAAATAMALHLGMPRAAVEGALAT 298

Query: 309 CGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFP 368
              L HR + + R+G V FINDSKATN  +   A L    R+ WIAGG +K+     L P
Sbjct: 299 FSALDHRQKLVGRIGTVRFINDSKATNADATARA-LACHDRLVWIAGGTAKAGGIEELAP 357

Query: 369 FISKIAKAYFIGN-----SAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
               +A A  IG      +A L  H    +I  TL + + +A     R+        +V+
Sbjct: 358 LFGHVALALLIGRDAPVLAATLTRHGVPHRIVHTLERAVPEA-----REAARALGVDVVM 412

Query: 424 FSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
            SP CASFDQ++ F  RG  F + V ++ G
Sbjct: 413 LSPACASFDQFSGFEARGAHFAALVRDLDG 442


>gi|58697458|ref|ZP_00372747.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|58536107|gb|EAL59735.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Wolbachia
           endosymbiont of Drosophila simulans]
          Length = 418

 Score =  193 bits (490), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 132/407 (32%), Positives = 198/407 (48%), Gaps = 62/407 (15%)

Query: 94  EIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPIL 153
           +I  DIELF+  +   +     I VTGTNGKS+T +LI H+L+  G  V +GGN+G+P+L
Sbjct: 2   KIKSDIELFLEAK---TTNQKVIGVTGTNGKSTTTSLIGHILKSAGKKVAIGGNLGVPVL 58

Query: 154 NLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM 213
           +LE  +    YVIE SS+Q+EL   I+  I  LLNI+PDH+DRH ++ENY+  K K++  
Sbjct: 59  DLERDA--EIYVIELSSFQLELMNEINVDISALLNITPDHIDRHGSMENYIATKLKLING 116

Query: 214 SKHAII-C--------INDHQCEKIAYDMNFIGHSISRISSQSLQ--------------- 249
           S+ A+I C         N    +KI   + +   S  R++ +S +               
Sbjct: 117 SEVAVIGCDNEITADIFNKFTGDKIPISVTYSPMSFQRVTLESRKEKPLPTTQMTEGGAR 176

Query: 250 -------------SDSDLYIDESFLKCSAT------SEVIFDFSQETKKH---------- 280
                        S+    ID ++L  S +         I   S + + H          
Sbjct: 177 DLISLAGNNLLDYSEQITGIDRNYLDPSVSYLDDKRGTGIQKISLKLENHSLSVSDVKIN 236

Query: 281 ---NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLH 337
              N +N+  +  VC  LG+    I   + S  GL HR + + ++ +V F+NDSKATN  
Sbjct: 237 LISNAENIAATYAVCKVLGVDSNTIINGIKSFSGLRHRNELLGKIRNVFFVNDSKATNAK 296

Query: 338 SVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST 397
           S   A L+ +  I WIAGG SK     +L    +++ KA+ IG S   F +    K++  
Sbjct: 297 SSEKAILSYE-NINWIAGGRSKKGGIESLSKHFTRVRKAFLIGESTEAFANVMENKVDYV 355

Query: 398 LSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
               L+ A +    +  N      +L SP CASFDQ+ NF ERG +F
Sbjct: 356 KCCNLEDAFRLAFEEALNSAEEVTILLSPACASFDQWKNFEERGEAF 402


>gi|299139512|ref|ZP_07032686.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Acidobacterium sp.
           MP5ACTX8]
 gi|298598440|gb|EFI54604.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Acidobacterium sp.
           MP5ACTX8]
          Length = 450

 Score =  192 bits (488), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 139/468 (29%), Positives = 222/468 (47%), Gaps = 42/468 (8%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV----KQAKDMGIEV-- 54
           M+L+  R   + V GLG+SGL+AA  LK+ G  V   D  P  +        D GI V  
Sbjct: 1   MELAGKR---VLVVGLGKSGLAAARFLKERGARVTVSDARPATLIAELPGLLDQGIMVEA 57

Query: 55  -----IDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                + FR         +V+SPG+ ++       +K      + IIG++EL  +     
Sbjct: 58  GSHGLLTFRRQ-----DLIVVSPGVPMSTPE----LKQVRAMGMHIIGELELGAQ----- 103

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFS-PNRFYVIEC 168
            LQ   + +TG+NGK++T  L+  + +  G    +GGNIG P+  L   S P  + V+E 
Sbjct: 104 FLQGEVVGITGSNGKTTTTTLMGEIFKAAGRPTLVGGNIGKPVTELVGESTPEAWSVLEV 163

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQ 225
           SS+Q+E   +  P I ++LNI+PDHLDRH   ENY   K +I    T     I+   D  
Sbjct: 164 SSFQLETVESFRPRIAMVLNITPDHLDRHGNFENYAAAKARITEFQTAEDFLILNAEDKP 223

Query: 226 CEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCS--ATSEVIFDFSQ--ETKKHN 281
            + +A       +  S    + ++  + ++ +  F   S  A  E +   ++      HN
Sbjct: 224 TQMVAAKTKAQIYWFS--PRRQVKQGAFVHGETIFFTPSEGAKPEPVMPVAEIPLAGAHN 281

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
           ++N++ +       G+  E I+ A+ +   + HRL+ +     V + NDSKATN+ + + 
Sbjct: 282 VENVLAAVCAARLAGVASETIRAAVAAFKAVEHRLEFVREHNGVRYYNDSKATNVDATVK 341

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTLSK 400
           A      RIY I GG  K  D++ + P + +  K    IG++A    H   G +    ++
Sbjct: 342 AVEAFAGRIYLILGGKDKDSDYAVMGPLLRERVKMVITIGSAAEKIEHQLAGVVKIERAE 401

Query: 401 TLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           T+D+A   V    E       VL +P CASFDQ+ N+  RG +F S V
Sbjct: 402 TMDRA---VALAHEAAVAGDTVLLAPACASFDQFQNYEHRGHAFKSLV 446


>gi|159903953|ref|YP_001551297.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. MIT 9211]
 gi|159889129|gb|ABX09343.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9211]
          Length = 457

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 150/459 (32%), Positives = 228/459 (49%), Gaps = 41/459 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFR-----EI----P 61
           + GLGRSGL AA  L + G +V+ ++  + P     +K++  + ID +     E+    P
Sbjct: 1   MVGLGRSGLGAAKLLNEQGANVVVFEQSNGPSLEALSKELNNQGIDVKLGVSLELKSFEP 60

Query: 62  W-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           W S +  +V SP IA      H  +       +EI  +I L  +  +      P+I VTG
Sbjct: 61  WLSNLKSVVTSPAIAWD----HCTLNALRNKGIEIESEISLAWKALK----HIPWIGVTG 112

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFS-------PNRFYVIECSSYQI 173
           TNGK++   ++ HVL  N  +  +GGN+G+P   +   S       PN + V+E SSYQ+
Sbjct: 113 TNGKTTVTHMLHHVLNSNQINTAMGGNVGIPASQIALDSIRSSRTEPN-WLVMELSSYQL 171

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E +P I P IG+   ++PDHL+RH +LENY +IKK+++  S   I  ++DH   K A   
Sbjct: 172 ETSPNISPKIGIWTTLTPDHLERHGSLENYSDIKKRLLENSSIRIYNLDDHFL-KNARSK 230

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVV 291
              G  +S   +    + +D +I  S  K     E I D +      +HN+QNL+     
Sbjct: 231 LMEGIWVSTNGAAINNNQADFWIT-SKGKLYEKGEEILDTTLLNIPGRHNLQNLLLVTAA 289

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
             ++GL   +I++A+ S  G+ HRL+ IA +  +   NDSKATN  +             
Sbjct: 290 AREIGLSPRDIEQAIASFKGVPHRLEKIANIKGIEIFNDSKATNYEAAKIGLEAVPSPTI 349

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFI-GNSAMLFFH-----HFGGKINSTLSKTLDQA 405
            IAGG SK  + +     ++K A A  + G SA   F       F G +N   S  L+ A
Sbjct: 350 VIAGGQSKKGNPNDWLQALNKKACAVVLFGASANTLFDLIRDSKFSGPVNCFPS--LNDA 407

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +++V       +  SI L SP CASFDQY ++ ERG  F
Sbjct: 408 IETVFNLAFEEKAKSI-LLSPACASFDQYKDYEERGNEF 445


>gi|223041554|ref|ZP_03611755.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus minor 202]
 gi|223017649|gb|EEF16059.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus minor 202]
          Length = 434

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 146/460 (31%), Positives = 231/460 (50%), Gaps = 52/460 (11%)

Query: 4   SSFRNHSIAVFGLGRSGLSAA--CALKDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREI 60
           + ++  +I + GLG +GLS     A K + V VI    +P  A K +KD+ +       +
Sbjct: 3   NQYQGKTITIIGLGTTGLSCVEFFADKQAQVRVIDTRANPAGADKLSKDIPLHTGSLN-L 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +V+SPG+AL    A   ++ A Q  VE++GDIELF RE +     +P IA+T
Sbjct: 62  EWLLSSDLIVISPGLAL----ATPEIQQAIQAGVEVVGDIELFCREAK-----APIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G NGKS+   L + + ++ G  V +GGNIG+P L+L        YV+E SS+Q+E T ++
Sbjct: 113 GANGKSTVTTLTTEMAKQAGIKVGMGGNIGVPALSL-LKGDYELYVLELSSFQLETTYSL 171

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
                 +LNIS DH+DR++ ++E Y   K +I   +++ I+   D     + Y    +  
Sbjct: 172 KAKAATILNISEDHMDRYNNSVEEYRAAKLRIYQNAENIIVNGED----PLTYPTQAV-E 226

Query: 239 SISRISSQSLQ---SDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCM 293
            + R + Q+ +    +  LY         A  + +    Q     +HN  N + +  +  
Sbjct: 227 KLIRFAEQNAEYSKKNDTLY---------AYDDAVIGIKQMLIRGRHNEMNALAAMALAE 277

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIY 351
             G+  E I +AL + GGL HR Q +A    V ++NDSKATN+ S + A   L     +Y
Sbjct: 278 AAGIPREGIVKALQTYGGLPHRFQAVATNDCVRWVNDSKATNVGSTVAALNGLEVAGTLY 337

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTLDQAL 406
            + GG  K+ DFS L P ++K        N     F   G ++      S L  T+ +A+
Sbjct: 338 LLLGGDGKAADFSELIPLVNK-------ANIVCYCFGQDGEQLAKLSTQSVLVATMQEAV 390

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
           + +      ++   +VL SP CAS DQ+ NF ERG  FM+
Sbjct: 391 EQI---RPQLKTGDMVLLSPACASLDQFKNFEERGNIFMA 427


>gi|322436304|ref|YP_004218516.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Acidobacterium sp.
           MP5ACTX9]
 gi|321164031|gb|ADW69736.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Acidobacterium sp.
           MP5ACTX9]
          Length = 451

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 147/462 (31%), Positives = 222/462 (48%), Gaps = 44/462 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM------GIEV----- 54
            +N  + V GLGRSGLSAA  L+D G  V   D    A   AK++      GI V     
Sbjct: 3   LKNKRVLVVGLGRSGLSAAMFLRDRGARVTVSDTR-SATALAKEIPALMEAGIMVESGGH 61

Query: 55  --IDFREIPWSIISFLVLSPGIAL-TGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL 111
             + FR         +V+SPG+ L T E A      A  F   +IG++EL     RF  L
Sbjct: 62  GLLTFRRQ-----DLIVVSPGVPLETPEIAQ-----AAAFGTAVIGELEL---ASRF--L 106

Query: 112 QSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFS-PNRFYVIECSS 170
               IA+TG+NGK++T  L   +         +GGNIGLP+++L   S P  + V+E SS
Sbjct: 107 DGSVIAITGSNGKTTTTTLTGKIFADAALPTLVGGNIGLPVIDLIAESRPETWSVLEVSS 166

Query: 171 YQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHA---IICINDHQCE 227
           +Q+E   T  P I ++LN++PDHLDRH T E Y   K +I    +     I+   D   +
Sbjct: 167 FQLETATTFKPRIAMVLNVTPDHLDRHKTFERYWEAKARITACQESEDFLILNAEDVNAQ 226

Query: 228 KIAYDMNFIGHSISRISSQSLQSDSDLYIDESFL--KCSATSEVIFDFSQETKK--HNIQ 283
           K+A       +  S    + ++  + ++ +  F   K     E +   S+   K  HN++
Sbjct: 227 KMAAKTRAQIYWFS--GRRQVKQGAFVHGESVFFLGKEGGKPEPVLPVSEIALKGAHNVE 284

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++ +       G+  E I+ A+     + HRL+ +     V F NDSKATN+ + + A 
Sbjct: 285 NVLAAVCAARLAGIDAETIRAAVKGFRAVEHRLELVRVRNGVEFYNDSKATNVDATVKAV 344

Query: 344 LNEKRRIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL 402
            +    I+ I GG  K  D++TL   +  ++   Y IG++A        G +    + TL
Sbjct: 345 ESFAGGIHLILGGKDKDSDYATLSALLKERVRVVYTIGSAAEKIERQLDGVVKIVQAGTL 404

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           D+A+K      E      IVL +P C+SFDQ+ N+ ERG  F
Sbjct: 405 DKAVKLA---AEAAVSDEIVLLAPACSSFDQFTNYEERGRVF 443


>gi|240948408|ref|ZP_04752786.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus minor NM305]
 gi|240297234|gb|EER47792.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus minor NM305]
          Length = 434

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 146/460 (31%), Positives = 231/460 (50%), Gaps = 52/460 (11%)

Query: 4   SSFRNHSIAVFGLGRSGLSAA--CALKDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREI 60
           + ++  +I + GLG +GLS     A K + V VI    +P  A K +K++ +       +
Sbjct: 3   NQYQGKTITIIGLGTTGLSCVEFFADKQAQVRVIDTRSNPAGADKLSKNIPLHTGGLN-L 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +V+SPG+AL    A   ++ A Q  VE++GDIELF RE +     +P IA+T
Sbjct: 62  EWLLSSDLIVISPGLAL----ATPEIQQAIQAGVEVVGDIELFCREAK-----APIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G NGKS+   L + + ++ G  V +GGNIG+P L+L   S    YV+E SS+Q+E T ++
Sbjct: 113 GANGKSTVTTLTTEMAKQAGIKVGMGGNIGVPALSL-LKSDYELYVLELSSFQLETTYSL 171

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
                 +LNIS DH+DR++ ++E Y   K +I   +++ I+   D     + Y    +  
Sbjct: 172 KAKAATILNISEDHMDRYNNSVEEYRAAKLRIYQNAENIIVNGED----PLTYPTQAV-E 226

Query: 239 SISRISSQSLQ---SDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCM 293
            + R + Q+ +    +  LY         A  + +    Q     +HN  N + +  +  
Sbjct: 227 KLIRFAEQNAEYSKKNDTLY---------AYDDAVIGIKQMLIRGRHNEMNALAAMALAE 277

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIY 351
             G+  E I +AL   GGL HR Q +A    V ++NDSKATN+ S + A   L     +Y
Sbjct: 278 AAGIPREGIVKALQIYGGLPHRFQAVATNDGVRWVNDSKATNVGSTVAALNGLEVAGTLY 337

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTLDQAL 406
            + GG  K+ DFS L P ++K        N     F   G ++      S L  T+ +A+
Sbjct: 338 LLLGGDGKAADFSELVPLVNK-------SNIVCYCFGQDGEQLAKLSTQSVLVATMQEAV 390

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
           + +      ++   +VL SP CAS DQ+ NF ERG  FM+
Sbjct: 391 EQI---RPQLKTGDMVLLSPACASLDQFKNFEERGNIFMA 427


>gi|228472694|ref|ZP_04057454.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Capnocytophaga
           gingivalis ATCC 33624]
 gi|228276107|gb|EEK14863.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Capnocytophaga
           gingivalis ATCC 33624]
          Length = 444

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 138/454 (30%), Positives = 233/454 (51%), Gaps = 29/454 (6%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFRE---IPWSIISF 67
           + + G G SG  AA   K  G  V   D  P      K++  + I + E       I+S 
Sbjct: 3   LVILGGGESGTGAAVLGKQKGWEVFLSDKSPLKEVYKKELDAKGIRWEEGQHTESEILSA 62

Query: 68  --LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
             ++ SPGI     +    V+ A    +EII +IE   R        +  IA+TG+NGK+
Sbjct: 63  DCIIKSPGIP----HKVPIVQQAKAKGIEIISEIEFASR-----YTDAKIIAITGSNGKT 113

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T  L+ H+L++ G  V +GGNIG     L    P  +YV+E SS+Q++   +  P I +
Sbjct: 114 TTTTLVYHLLKEAGLSVAVGGNIGYSFARLVAQEPKEYYVLEISSFQLDDITSFHPHIAL 173

Query: 186 LLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRIS 244
           LLNI+PDHLDR+ +  +NY++ K +I    + A   I D      A ++   G   +++ 
Sbjct: 174 LLNITPDHLDRYNYEFQNYIDAKMRITEFQQAADFLIYDADDPVTAQEIG-KGQVKAQLL 232

Query: 245 SQSLQSDSD---LYIDESFLKCSATSEVIFDFSQE----TKKHNIQNLVTSAVVCMQLGL 297
             SL+   +     +DE  +  +  ++ IF+ S +      KHN++N + + +V   L +
Sbjct: 233 PFSLEKTFERGAWSLDEKNMYVN-VNQNIFEMSTKDLTIKGKHNLKNAMGATMVAKLLNV 291

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGL 357
           + E I+ +L++  G+ HRL+ +  +  V +INDSKATN++SV +A  + +  + WI GG 
Sbjct: 292 RNENIRNSLMTFQGVPHRLEFVREVEGVRYINDSKATNVNSVYYALDSMEEGLVWIVGGQ 351

Query: 358 SKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTL-SKTLDQALKSVVRDVEN 415
            K +D++ L P++SK  KA   +G         F   + + + + +++ A++ V R +  
Sbjct: 352 DKGNDYTPLIPYVSKKVKAIVCLGLDNQKIIQTFQSIVPTIIETHSMEDAVQ-VGRGLS- 409

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
            Q    VL SP CASFD + ++ +RG  F   V+
Sbjct: 410 -QEGDTVLLSPACASFDLFQSYEDRGNQFKHYVN 442


>gi|160872723|ref|ZP_02062855.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsiella
           grylli]
 gi|159121522|gb|EDP46860.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Rickettsiella
           grylli]
          Length = 441

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 143/449 (31%), Positives = 221/449 (49%), Gaps = 32/449 (7%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDD--HPCAV----KQAKDMGIEVIDFREIPWSIIS 66
           + GLG++GLS A  LK   +  I +D+  +P  +    K+  D+G  +   +   +   +
Sbjct: 2   ILGLGKTGLSCARHLKRFNLPFIIFDNRLNPPKLSHFKKEFPDVGCYLGSLKPNLFKRCT 61

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            L++SPGI L   N      +  Q  ++ +GDIELF +  R     +P IA+TG+N K +
Sbjct: 62  KLIVSPGIDL---NETTIRTIIEQHTLKPLGDIELFAQHAR-----APIIAITGSNAKGT 113

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
             +LI  ++++   +V +GGNIG P L+L       FYV+E SS+Q+E T ++ P +  +
Sbjct: 114 VTSLIGKMIQRAHLNVAVGGNIGKPALDLLNEPVPDFYVLEISSFQLETTYSLRPKLASI 173

Query: 187 LNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQ 246
           LNISPDHLDRH TL  Y+N K++I   +  A+   +D      A     I   ++  +  
Sbjct: 174 LNISPDHLDRHKTLTAYINAKQRIYHQADIALWNRDDLNTFPQARTKKIISFGLTTTTPH 233

Query: 247 SLQSDSDLYI----DESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEI 302
           +     + Y+     ++F+       +  D      +HN  N + +  +   +GL  + +
Sbjct: 234 A----HEFYLYNSHQKNFIAKGHDRLLPVDALFIQGRHNWANAIAALTIGHAIGLPTKAM 289

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE-----KRRIYWIAGGL 357
             AL    GL HR Q +     V + NDSKATN+ + + A LN        +I  IAGGL
Sbjct: 290 LTALCEFKGLPHRCQWVKEFKGVTWYNDSKATNVGATL-AALNGLGPSISGKIILIAGGL 348

Query: 358 SKSDDFSTLF-PFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENV 416
           SK+ DFS L  P    + K   IG  A L  +       ST  +T+     +V    E  
Sbjct: 349 SKNADFSLLHNPVKHYVKKIILIGRDAALLKNTLE---KSTAIQTVSDLRHAVNLAHETA 405

Query: 417 QLPSIVLFSPGCASFDQYNNFRERGFSFM 445
           +   IVL SP CAS D + N+ ERG  FM
Sbjct: 406 RRGDIVLLSPACASLDMFKNYEERGDVFM 434


>gi|33151489|ref|NP_872842.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           ducreyi 35000HP]
 gi|60390541|sp|Q7VP56|MURD_HAEDU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|33147709|gb|AAP95231.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Haemophilus
           ducreyi 35000HP]
          Length = 435

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 148/458 (32%), Positives = 229/458 (50%), Gaps = 45/458 (9%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAAC--ALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR 58
           M  + ++   I + GLG++GLS     A K + + VI   + P  ++   D         
Sbjct: 1   MMQNQYQGKIITIVGLGKTGLSCVAFFAEKQATIQVIDTREQPAGIEHLSDNVALHTGSL 60

Query: 59  EIPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
            + W + S  +V+SPG+AL    A   ++ A Q  +E++GDIELFVRE +     +P IA
Sbjct: 61  NLEWLLASDLIVMSPGLAL----ATPEIQTAIQAGIEVVGDIELFVREAK-----APIIA 111

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177
           +TG+NGKS+   L+S + ++ G  V +GGNIG+P L+L        +V+E SS+Q+E T 
Sbjct: 112 ITGSNGKSTVTTLVSEMAQQAGIKVGMGGNIGIPALSL-LNKGYELFVLELSSFQLETTY 170

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG 237
           ++      +LN+S DH+DR+ + E+Y   K +I   +++ I  +ND   + + Y +    
Sbjct: 171 SLKAKAATILNVSQDHMDRYASGEHYRQAKLRIYENAEYVI--VNDD--DPLTYPLP--S 224

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVI-FDFSQETKKHNIQNLVTSAVVCMQLG 296
            S+  +   + + D+   I    L CS    VI  D    T +HN  N + +  +    G
Sbjct: 225 QSVGNLRHFA-EHDAQYAIKYDQL-CSGDQAVINTDQMLLTGRHNQLNALAAIALAEAAG 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           +    I   L   GGL HR Q +     V ++NDSKATN+ S + A   L     +Y + 
Sbjct: 283 INRTGIINGLRCYGGLAHRFQRVPTNDGVCWVNDSKATNVGSTVAALNGLPLSGTLYLLL 342

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GK------INSTLSKTLDQAL 406
           GG  K  DFS L   +          N   +  + FG  GK       NS L  T+ QA+
Sbjct: 343 GGDGKGADFSMLKALV----------NQPHIVCYCFGKDGKSLAELTTNSVLVDTMQQAI 392

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +  +R +  V+   +VL SP CAS DQ+NNF ERG  F
Sbjct: 393 EQ-IRPL--VKQGDMVLLSPACASLDQFNNFEERGDMF 427


>gi|296110605|ref|YP_003620986.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Leuconostoc
           kimchii IMSNU 11154]
 gi|295832136|gb|ADG40017.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Leuconostoc
           kimchii IMSNU 11154]
          Length = 448

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 136/469 (28%), Positives = 225/469 (47%), Gaps = 36/469 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD----DHPCAVKQAKDMGIEVI- 55
           M + +F N  + VFG  RSG +AA  L   G  V   +    D+    +  +  G++ I 
Sbjct: 1   MGIQNFNNKKVMVFGWARSGKAAAKCLTKIGAQVTVVNGGDFDNDDVYQTLRSAGVKFIN 60

Query: 56  --DFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
             D R +  S   FLV +PGI    +     VK A + N+ I+ ++ +       S    
Sbjct: 61  HDDDRSLDQSF-DFLVKNPGIDYQTD----IVKKAQKLNIPILTEVAV-----ALSLFNG 110

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
             IAVTG+NGK++T +LI  +L  +G  V   GNIG P+  + E  +     ++E SS+Q
Sbjct: 111 RLIAVTGSNGKTTTTSLIRDMLESDGQQVTTAGNIGTPVSEVVENLTDEETLLLELSSFQ 170

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKI 229
           +  TP I P I ++ NI  +HLD H + +NYV  K +I    T+ +  ++       +  
Sbjct: 171 LLGTPDIRPDIALITNIFANHLDYHGSRDNYVEAKFQITKNQTVDQTLVLNAEGKDTQNF 230

Query: 230 AYDMNFIGHSISRISSQ---SLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLV 286
               N      SR SS+   ++ +DS +  +   +  +A   V          HN++N+V
Sbjct: 231 ITRTNAKVVEFSRKSSEFMVTVNADSLMIANHPVMPLTAIKLV--------GPHNLENIV 282

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
            +  V    G+    I++ L + GG+ HRLQ +     + F NDSKAT++ +   A  + 
Sbjct: 283 AATTVAKLAGVHDSAIRQVLETFGGVAHRLQFVLSANQIKFYNDSKATDIEATQTALNSF 342

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT-LDQA 405
            +   W+AGGL + DD + L P ++ +      G +               ++ T + QA
Sbjct: 343 DQPTIWLAGGLDRGDDLTRLVPNLTHVKVVIAFGETQQKIVEVARAANKPVITVTDVTQA 402

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           +   V+  E      IVL SP  AS+DQY+NF ERG +++++V ++ G+
Sbjct: 403 VPVAVKLAE---AGDIVLLSPAAASWDQYDNFEERGEAYVTEVKKVMGV 448


>gi|20808074|ref|NP_623245.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thermoanaerobacter
           tengcongensis MB4]
 gi|254479543|ref|ZP_05092860.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Carboxydibrachium
           pacificum DSM 12653]
 gi|30316069|sp|Q8R9G4|MURD_THETN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|20516656|gb|AAM24849.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Thermoanaerobacter
           tengcongensis MB4]
 gi|214034511|gb|EEB75268.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Carboxydibrachium
           pacificum DSM 12653]
          Length = 450

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 147/466 (31%), Positives = 231/466 (49%), Gaps = 38/466 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD-DHPCAVKQA----KDMGIEVI--DF 57
             +   + V GLG SG++    L + G +VIA+D  +  A+K+A    KD+ +E+   +F
Sbjct: 2   ELKEKRVFVAGLGVSGVALCRVLVNLGANVIAYDRKNEIALKEALEELKDLPVEIKLGEF 61

Query: 58  REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
           +E     I  +VLSPGI+L  E     VK A    +EI+G++EL  R  +     +P  A
Sbjct: 62  KEEFLKGIELVVLSPGISLESE----IVKKAKDMGLEILGEVELAYRLSK-----APIYA 112

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPIL--NLEYFSPNRFYVIECSSYQIEL 175
           +TGTNGK++T +L+  + R  G  V + GNIG P++   LE   PN   V E SS+Q+E 
Sbjct: 113 ITGTNGKTTTTSLLGEMFRNAGRKVYVAGNIGYPLIYAALEA-GPNDHIVAEISSFQLET 171

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF 235
                P I  ++NI+PDHLDRH T ENY NIK +I    +     + ++  + + + +  
Sbjct: 172 VKEFRPKISCIINITPDHLDRHKTFENYANIKGRIFENQREEEYVVLNYD-DPVTWGLKE 230

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
              +     S+    ++  Y+ E FL       +  +      +HN++N + ++ V    
Sbjct: 231 RAKAKVFPFSRKKVLENGAYVKEGFLYLQNKKVIKVEDIYIPGEHNLENALAASSVAYLS 290

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G++V+ I+  L +  G+ HR++ +A +  + F NDSK TN  + I A    K  I  IAG
Sbjct: 291 GIEVDAIETTLRTFKGVEHRIEFVAEIEGIKFYNDSKGTNPDASIKAIQALKTPIVLIAG 350

Query: 356 GLSKSDDFSTLFP-FISKIAKAYFIGNSAMLFFHHFGGKINSTLSK---------TLDQA 405
           G  K  +F      F  K+ K   IG +A         KI  T  K          +D  
Sbjct: 351 GYDKGSEFDEFVKTFDKKVRKLILIGQTAQ--------KIKKTALKYSYPEEDIFLVDSL 402

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            ++V +  E  +    VL SP CAS+D + NF ERG +F   V ++
Sbjct: 403 EEAVRKAYEVAEKGDSVLLSPACASWDMFKNFEERGKAFKKAVMDL 448


>gi|152996629|ref|YP_001341464.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinomonas sp.
           MWYL1]
 gi|150837553|gb|ABR71529.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinomonas sp.
           MWYL1]
          Length = 449

 Score =  187 bits (475), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 148/460 (32%), Positives = 229/460 (49%), Gaps = 41/460 (8%)

Query: 12  AVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIE------VIDFREIPWS 63
           AV GLG +GLS    L   G+  +V+   ++P  ++QAK+   E       +D  E    
Sbjct: 11  AVVGLGATGLSCVRFLASKGIEFYVVDSRENPPGLEQAKEFCTEDRIFTGSLDVLETLG- 69

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
            ++ L +SPGIAL         +LA +  V + GDI+LF        + +PF+A+TG+N 
Sbjct: 70  -VTELFVSPGIAL---RTPVLARLAER-GVVMRGDIDLFC-----DYVDAPFVAITGSNA 119

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR-FYVIECSSYQIELTPTIDPS 182
           KS+   L++ +L+ +G + + GGN+GLP L+L   +PN  FYV+E SS+Q+E T  +   
Sbjct: 120 KSTVTTLVAMLLQASGKNAKAGGNLGLPALDL--LAPNTDFYVLELSSFQLETTHALQAD 177

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           +  LLN+S DH+DR+  L  Y   K+K+    K A+    D     +  +    G  +  
Sbjct: 178 LACLLNVSEDHMDRYKDLYEYQRAKQKVYRGCKAAVCNKQDILTAPLLAE----GVPVRA 233

Query: 243 ISSQS--LQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLVTSAVVCMQLGLK 298
            +++S  L+    L  D+    C    E ++  SQ   K  HN  N++ +  +   LG+ 
Sbjct: 234 FTTKSPDLKEYGLLNDDDGAWLCKGV-ERLYHTSQIALKGSHNHANVLAALAMLELLGVD 292

Query: 299 V--EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN----EKRRIYW 352
           V  E + + L   GGL HR +T+  L  V +INDSK TN+ + + A         + I  
Sbjct: 293 VLSEAVGKVLKEFGGLPHRCETVRVLNGVTYINDSKGTNVGATLAALQGLGSTANKNILL 352

Query: 353 IAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           IAGG  K  DFS L   ++ + +  Y  G  A           +     TLDQ + S+ +
Sbjct: 353 IAGGEGKGADFSALAKPVNNLVRTVYLFGKDADRIAEVLPSNTDVKHFDTLDQIVASIGQ 412

Query: 412 DVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           D +  +   IVLFSP CAS D Y N+  RG  F   V+E+
Sbjct: 413 DSKEGE---IVLFSPACASLDMYKNYEMRGAHFARLVAEL 449


>gi|254362463|ref|ZP_04978571.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
           haemolytica PHL213]
 gi|261493188|ref|ZP_05989717.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496956|ref|ZP_05993323.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|153094055|gb|EDN74967.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
           haemolytica PHL213]
 gi|261307392|gb|EEY08728.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261311151|gb|EEY12325.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 433

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 143/462 (30%), Positives = 225/462 (48%), Gaps = 61/462 (13%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP---- 61
           + N ++ + GLG +GLS     K    ++   D       +A   G + +D   IP    
Sbjct: 5   YENKTVTIIGLGTTGLSCVDFFKKKNANIQVID------TRANPAGADKLDVT-IPLHTG 57

Query: 62  -----WSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPF 115
                W + S  +V+SPG+A+    A   ++ A Q  VEI+GD+ELF RE +     +P 
Sbjct: 58  GLNSEWLLKSDLIVISPGLAV----ATPEIQQAIQAGVEIVGDVELFCREAK-----API 108

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           IA+TG+NGKS+   L + + ++ G  V +GGNIG+P+L+L        +V+E SS+Q+E 
Sbjct: 109 IAITGSNGKSTVTTLTTEMAKQAGIKVGMGGNIGVPVLSL-LEGDYDLFVLELSSFQLET 167

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF 235
           T ++      +LNIS DH+DR+ ++ +Y   K +I   +++ I+   D Q   I      
Sbjct: 168 TYSLKAKAATVLNISEDHMDRYDSIADYRQAKLRIYDNAENIIVNGEDAQTYPIQAVKKV 227

Query: 236 I----GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           I     ++   + +Q L S  D  I    +  S              +HN  N + +  +
Sbjct: 228 IRFAEQNAEYSLRNQMLYSGDDAIIQTKQMLISG-------------RHNEMNALAAMAL 274

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
                +  E I +AL   GGL HR Q +A    V ++NDSKATN+ S + A   LN    
Sbjct: 275 AEAANVPREGIVKALQIYGGLPHRFQAVATNDGVRWVNDSKATNVGSTVAALNGLNIAGT 334

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTLDQ 404
           +Y + GG  K+ DFS L P I+K        N     F   G  +      S L +T+ Q
Sbjct: 335 LYLLLGGDGKAADFSELKPLINK-------PNIVCYCFGQDGAALAELSEQSVLVETMQQ 387

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
           A++++   ++      +VL SP CAS DQ+ NF +RG  FM+
Sbjct: 388 AIEAIRPQLKK---GDMVLLSPACASLDQFKNFEQRGEVFMA 426


>gi|319789935|ref|YP_004151568.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thermovibrio
           ammonificans HB-1]
 gi|317114437|gb|ADU96927.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thermovibrio
           ammonificans HB-1]
          Length = 413

 Score =  187 bits (474), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 135/443 (30%), Positives = 213/443 (48%), Gaps = 38/443 (8%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL 70
           + VFG G+SGL AA  L+  G+  + + D                   E   S I+ +V 
Sbjct: 3   VLVFGRGKSGLGAAKLLERLGIEPLLYSDGEP----------------EPELSGIAAVVK 46

Query: 71  SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVAL 130
           SPG+       +  ++ A +  + + G++EL  R   FSS    FI+VTGTNGKS+T A+
Sbjct: 47  SPGVP----PRNPLLEKAKRAGIPVYGEVELGYR---FSS--GSFISVTGTNGKSTTTAV 97

Query: 131 ISHVLRKNGYDVQLGGNIGLPILNLEY-FSPNRFYVIECSSYQIELTPTIDPSIGVLLNI 189
           I H L+ +G +  +GGN G+P+       +   F  +E SS+QIE   +    + V LN+
Sbjct: 98  IYHALKLSGRESFIGGNYGIPLSTFALDTTEESFTALELSSFQIEDLTSFRSRVSVFLNV 157

Query: 190 SPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQ 249
           +PDHL+R+ + E Y   K +++  S  A++  +D   + +   +     S+S  S    +
Sbjct: 158 TPDHLNRYSSFEEYREAKLRLLDFSDCAVVNGDDPSFKHLKGKLGIYTFSVSTDSGADAR 217

Query: 250 SDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSC 309
            + +L +   +        + +        HN++N + + V    +GL  EEI     + 
Sbjct: 218 VEGELLVFSGY-------RIPYRELPLKGIHNLENYLAALVALAVVGLSEEEIYEGFKAF 270

Query: 310 GGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPF 369
            GL HR + + R G V+F+NDSKATN  ++  A L   R +  IAGG  K  DF  L P 
Sbjct: 271 KGLPHRCEVVGRKGGVVFVNDSKATNPDAMKKA-LESFRSVVLIAGGSDKGLDFKELKPL 329

Query: 370 ISKIAKAYF-IGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGC 428
           +    KA   IG +A      F  +     + ++++A   V R         +VL SPGC
Sbjct: 330 VKSRVKALVAIGETAGKLVETFKEETYVLTASSMEEA---VERAYALAGDEGVVLLSPGC 386

Query: 429 ASFDQYNNFRERGFSFMSQVSEI 451
           ASFD + NF+ERG  F   V  +
Sbjct: 387 ASFDMFKNFQERGERFREAVKRL 409


>gi|254449012|ref|ZP_05062466.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma
           proteobacterium HTCC5015]
 gi|198261406|gb|EDY85697.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma
           proteobacterium HTCC5015]
          Length = 447

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 139/457 (30%), Positives = 218/457 (47%), Gaps = 45/457 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAV------KQAKDMGIEVIDFREIPWSIIS 66
           + GLG +GLS A  L   GV     D   C        ++  ++ +++  F       + 
Sbjct: 13  IVGLGATGLSCARFLAAHGVEFSVADSRECPALLPVLREELPEVSVQLGAFSLQQLQGVE 72

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            L+LSPG+    +     V+ A    V ++GDIELF R       Q+P IA+TG+NGKS+
Sbjct: 73  TLLLSPGV----DPRQSLVQEAISRGVNVLGDIELFAR-----CAQAPLIAITGSNGKST 123

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIECSSYQIELTPTIDPSIGV 185
              L+  + +  G  V +GGN+G P L  E  +P    YV+E SS+Q+E   ++ P    
Sbjct: 124 VTELVGSMAQSAGMTVAIGGNLGTPAL--EILAPAVDLYVLELSSFQLETVQSLRPKAAT 181

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-------EKIAY--DMNFI 236
           +LNIS DH+DR+ ++E Y   K   ++ S+ A+I   D +        E++ +  D +  
Sbjct: 182 VLNISEDHMDRYSSIEAYAAAKAAAISHSEVAVINRQDKRVAAMLSDGERVTFGSDSSEA 241

Query: 237 GHSISRISSQS-LQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
           G+ + R++    L +  +  I+ S LK                +HN  N + +  +    
Sbjct: 242 GYGLERLAGTVWLTAQGERLIEVSDLKICG-------------EHNWLNALAALALADAA 288

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  E    AL    GL HR + +A    VI+INDSKATN+ +   A     + +  IAG
Sbjct: 289 GIAREASLAALKEFAGLPHRTEWVAERNGVIYINDSKATNVGATAAAVTGFDQPLVLIAG 348

Query: 356 GLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE 414
           G+ K  DF+ L   +   AKA   +G+ A L     G ++      ++ +A   V R  E
Sbjct: 349 GVGKGQDFAPLKTSLKARAKAVVLLGHDAELIGQALGDEVAQYRVASMSEA---VSRATE 405

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             +   +VL SP CASFDQY  F  RG  F   V+++
Sbjct: 406 LAECGDVVLLSPACASFDQYQGFEARGEDFARCVAQL 442


>gi|251792021|ref|YP_003006741.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Aggregatibacter aphrophilus NJ8700]
 gi|247533408|gb|ACS96654.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aggregatibacter
           aphrophilus NJ8700]
          Length = 438

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 144/462 (31%), Positives = 230/462 (49%), Gaps = 48/462 (10%)

Query: 6   FRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQ-AKDMGIEVIDFREIPW 62
           ++N  + V GLG++GLS    L  K + V VI     P    Q +K++ +      +  W
Sbjct: 3   YQNKKVTVIGLGKTGLSCVDFLRAKQADVRVIDTRQQPAGADQLSKEIPLHTGSLNQ-QW 61

Query: 63  SIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            + S  +V+SPG+A+        ++ A Q  VE++GDIELF RE        P +A+TG+
Sbjct: 62  LLESDLIVISPGLAVKTPE----IQTALQAGVEVVGDIELFCREA-----DKPIVAITGS 112

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+   L++ + +  G  V +GGNIG+P L+L     +  YV+E SS+Q+E T ++  
Sbjct: 113 NGKSTVTTLVAEMAKAGGLSVGMGGNIGIPALSL-LNQQHDLYVLELSSFQLETTYSLKA 171

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
               +LN++ DH++R+  L++Y + K KI    + A+I   D      A  +        
Sbjct: 172 MAATVLNVTEDHMNRYVDLQDYRHAKLKIYDNCQTAVINGED------ALTLPTTQRPQQ 225

Query: 242 RISSQSLQSDSDLYID--ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           ++S     +D  L  D   ++L     S +  D  + + +HN  N + +  +    G+ +
Sbjct: 226 QVSFAENNADYWLKTDGHHTYLMACNESILTIDEMKLSGRHNYMNALAAIALAQAAGVNL 285

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGL 357
             I+ AL   GGL HR Q       V +INDSKATN+ S + A   L  K +++ + GG 
Sbjct: 286 SGIQTALREFGGLDHRFQLAHMADGVRWINDSKATNVGSTVAALTGLQVKGKLHLLLGGD 345

Query: 358 SKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLS------KTLDQALKSV 409
            K  DFS L   I          N   +F + FG  GK  + LS       T++QA+ ++
Sbjct: 346 GKGADFSELATLI----------NQPHIFCYCFGQDGKQLAALSPQSQLFDTMEQAIAAI 395

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVS 449
                 +Q   +VL SP CAS DQ+  F  RG  F+ ++Q+S
Sbjct: 396 RL---QLQAGDMVLLSPACASLDQFPCFEARGDEFTRLAQLS 434


>gi|33865066|ref|NP_896625.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. WH 8102]
 gi|60390530|sp|Q7U8T1|MURD_SYNPX RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|33638750|emb|CAE07045.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           WH 8102]
          Length = 462

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 148/479 (30%), Positives = 230/479 (48%), Gaps = 67/479 (13%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAV----------KQAKDM---GIEV----- 54
           V GLGRSG  AA  L+ +G        HP +V          K+A+ +   G+EV     
Sbjct: 6   VVGLGRSGQGAARLLQATG--------HPVSVIDSGQGEQLEKKAEGLRQQGVEVQLQAP 57

Query: 55  --ID-FREIPW-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS 110
             ID FR  PW   +  +V+SPG+       H  +    Q  V + G++ +      + +
Sbjct: 58  LAIDSFR--PWLDQLQRVVISPGVPWD----HPTLDDLRQRGVAVDGEMAVA-----WDA 106

Query: 111 LQS-PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPI----LNL--EYFSPNRF 163
           L+  P++ +TGTNGK++   L+SHVL + G    +GGN+G+      LNL  E+ +   +
Sbjct: 107 LKHIPWVGITGTNGKTTVTHLLSHVLCQAGLAAPMGGNMGVSAAEMALNLQQEHTTAPDW 166

Query: 164 YVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND 223
            V+E SSYQIE    I P IG+   ++PDHL+RH T+E Y  IK+ ++  S HAI   +D
Sbjct: 167 LVMELSSYQIEAAKRIRPRIGIWTTLTPDHLERHGTVEAYRAIKRGLLERSDHAIFNADD 226

Query: 224 HQCEKIAYDMNFIGHSISRISSQSLQSD---SDLYIDESFLKCSATSEVIFDFSQET--- 277
               +     ++ G +   +S++S Q D   +DL+I+     C  +  +   F  E    
Sbjct: 227 PDLRQ--QRQSWTGGTW--VSAESAQPDGHPADLWINGKGWVCDRSQPL---FPAEALAM 279

Query: 278 -KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL 336
              HN QNL+       Q+GL    I   L S  G+ HRL+ + R+G+    NDSKATN 
Sbjct: 280 PGAHNRQNLLLVTAAARQIGLSPASIVAGLRSFPGVPHRLEPVGRIGNAQVFNDSKATNY 339

Query: 337 HSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF--GGKI 394
            +        +  +  +AGG +K  D +     +++ A A  +  +     H    G   
Sbjct: 340 DAAAVGLKAMQGPVVVLAGGSTKQGDATGWLEELNRKACAVVLFGAGTEELHGLITGANF 399

Query: 395 NSTLSKTLD--QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              L++  D   A++  VR  E +   S+ L SP CASFDQY +F  RG  F   + ++
Sbjct: 400 TGELTRRTDLTSAVEEAVRSAEALGATSL-LLSPACASFDQYRDFEARGDHFKQLIHQV 457


>gi|312128117|ref|YP_003992991.1| udp-n-acetylmuramoylalanine/d-glutamate ligase
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311778136|gb|ADQ07622.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 458

 Score =  186 bits (473), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 150/473 (31%), Positives = 243/473 (51%), Gaps = 49/473 (10%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA--VKQAKDMGIEVID---FREI 60
            +  ++ V GLGRSGL++A  LK  G  VI +D+       K+ ++   E++D   + EI
Sbjct: 3   LKGKNVLVVGLGRSGLASARFLKKHGAFVIGFDEKAEDQFKKEDRNCAQELLDEIYYCEI 62

Query: 61  PWSII---SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
           P  +I     +V+SPG+ L+       + LA++  VE+IG+IEL     RF   ++  +A
Sbjct: 63  PDEVIDRVQLVVVSPGVPLS----KRPLVLAHKKGVEVIGEIEL---AYRFCKSKN-IVA 114

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELT 176
           +TGTNGK++T  L+  +L+K   DV + GNIGLP ++ +E  S N  +V+E SS+Q+E  
Sbjct: 115 ITGTNGKTTTTTLVGEILKKQYEDVVVCGNIGLPFIDTVETSSENTIFVLEISSFQLETI 174

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN-- 234
               P +G +LNI+PDHL+RH T+ENY+  K +I          I++     + YD N  
Sbjct: 175 KYFKPKVGCILNITPDHLNRHMTMENYIKAKMRIFE-------NIDEMGYTVLNYDNNVT 227

Query: 235 --FIGHSISRI---SSQSLQSDSDLYIDES---FLKCSATSEV-----IFDFSQETKKHN 281
              IG +   +   S    Q ++ ++++     F     T EV     IF   Q    HN
Sbjct: 228 RDLIGLAKGNVIVFSKTKTQFENVVFVENDVIYFTFEGKTQEVMKKDEIFIPGQ----HN 283

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
           ++N + +    +  G++ + I++ L +  G+ HR++ +A +  + F NDSK TN  +   
Sbjct: 284 LENALAAISCTLPFGIEKDTIEQVLKTFRGVEHRIEFVAEINGIKFYNDSKGTNTDAAEK 343

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFG--GKINSTL 398
           A    K  I  IAGG  K + F      I+K + K + +G +           G  N  L
Sbjct: 344 AISAFKNPIILIAGGYDKGESFEKFVSLIAKRVKKVFLLGQTKHKIASELEKIGYKNFEL 403

Query: 399 SKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             TL +A++   +  E+ Q   +VL SP CAS+D + N+ +RG  F   V E+
Sbjct: 404 VSTLKEAVR---KSFESAQNGDVVLLSPACASWDMFENYEQRGRMFKEYVREL 453


>gi|323497893|ref|ZP_08102902.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           sinaloensis DSM 21326]
 gi|323316938|gb|EGA69940.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           sinaloensis DSM 21326]
          Length = 441

 Score =  186 bits (473), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 147/451 (32%), Positives = 224/451 (49%), Gaps = 42/451 (9%)

Query: 9   HSIAVFGLGRSGLSAACALK----DSGVHVIAWDDHPCAVKQAKDMGIEVIDFR-EIPWS 63
           HS+ V GLG +GLS    L     D  + VI   D+P   ++A   G+++        W 
Sbjct: 10  HSVVVVGLGITGLSVVKYLAKLPYDLTIKVIDTRDNPPG-QEALPSGVKLHSGSWNQAWL 68

Query: 64  IISFLVLS-PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
             + LV++ PGIAL        ++   +  V ++GDIELF  +     +  P IA+TG+N
Sbjct: 69  FEADLVVANPGIALATPE----IQKTLEAGVAVVGDIELFAWQ-----VDKPVIAITGSN 119

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+   L   V +  G  V +GGNIG+P L L    P   YV+E SS+Q+E T +++  
Sbjct: 120 GKSTVTDLAGVVAKAAGLQVGVGGNIGVPALEL-LEQPADLYVLELSSFQLETTSSLNLK 178

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH---- 238
               LN+S DH+DR+  +E Y   K +I    +HA  CI + Q +K  Y  +F G     
Sbjct: 179 AAAFLNLSEDHMDRYDGMEGYRQAKLRIF---EHAESCIVNAQ-DKATYPEHFKGELVEF 234

Query: 239 SISRISSQSLQSDSDL-YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
           S++  +  S+Q   +  Y+ +  L   AT E+         +HN+ N +    +   +G+
Sbjct: 235 SLTDKTQFSVQVQQNREYLCQDNLPILATDELTL-----VGRHNVANALVVLALLDCVGI 289

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAG 355
            V +   AL S  GLTHR Q +A    V ++NDSKATN+ S + A   L    ++Y + G
Sbjct: 290 DVSQGLSALKSYNGLTHRCQIVADNHGVKWVNDSKATNVASTLAALSGLTLTGKLYLLVG 349

Query: 356 GLSKSDDFSTLFPFISK--IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           G+ K  DFS L P ++K  +    F  + A     H   K  + + + ++ A   +    
Sbjct: 350 GVGKGADFSELAPVLAKLNVQLCCFGEDGAQFMALHPSAKQFTHMQEIVEWAKPQLTTG- 408

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
                  +VL SP CASFDQ+NNF  RG +F
Sbjct: 409 ------DMVLLSPACASFDQFNNFMARGDAF 433


>gi|325294673|ref|YP_004281187.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065121|gb|ADY73128.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 412

 Score =  186 bits (472), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 143/445 (32%), Positives = 218/445 (48%), Gaps = 55/445 (12%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDD-HPCAVKQAKDMGIEVIDFREIPWSIISFLVLS 71
           V G G+SG +AA  L+  G  VI +DD  P  +    D+                 +V S
Sbjct: 5   VLGKGKSGKAAAELLEKKGYKVILYDDKEPTKLPDFPDL-----------------VVKS 47

Query: 72  PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALI 131
           PGI     + H  V    +  +E+IG+IEL  R       +   I++TGTNGKS+T ALI
Sbjct: 48  PGIP----SYHSVVVSYKKKGIEVIGEIELAYR-----YFKGKIISITGTNGKSTTTALI 98

Query: 132 SHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNIS 190
             VL++ GY   +GGN G+P  +  E  + +   V+E SS+QIE       SI ++LNI+
Sbjct: 99  YQVLKEAGYKTFIGGNFGIPFSSFAEETTDDSITVLELSSFQIEDLKDFRSSISIILNIT 158

Query: 191 PDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQS 250
           PDH++R+ + E YV  K K++  S+  I+  +D     +  + NF   S  R        
Sbjct: 159 PDHMNRYKSFEEYVKAKLKLLGHSEFCILNQDDPVLRNLNRE-NFFFFSRKR-------- 209

Query: 251 DSDLYIDESFLKCSATSEVIFDFSQETKK------HNIQNLVTSAVVCMQLGLKVEEIKR 304
            +D + ++  + C        DF  E +       HN++N + + +   +L L  E+I  
Sbjct: 210 KADAFFEKGKIFCK-------DFKIEVELLPLKGIHNVENYMGALLALKKLKLSNEKILN 262

Query: 305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFS 364
              +  GL HR + +A +  + FINDSK+TN+ S+  A L     I  IAGG  K  DFS
Sbjct: 263 GFKTFYGLPHRTELVAEINGIKFINDSKSTNVDSLKKA-LESYEDIILIAGGSDKGLDFS 321

Query: 365 TLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
           +L   + +  K    IG +A  F   F   ++  +S  + QA+K+  +   +     +VL
Sbjct: 322 SLRKLVRERVKGIVAIGETAEQFKKTFSDIVDVRISDNIFQAVKTAYKLASS---GDVVL 378

Query: 424 FSPGCASFDQYNNFRERGFSFMSQV 448
            SPGCASFD + NF +RG  F   V
Sbjct: 379 LSPGCASFDMFKNFEDRGEKFREAV 403


>gi|15602005|ref|NP_245077.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|30316119|sp|Q9CPB0|MURD_PASMU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|12720355|gb|AAK02224.1| MurD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 434

 Score =  186 bits (471), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 142/460 (30%), Positives = 234/460 (50%), Gaps = 54/460 (11%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQ-AKDMGIEVIDFREI 60
           +S++N  + V GLG++GLS    L  K + V VI     P   +Q AK++ +      + 
Sbjct: 3   TSYKNKKVTVIGLGKTGLSCVDFLLAKQADVRVIDTRTQPAGAEQLAKNVPLHTGSLNQ- 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +++SPG+A+        ++ A    +E+IGDIELF RE +      P IA+T
Sbjct: 62  QWLLESDLIIISPGLAVKTPE----IQTALAAGIEVIGDIELFCREAK-----KPIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+  +L++H++   G  V +GGNIG+P L+L     +  YV+E SS+Q+E T ++
Sbjct: 113 GSNGKSTVTSLVAHMVNAAGLKVGMGGNIGIPALSL-LEQAHDMYVLELSSFQLETTYSL 171

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHS 239
             +   +LNIS DH++R+  LE+Y   K KI   ++ A+I       E     M+ + + 
Sbjct: 172 KATSATVLNISEDHMNRYVDLEDYRQAKLKIYHHAQTAVI-----NAEDALTAMDGLKNG 226

Query: 240 ISRISSQSLQSDSDLYID----ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
           +S       + ++D ++      S+L       +  D  +   +HN  N + +  +    
Sbjct: 227 VSFG-----EDNADYWLKTEKGRSYLMAKDERVLACDEMKLVGRHNYMNALAAIALAQAA 281

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGH-VIFINDSKATNLHSVIHAF--LNEKRRIYW 352
           G+ +E I+RAL    GL HR Q +A   H V ++NDSKATN+ S + A   L     ++ 
Sbjct: 282 GIPLESIRRALREFNGLDHRFQ-LAHFAHGVRWVNDSKATNVGSTVAALTGLQLNGTLHL 340

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLS------KTLDQ 404
           + GG  K  DFS L   I          N   +  + FG  G+  + LS       T+++
Sbjct: 341 LLGGDGKGADFSELASLI----------NQPNIICYCFGQDGEQLAALSPRSQRFSTMEE 390

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           A+ ++      +    +VL SP CAS DQ+++F +RG  F
Sbjct: 391 AINAL---RPTLSAGDMVLLSPACASLDQFSSFEQRGDEF 427


>gi|27904701|ref|NP_777827.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
 gi|31076803|sp|Q89AQ2|MURD_BUCBP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|27904098|gb|AAO26932.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
          Length = 442

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 139/468 (29%), Positives = 248/468 (52%), Gaps = 52/468 (11%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVH--VIAWDDHPCAVKQAKDMGIEVIDFREI-- 60
           ++ +  I +FG+G +G+S        G++  ++  D  P  +++       +I F+ I  
Sbjct: 4   NYLHKKILIFGMGLTGISCLNFFLSKGIYPKIMDTDKRPKHIEK-------IIKFKNICY 56

Query: 61  -------PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ 112
                   W + S  +++SPGI      +H  +K A + N+EIIGDIELFV+E +     
Sbjct: 57  HTGSVNYSWILQSNLIIVSPGIT----PSHPALKFATKKNIEIIGDIELFVQETKV---- 108

Query: 113 SPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSY 171
            P IA+TG+NGKSS   ++  +++K G+   +GGNIG+P LN+   F+   F+++E SS+
Sbjct: 109 -PIIAITGSNGKSSVTKIVKEIIQKAGFTTYIGGNIGIPALNIVNKFA--HFFILELSSF 165

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHT-LENYVNIKKKIVTMSKHAIICIND----HQC 226
           Q+E T ++   I  +LNI+PDHL+R+ + ++ Y   K+KI   SK  II +++    ++ 
Sbjct: 166 QLERTFSLKAYIATILNITPDHLNRYSSDIKEYEKAKQKIYKNSKICIINVDNPVTINRQ 225

Query: 227 EKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLV 286
            ++   ++F  HS     S +    ++ ++    LK   T ++     + + +HN  N++
Sbjct: 226 AQLTKCISFGVHSGDYHLSHTY---TNTWLCYKSLKLINTKKL-----KLSGRHNYINML 277

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--L 344
           ++  +  +L +  +   R L +  GL HR Q + +  ++ +INDSK+TN+ S   A   +
Sbjct: 278 SALAIVHELKISFKISVRILKNFLGLPHRCQKVYKNNNITWINDSKSTNIASTKSAIQSI 337

Query: 345 NEKRRIYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLD 403
           N K +I  I GG  KS + + L P +   A   Y  G      F+ +  K  S + +TL 
Sbjct: 338 NTKGKIRLILGGDKKSSNLNLLKPILKNNAIVIYCYGKDKKELFNLYPHK--SKIFETLQ 395

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           + ++ +      VQ   +VL SP C+S DQ++ F ERG +F+  + E+
Sbjct: 396 EVMQHISVQ---VQPGDVVLLSPACSSLDQFSGFEERGNTFVKLIQEL 440


>gi|224826076|ref|ZP_03699179.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella
           nitroferrum 2002]
 gi|224601713|gb|EEG07893.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Lutiella
           nitroferrum 2002]
          Length = 455

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 144/468 (30%), Positives = 223/468 (47%), Gaps = 43/468 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVI---AWDDHPCAVKQAKDM---GIEVIDFRE 59
           F N  I V GLG +GLSAA  L   G  V    + D+ P A   A+ +    ++   F  
Sbjct: 3   FANRHIVVVGLGDTGLSAARWLAAHGATVTVADSRDNPPNAATLAESLPGVALKTGAFDA 62

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
             ++    LV+SPG+A+    A   +    +   E++GD+ELF R    +   S  IA+T
Sbjct: 63  TTFAGAEMLVVSPGVAV----ATPAIAAFRRAGGEVVGDVELFARA--IAGSGSKVIAIT 116

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFSPNR--FYVIECSSYQIE 174
           G+NGKS+  +L+ H+ R+ G D  L GNIGLP+L+       S  R   +V+E SS+Q+E
Sbjct: 117 GSNGKSTVTSLVGHLCRQAGLDTVLAGNIGLPVLDALGEREASGKRPDVWVLELSSFQLE 176

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN 234
            T +++     +LNIS DHLDR+  L +Y + K  +       ++  +D     +   M 
Sbjct: 177 TTTSLNADAATVLNISEDHLDRYADLLDYAHSKTAVFNGRGVQVLNRDD----ALVRAMV 232

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLVTSAVVC 292
             GH+  R  S    +D  L  D      +   E +FD ++ + +  HN  N + +  + 
Sbjct: 233 RPGHA-QRWFSLKETADYALRQDAGRYWLTVAGEAVFDCAEMSLQGLHNAANALAALALT 291

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
             +GL    +   L +  GL HR++ +A +  V +I+DSK TN+ +   A     R +  
Sbjct: 292 EAIGLPRAALLEGLKTFTGLAHRVEFVAEVHGVRYIDDSKGTNVGATEAALNGMTRPVVL 351

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLS---------KTLD 403
           IAGG  K  DFS L P  ++IA+       A+L      GKI + L           TL+
Sbjct: 352 IAGGDGKGQDFSPLKPACARIAR-------AVLLIGRDAGKIRAVLEGLPLPIVDCATLE 404

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +A +   R  E      +VL SP CAS D + N+  R   F+  V  +
Sbjct: 405 EATREAARLAEA---GDVVLLSPACASLDMFKNYAHRAQVFIDGVRAL 449


>gi|332142426|ref|YP_004428164.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327552448|gb|AEA99166.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 479

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 151/493 (30%), Positives = 240/493 (48%), Gaps = 58/493 (11%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREIPWSII 65
           R HS  V GLG +G +    L      V A+D  P  +  +  D  ++     ++    +
Sbjct: 6   REHSYVVGGLGVTGQACVRFLLQHKATVKAFDTRPTFSAPENLDTSMQAFLAEKVTCRAL 65

Query: 66  SF--------LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP--- 114
           S         LVLSPG+AL  E     V+LA Q  VE+IGD+ELF R        +P   
Sbjct: 66  SADYFDGVDTLVLSPGLALDIEQ----VELAKQCGVEVIGDVELFARLNTSFKSDTPAKR 121

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQI 173
            + +TG+NGK++   L++H+L   G      GN+G P+L  LE  S     V+E SS+Q+
Sbjct: 122 VVGITGSNGKTTVTLLVNHLLNACGVKSIEAGNVGRPVLEALE--SDADVVVMELSSFQL 179

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD- 232
           E T ++      +LNIS DHLDRH TLE+YV+ K +I   +K A++       E +A D 
Sbjct: 180 ETTSSLVLEAATVLNISDDHLDRHGTLEHYVDAKHRIFANAKSAVVW---RDGEFVAPDD 236

Query: 233 -MNFIGHSISRISSQS-----------LQSDSDLYI----DESFLKCSATSEVIFDFSQE 276
            +N  G + ++ ++Q+             SDS   I    D   +  +    +       
Sbjct: 237 ALNVEGQANAQKANQNGLLRSAIEYGLGASDSGFSIVTMLDSKHIAFNGKPIIALSDIHL 296

Query: 277 TKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL 336
              HN+ N++ +  +C +LG+  ++  + L S     HR   +AR+  V +I+DSKATN+
Sbjct: 297 AGMHNVLNIMAALGICCKLGVSPDQAVKHLHSFKSAPHRCVEVARVNSVRYIDDSKATNI 356

Query: 337 HSVIHAF----LNEKRRIYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFG 391
            + I A          ++  IAGG +K  D S+L P++++ ++  + +G  A LF   F 
Sbjct: 357 GATIAALEGISPTIAGKLLLIAGGDAKGADISSLAPYLTQYVSHVFALGKDAHLFAQSFA 416

Query: 392 GKINSTLSKTLDQALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
              ++T   T+ +A+K  +R    +  P   VL SP CAS D + N+  RG  F   V +
Sbjct: 417 ---HTTQVATMKEAVKGALR----LAAPGDAVLLSPACASIDMFKNYMHRGEMFKQTVHD 469

Query: 451 IPGIEMLVDIEEE 463
                 L+DI++E
Sbjct: 470 ------LLDIKQE 476


>gi|326334992|ref|ZP_08201192.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Capnocytophaga
           sp. oral taxon 338 str. F0234]
 gi|325692797|gb|EGD34736.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Capnocytophaga
           sp. oral taxon 338 str. F0234]
          Length = 445

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 132/448 (29%), Positives = 225/448 (50%), Gaps = 26/448 (5%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFL-- 68
           + + G G SG+ AA      G  V   D  P   K  +++    I + E   S    L  
Sbjct: 3   LVILGGGESGIGAAILGLKQGWEVFLSDRAPLKEKYKQELASLPICWEEGQHSEQEILSA 62

Query: 69  ---VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKS 125
              + SPGI          ++ A +  +EII +IE   R       Q+  IAVTG+NGK+
Sbjct: 63  DCIIKSPGIPQKAP----IIEKARKKGIEIISEIEFASR-----YTQAKIIAVTGSNGKT 113

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
           +T +L+ H+L + G  + +GGNIG     +    P  +YV+E SS+Q++   +  P I +
Sbjct: 114 TTTSLLYHLLEQAGLSIGVGGNIGNSFARMVAQEPKEYYVLEISSFQLDDISSFRPHIAL 173

Query: 186 LLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQ----CEKIAYDMNFIGHSI 240
           LLNI+PDHLDR+ +  +NY++ K +I      A   I D       E++A   +     I
Sbjct: 174 LLNITPDHLDRYNYQFQNYIDAKFRITEFQSQADFLIYDADDPVLQEELAKRKDIKAQCI 233

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLGLK 298
                +S +  +    D+ F      ++      + T   KHN++N++ ++V    L ++
Sbjct: 234 PFSLEKSNEQGAYCLDDKLFHITINQNKFEMSIRELTIKGKHNLKNVMGASVAAKLLNIR 293

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLS 358
            E I+++L++  G+ HRL+ +  +G V +INDSKATN++SV +A  +    + WI GG  
Sbjct: 294 NENIRKSLMTFQGVPHRLEFVKEVGEVRYINDSKATNVNSVYYALDSMPDGLIWIVGGQD 353

Query: 359 KSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTL-SKTLDQALKSVVRDVENV 416
           K +D++ L P++S+  KA   +G         F   + + + + +++ A++ V R +   
Sbjct: 354 KGNDYNPLIPYVSQKVKAIVCLGLDNQKIIQTFQSIVPTIIETHSMEDAVQ-VSRGLS-- 410

Query: 417 QLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +    VL SP CASFD + ++ +RG  F
Sbjct: 411 EEGDTVLLSPACASFDLFQSYEDRGNQF 438


>gi|148242946|ref|YP_001228103.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. RCC307]
 gi|147851256|emb|CAK28750.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           RCC307]
          Length = 458

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 147/467 (31%), Positives = 221/467 (47%), Gaps = 40/467 (8%)

Query: 11  IAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQAKDM---GIEVI--------DF 57
           + V GLGRSG+ AA  L  +D+ V ++  +      ++A ++   GI+V          F
Sbjct: 5   VVVVGLGRSGIGAARLLNARDADVWLLESNSSAELKRRADELNAIGIQVELGKPLALESF 64

Query: 58  REIP-WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
             +P W   S +V+SPGIA      H  +         ++G++E  V  +  + +  P+I
Sbjct: 65  EALPRWP--STVVISPGIAFD----HPVLNQLRDRGCRVVGEVE--VAWQAMAGI--PWI 114

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIG-----LPILNLEYFSPNRFYVIECSSY 171
            +TGTNGK++  +L++H+L++ G D    GNIG     L +  LE   P R  V+E SSY
Sbjct: 115 GITGTNGKTTVTSLVAHLLQQGGLDAPACGNIGASAAELALACLEGEKPERV-VVELSSY 173

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAY 231
           QIE  P++ PSIGV   ++PDHLDRH TLE Y +IK  ++  S    +  +D      A 
Sbjct: 174 QIEAAPSVQPSIGVWTTLTPDHLDRHGTLERYRSIKAGLLQQSGRQFLNADDRDLFAHAA 233

Query: 232 DMNFIGHSISRISSQ-SLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTS 288
           +         R   Q S      L++    L C+ T   +F  +       HN QNL  +
Sbjct: 234 EWPQALWVSGRDKDQFSAAITPHLWVSGGQL-CNQTGP-LFPCAALAMPGAHNRQNLALA 291

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
             V ++ GL   +I+    S  G+ HRL+ I  L  + + NDSKATN  + + A  + +R
Sbjct: 292 TAVALECGLSPAQIEAGCRSFPGVPHRLERIRELSGITYFNDSKATNYDASLVALQSLER 351

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST----LSKTLDQ 404
            +  +AGG +K  +       + + A A  +   A   F    G           + LDQ
Sbjct: 352 PLVVLAGGRAKRGEPGAWLEALGQKAAAVVLFGEAQSTFRELLGSAGYPGVIEQQEHLDQ 411

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           AL    R  E +     VL SP CASFDQY +F  RG  F   V  +
Sbjct: 412 ALPLARRLAEQLNC-QAVLLSPACASFDQYRDFEVRGDHFRQLVEAM 457


>gi|90020493|ref|YP_526320.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Saccharophagus
           degradans 2-40]
 gi|122063257|sp|Q21MH1|MURD_SACD2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|89950093|gb|ABD80108.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Saccharophagus
           degradans 2-40]
          Length = 456

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 138/463 (29%), Positives = 227/463 (49%), Gaps = 35/463 (7%)

Query: 8   NHSIAVFGLGRSGLSAACALKDSGVHVIAWD---DHP------CAVKQAKDMGIEVIDFR 58
           ++ I V G+G +GLS A  L + G +    D   D P       A  QAK   ++V D  
Sbjct: 8   DNPIVVVGMGLTGLSVARYLANKGANFFLLDTRKDLPKSTWQQVAELQAKCPSMKV-DNG 66

Query: 59  EIPWSIISF---LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPF 115
            +   +++    +VLSPG+ L    A   ++ A    VEIIGDI+LF+ ER+     +P 
Sbjct: 67  SLDVELLTSAKQIVLSPGVPL----ATPEIQQAKAAGVEIIGDIDLFLAERK-----APV 117

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIEL 175
           + +TG+NGKS+   L+       G +V +GGNIG+P+L+L   +    YV+E SS+Q+E 
Sbjct: 118 VGITGSNGKSTVTTLVGLAAENAGMNVAVGGNIGVPVLDLLADADVELYVLELSSFQLES 177

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH-QCEKIAYDMN 234
                  +  +LN+SPDH+DR+ +L +Y   K++I   +K  +  + D      +   + 
Sbjct: 178 VKRAQLDVACVLNVSPDHMDRYPSLAHYCQAKQRIYFGAKKIVYNLEDTLTIPPVMAGVE 237

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVVC 292
             G S  +      +++  + ++      S   + +F  +  +    HN++N + +  +C
Sbjct: 238 RYGFSSKKAVE---ENEKHVLLNNDTNALSLNGQDVFSVADIKIAGAHNLKNALAALAIC 294

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHS---VIHAFLNEKRR 349
               +    +K+AL    GL HR Q +A    V +INDSKATN+ S    I     + + 
Sbjct: 295 DAANIPFAGLKQALQEFEGLPHRCQWVANKNGVTYINDSKATNIGSAQAAIEGLAGQFKN 354

Query: 350 IYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           I  IAGG  K  DFS+L   I++ ++    IG  A         ++    ++TL+ A+K 
Sbjct: 355 IVLIAGGDGKGADFSSLGKVINQYVSAVVLIGVDAPKIQAVVDPQVMCVKAQTLNAAVKQ 414

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                ++  L   VL SP CAS D + N+  RG  F   V+E+
Sbjct: 415 AALLAKSGDL---VLLSPACASLDMFANYEARGHEFALTVAEV 454


>gi|315633815|ref|ZP_07889104.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Aggregatibacter
           segnis ATCC 33393]
 gi|315477065|gb|EFU67808.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Aggregatibacter
           segnis ATCC 33393]
          Length = 434

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 145/456 (31%), Positives = 227/456 (49%), Gaps = 48/456 (10%)

Query: 6   FRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQA-KDMGIEVIDFREIPW 62
           +++  + V GLG++GLS    L  K + V VI   + P   +Q  K + +      +  W
Sbjct: 3   YQDKKVTVIGLGKTGLSCVDFLRAKHADVRVIDTRNAPAGAEQLDKAIPLHTGSLNQ-QW 61

Query: 63  SIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            + S  +V+SPG+A+        ++ A Q  VE++GDIELF RE        P +A+TG+
Sbjct: 62  LLESDLIVISPGLAVKTPE----IQTALQAGVEVVGDIELFCREA-----DKPIVAITGS 112

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+   L++ + +  G  V +GGNIG+P L+L   S +  Y++E SS+Q+E T ++  
Sbjct: 113 NGKSTVTTLVAEMAKAAGLSVGMGGNIGIPALSLLNQSHD-IYILELSSFQLETTYSLKT 171

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
               +LN++ DH++R+  L++Y + K KI    + A++   D         +    H   
Sbjct: 172 VAATVLNVTEDHMNRYVDLQDYRHAKLKIYDNCQTAVVNGED------PLTLPTTQHPEK 225

Query: 242 RISSQSLQSDSDLYIDESFLKCSATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           R+S     +D  L  +       A  EVI   D  + T +HN  N + +  +    G+ +
Sbjct: 226 RVSFAEHHADYWLKNENQKTYLMARGEVILACDEMKLTGRHNYMNALAAIALAQAAGINL 285

Query: 300 EEIKRALLSCGGLTHRLQTIARLGH-VIFINDSKATNLHSVIHAF--LNEKRRIYWIAGG 356
             I+ AL   GGL HR Q +A + H V +INDSKATN+ S + A   L    ++Y + GG
Sbjct: 286 LGIQTALREFGGLEHRFQ-VAHMAHGVRWINDSKATNVGSTVAALTGLQVAGKLYLLLGG 344

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLSK------TLDQALKS 408
             K  DFS L   I          N   +F + FG  GK  + LS       T++QA+ +
Sbjct: 345 DGKGADFSELATLI----------NQPHIFCYCFGQDGKQLAALSSQSQLFDTMEQAIAA 394

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +      +Q   +VL SP CAS DQ+  F  RG  F
Sbjct: 395 I---RPQLQAGDVVLLSPACASLDQFPCFEARGDEF 427


>gi|123966762|ref|YP_001011843.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. MIT 9515]
 gi|158512733|sp|A2BY75|MURD_PROM5 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|123201128|gb|ABM72736.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9515]
          Length = 477

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 230/466 (49%), Gaps = 45/466 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID----------FREIPW 62
           V GLGRSG  AA  L+  G  VI W+ +           +E +D          F E   
Sbjct: 16  VIGLGRSGFWAAKYLRSLGKKVIVWESNENEELSETKEILEKLDISVCLNKQFLFEEFSE 75

Query: 63  SI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIAVT 119
            +  I  +V+SP I +  +     +KL  +  +E++G++ +      + SL++  +I +T
Sbjct: 76  CLNQIEAVVISPAIPIDHKT---IIKLKEK-GIEVLGEVNI-----AWESLKNINWIGIT 126

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQIEL- 175
           GTNGK++   L+SH+LR N       GNIG P+  + Y   ++   + V E SSYQIE+ 
Sbjct: 127 GTNGKTTVTHLLSHILRTNNLLAPFAGNIGTPLCKIAYSIKSKNIDWLVAELSSYQIEIA 186

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF 235
           T  I P IG+    + DHLDRH TL+NY  IK  ++  S+  I   +D     I    NF
Sbjct: 187 TLCIKPKIGIWTTFTADHLDRHKTLDNYFKIKNSLLKQSEFRIYNYDD-----IHLRENF 241

Query: 236 IGHSISR---ISSQSLQSD---SDLYID-ESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
              S+S+   I++ S QSD    D +I+ E F+     + +     +    HN QNL+ +
Sbjct: 242 --KSLSKGIWITTSSKQSDLDHCDYWINNEDFIVERQENLLSLKNFKLKGNHNTQNLLLA 299

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
                ++GL  E+IK ALLS   L HR++TI +   +  INDSKATN  S        K 
Sbjct: 300 IAAARKIGLSPEKIKNALLSYEQLPHRMETIYQSNKLEIINDSKATNFDSSTAGIKAIKG 359

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFI-GNSAML---FFHHFGGKINSTLSKTLDQ 404
               I+GG  KS  +      I+K AKA F+ G S+          G K +  +   L +
Sbjct: 360 APIIISGGKLKSGSYIEWVNIINKKAKAVFLFGESSQTLKKLILEGGFKKDIFIFNDLSE 419

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            +  V   +EN Q+ ++ LFSP C+SFDQ+ N+ ERG  F   + E
Sbjct: 420 VINYVYSYIENNQIETL-LFSPSCSSFDQFRNYEERGDIFKKLIHE 464


>gi|113460502|ref|YP_718566.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           somnus 129PT]
 gi|112822545|gb|ABI24634.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Haemophilus somnus
           129PT]
          Length = 436

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 143/466 (30%), Positives = 231/466 (49%), Gaps = 52/466 (11%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREI 60
           + ++N +I V GLG++GLS    L  + + V VI     P  A K  +++ +      + 
Sbjct: 3   NQYQNKNICVVGLGKTGLSCVDFLLRQQANVRVIDTRQQPTGAEKLPENVPLHTGSLNQQ 62

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
                  +V+SPG+++        ++ A Q  VE++GDIELF R         P IA+TG
Sbjct: 63  WLLEADLIVISPGLSVKTLE----IQTALQAGVEVVGDIELFCRHAN-----KPIIAITG 113

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           +NGKS+   L+S + +++G  V +GGNIG+P L L        YV+E SS+Q+E T ++ 
Sbjct: 114 SNGKSTVTTLVSEMAKEDGLKVGMGGNIGIPALEL-LQQDYDIYVLELSSFQLETTYSLK 172

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--HQCEKIAYDMNFIGH 238
            +   +LNIS DH+DR+  +E+Y   K +I    + A+I   D     E +   + F G 
Sbjct: 173 ATAATILNISEDHMDRYLDIEDYRQAKLRIYENCQRAVINAEDVLTTTEDLKSPITF-GE 231

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLG 296
           S         Q+D  L  +       A   +I   D  +   +HN  N + ++ +   + 
Sbjct: 232 S---------QADYWLKTENGKQYLMAKERLILPCDEMKLVGRHNYMNALAASALVQAVD 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           +    I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L    +++ + 
Sbjct: 283 ISFTAIRTALRKFTGLAHRFQLAYQKDDVRWINDSKATNVGSTVAALTGLYVANKLHLLL 342

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GK------INSTLSKTLDQAL 406
           GG  KS DFS L   I          N   ++ + FG  GK      + S L  T++QA+
Sbjct: 343 GGDGKSADFSELATLI----------NQPHIYCYCFGQDGKELAALSVQSQLFDTMEQAI 392

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVSE 450
           +++     N+Q   +VL SP CAS DQ+ +F  RG  FS ++++++
Sbjct: 393 EAI---RPNLQQGDMVLLSPACASLDQFKSFEHRGDVFSDLAKLAQ 435


>gi|298491728|ref|YP_003721905.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase ['Nostoc azollae'
           0708]
 gi|298233646|gb|ADI64782.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase ['Nostoc azollae'
           0708]
          Length = 456

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 151/458 (32%), Positives = 227/458 (49%), Gaps = 43/458 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFR---------EI 60
           V GLG+SG++AA  LK  G  V    DH   P  ++Q +++  E I  +         EI
Sbjct: 6   VIGLGKSGIAAARLLKQEGWEV-ELSDHNTSPNLLEQQQELANEQIPVKLGNTPDLESEI 64

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKL---ANQFNVEIIGDIELFVRERRFSSLQS-PFI 116
              +   +V+SPG+        W + +   A +  +E IG+IEL  R      LQ+ P++
Sbjct: 65  ---LPQLIVVSPGVP-------WDIPILVKARELGIETIGEIELAWRH-----LQNIPWV 109

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVI-ECSSYQIEL 175
           A+TGTNGK++T +L + + +  G +    GNIG+    +        ++I E SSYQIE 
Sbjct: 110 AITGTNGKTTTTSLTAAIFQAAGLNAPACGNIGMAACEVALSVQKPDWIIGELSSYQIES 169

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF 235
           + T+ P IG+    +PDHL RH TLENY NIK K++  S   I   +D    K+  +   
Sbjct: 170 SVTLSPPIGIWTTFTPDHLARHKTLENYYNIKAKLLNNSHLQIFNGDDIYLNKVGLNHWH 229

Query: 236 IGHSISRISSQSLQSDSDLYIDESF----LKCSATSEVIFDFS--QETKKHNIQNLVTSA 289
             +  +    + L  +   Y++  +    L  ++TS+ I + S  +   +HN QNL+ S 
Sbjct: 230 NAYWTTVKGPEFLIGEKGFYMENGWVIEKLSATSTSQPIVEVSALRMVGEHNQQNLLMSV 289

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                 G+ +E I  A+    G+THRL+ I     + FINDSKATN  +      + K  
Sbjct: 290 AAARLGGINIEAISHAVHEFPGVTHRLEHICTWEGIDFINDSKATNYDAAEVGLASVKSP 349

Query: 350 IYWIAGGLSKS-DDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLSKTLDQAL 406
           +  IAGG +K+ DD   L    +K A    IGN+A  F       G  N  + +T+ +A+
Sbjct: 350 VILIAGGEAKAGDDTGWLNKIQAKAATVLLIGNAAPTFAQRLEEVGYTNFEIIETMAKAV 409

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
                  +  Q  S+VL SP CASFDQY NF  RG  F
Sbjct: 410 PKSAELAKQYQA-SVVLLSPACASFDQYPNFEARGEDF 446


>gi|37527520|ref|NP_930864.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|60390525|sp|Q7N145|MURD_PHOLL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|36786955|emb|CAE16029.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase
           (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase)
           (D-glutamic acid adding enzyme) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 436

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 147/462 (31%), Positives = 225/462 (48%), Gaps = 40/462 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEVIDFR-E 59
           ++ +    + + GLG +GLS        GV   V+     P    +  D G+E       
Sbjct: 1   MADYLGKKVVIIGLGLTGLSCVDFFMARGVIPRVMDTRTAPPGKDKLPD-GVECHSGSLN 59

Query: 60  IPWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W +    +V+SPGIAL    A   ++ A    +EI+GDIELF RE       +P +A+
Sbjct: 60  ADWLMDADLIVVSPGIAL----ATAVLQAAANAGIEIVGDIELFCREA-----TAPIVAI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+  +L+  + +   + V +GGNIGLP L L   S  + YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTSLVGEMAKAANWQVGVGGNIGLPALELLKKS-CQLYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG 237
           ++ +   +LN++ DH+DR+   +  Y   K +I   +K    CI + Q      +M    
Sbjct: 170 LNATAAAVLNVTEDHMDRYPQGVSQYRAAKLRIYHQAKR---CIVNAQDPLTLPEMGMDS 226

Query: 238 HSIS-RISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG 296
             +S  +     Q DS    + +FLK    S +  +  + T +HN  N + +  +   +G
Sbjct: 227 RCVSFGVDCGDYQLDS----ENAFLKVHNQSLLATNEIKLTGRHNYANGLVALALADAVG 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGH-VIFINDSKATNLHSVIHAF--LNEKRRIYWI 353
           +  E     L    GL HR Q +ARL   V +INDSKATN+ S + A   LN +  +Y +
Sbjct: 283 IPREASLATLTVYPGLDHRFQ-LARLNKGVRWINDSKATNVGSTMAALDGLNLEGTLYLL 341

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSK---TLDQALKSVV 410
            GG  KS DFS L PF+         GN   L+     GK  + L     TL + ++  +
Sbjct: 342 LGGDGKSADFSPLKPFLC--------GNKVQLYCFGRDGKQLAQLRPEIATLTETMEQAI 393

Query: 411 RDV-ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           RD+   +    +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 394 RDIAPRLVAGDMVLLSPACASLDQFRNFEQRGHEFTRLAEEL 435


>gi|116071267|ref|ZP_01468536.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. BL107]
 gi|116066672|gb|EAU72429.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. BL107]
          Length = 462

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 149/469 (31%), Positives = 220/469 (46%), Gaps = 60/469 (12%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD-----DHPCAVKQAKDMGIEV-------IDFREI 60
           V GLGRSGL AA  L   G  V+  +     D      Q +  GIEV       I+  E 
Sbjct: 6   VVGLGRSGLGAARLLHHQGQAVVVLERGEGPDQTSCAAQLRAEGIEVELGIPLEINSFE- 64

Query: 61  PW-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIAV 118
           PW S ++ +V+ PGI       H  +++  Q  V++ G+IEL      + +L   P++ +
Sbjct: 65  PWRSDLTAVVIGPGIPWD----HPTLEILRQEGVQVRGEIELA-----WDALNDIPWVGI 115

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIG-------LPILNLEYFSPNRFYVIECSSY 171
           TGTNGK++   L+SHVL + G    +GGN+G       L I   +   P+ + V+E SSY
Sbjct: 116 TGTNGKTTVTHLLSHVLEQAGLRAPMGGNMGVSAAEMALKIKTGDLLRPD-WLVMELSSY 174

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAY 231
           QIE  PT+ PSIG+   ++PDHL+RH TLE Y  IK+ ++  S  AI   +D        
Sbjct: 175 QIEAGPTLAPSIGIWTTLTPDHLERHGTLEAYRAIKRGLLQRSSLAIFNGDD-------A 227

Query: 232 DMNFIGHSISRISSQSLQS--------DSDLYIDESFLKCSATSEVIF--DFSQETKKHN 281
           D+N   H  S  S   +Q+         +D +ID++    +  S  +F  D       HN
Sbjct: 228 DLN--AHRSSLKSGIWVQTATPCPDDQPADFWIDDAGTIQARESGAMFPADALAMPGAHN 285

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
            QN +      +Q+GL  E+I +   S  G+ HRL+ +         NDSKATN  +   
Sbjct: 286 RQNQLLVTAAAIQIGLNAEQIAQGFRSFPGVPHRLERLGSTASADVFNDSKATNYDAAAV 345

Query: 342 AFLNEKRRIYWIAGGLSKSDDFST-LFPFISKIAKAYFIGNS-----AMLFFHHFGGKIN 395
                   +  +AGG +K  D +  L    SK       G       A++    + G+++
Sbjct: 346 GLQAMAGTVVVLAGGQTKRGDATGWLTELKSKACAVVLFGAGAEELDALIRQSDYQGQVH 405

Query: 396 STLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
                 L  A+   V+    +Q  S+ L SP CASFDQY +F  RG  F
Sbjct: 406 RC--NDLKAAVAIAVQATSELQATSL-LLSPACASFDQYQDFEARGDHF 451


>gi|170718781|ref|YP_001783964.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           somnus 2336]
 gi|168826910|gb|ACA32281.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Haemophilus somnus
           2336]
          Length = 436

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 143/466 (30%), Positives = 231/466 (49%), Gaps = 52/466 (11%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREI 60
           + ++N +I V GLG++GLS    L  + + V VI     P  A K  +++ +      + 
Sbjct: 3   NQYQNKNICVVGLGKTGLSCVDFLLRQQANVRVIDTRQQPTGAEKLPENVPLHTGSLNQQ 62

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
                  +V+SPG+++        ++ A Q  VE++GDIELF R         P IA+TG
Sbjct: 63  WLLEADLIVISPGLSVKTLE----IQTALQAGVEVVGDIELFCR-----YANKPIIAITG 113

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           +NGKS+   L+S + +++G  V +GGNIG+P L L        YV+E SS+Q+E T ++ 
Sbjct: 114 SNGKSTVTTLVSEMAKEDGLKVGIGGNIGIPALEL-LQQDYDLYVLELSSFQLETTYSLK 172

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--HQCEKIAYDMNFIGH 238
            +   +LNIS DH+DR+  +E+Y   K +I    + A+I   D     E +   + F G 
Sbjct: 173 ATAATILNISEDHMDRYLDIEDYRQAKLRIYENCQRAVINAEDVLTTTEDLKSPITF-GE 231

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLG 296
           S         Q+D  L  +       A   +I   D  +   +HN  N + ++ +   + 
Sbjct: 232 S---------QADYWLKTENGKQYLMAKERLILPCDEMKLVGRHNYMNALAASALVQAVD 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           +    I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L    +++ + 
Sbjct: 283 ISFTAIRTALRKFTGLAHRFQLAYQKDDVRWINDSKATNVGSTVAALTGLYVANKLHLLL 342

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GK------INSTLSKTLDQAL 406
           GG  KS DFS L   I          N   ++ + FG  GK      + S L  T++QA+
Sbjct: 343 GGDGKSADFSELATLI----------NQPHIYCYCFGQDGKELAALSVQSQLFDTMEQAI 392

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVSE 450
           +++     N+Q   +VL SP CAS DQ+ +F  RG  FS ++++++
Sbjct: 393 EAI---RPNLQQGDMVLLSPACASLDQFKSFEHRGDVFSDLAKLAQ 435


>gi|87122629|ref|ZP_01078506.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinomonas sp.
           MED121]
 gi|86162087|gb|EAQ63375.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Marinomonas sp.
           MED121]
          Length = 447

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 143/456 (31%), Positives = 227/456 (49%), Gaps = 35/456 (7%)

Query: 12  AVFGLGRSGLSAA--CALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR-------EIPW 62
           AV GLG +GLS A   A K+   +V+   + P  + + K +  E   F        E+P 
Sbjct: 11  AVVGLGITGLSCAKFLAAKELDFYVVDSREAPPGLDEVKALVPEDRIFTGSLDKLLELP- 69

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
             ++ L +SPG+AL    A   ++   +  V++ GDI+LF        + +P +A+TG+N
Sbjct: 70  --VTELFVSPGVAL----AEPVLQTLAEQGVQMRGDIDLFCEH-----VNAPLVAITGSN 118

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
            KS+   +++ +L  +G +V +GGN+G P L+L   +P+ +YV+E SS+Q+E T  ++  
Sbjct: 119 AKSTVTTMVADMLLASGKNVAVGGNLGQPALDLLTHTPD-YYVLELSSFQLETTRVLNAK 177

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
           +  +LN+S DH+DR+ +L +Y  +K+K+    + A+    D     +      +G   + 
Sbjct: 178 VACILNVSEDHMDRYDSLYDYQRVKQKVYRNCESAVCNKQDILTAPLLPAGTPVGVFTTG 237

Query: 243 ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK-KHNIQNLVTSAVVCMQLG--LKV 299
           ++     ++  L  DE F  C     +        K KHN  N + S  +   LG  LK 
Sbjct: 238 LAD---LNEFGLIEDEGFWLCHGVKRLYHSSDIRLKGKHNYANFLASFAMLHLLGVELKS 294

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEK-RRIYWIAGG 356
           + I   L +  GL HR + IA    V +INDSK TN+ + + A   L  K R I+ I GG
Sbjct: 295 DAIAEYLKTFSGLAHRCEFIAEHQGVTYINDSKGTNVGATLAALEGLGSKHRNIHLILGG 354

Query: 357 LSKSDDFSTLFPFISKIAKAYFI-GNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
             K  DFS L   I +  K+  + G  A +     G   N +  + LD+ +   V  VE 
Sbjct: 355 KGKGADFSPLLSSIQQYVKSVSVFGEDAKIIIGALGAVDNLSHYQDLDEVM---VGCVEQ 411

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                IVLFSP CASFDQ+ ++  RG  F S V  +
Sbjct: 412 AVADDIVLFSPACASFDQFASYVARGEYFTSLVRAL 447


>gi|261345646|ref|ZP_05973290.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Providencia
           rustigianii DSM 4541]
 gi|282566128|gb|EFB71663.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Providencia
           rustigianii DSM 4541]
          Length = 441

 Score =  183 bits (465), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 144/465 (30%), Positives = 227/465 (48%), Gaps = 42/465 (9%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFR 58
           ++   ++  ++ + GLG +GLS        GV     D    P  + +  D  I      
Sbjct: 4   LQAQQYQGKNVVIIGLGLTGLSCVQFFLTRGVVPRVMDTRAVPPGIDKLPDNVICHSGSL 63

Query: 59  EIPWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
              W +    +V SPGIAL  +     ++LA    +EI+GDIELF RE     + +P +A
Sbjct: 64  NDEWLLQADLIVASPGIALATKQ----LQLAANKGIEIVGDIELFCRE-----VDAPIVA 114

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177
           +TG+NGKS+  +L+  + +  G  V +GGNIG+P L+L     +  YV+E SS+Q+E T 
Sbjct: 115 ITGSNGKSTVTSLVGEMAKAAGISVGVGGNIGIPALSL-LNQGHSLYVLELSSFQLETTS 173

Query: 178 TIDPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI 236
           ++  +   +LNIS DH+DR+   LE Y   K +I   ++H I  +N      +  D    
Sbjct: 174 SLQAAAATVLNISEDHMDRYPLGLEQYRAAKLRIYDNAQHCI--VNAQDVLTLPTD---- 227

Query: 237 GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCMQ 294
            H +++ +S  L ++ D Y D       A  E + D S+   T +HN  N + +  +   
Sbjct: 228 -HRLNQCTSFGL-NNGDYYFDTQKRVLIAKGETVLDASEMHLTGQHNYMNALAALALADT 285

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYW 352
           +G+  E   + L    GL HR Q +     V +INDSKATN+ S   A   L+    IY 
Sbjct: 286 VGIPREASIKVLKEYAGLVHRFQLVLFNNGVRWINDSKATNVGSTEAALNGLHVDGTIYL 345

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI------NSTLSKTLDQAL 406
           + GG  KS DFS L  +IS         N  +  F   G ++       S L++T++Q+L
Sbjct: 346 LLGGDGKSADFSPLKNYISA-------DNYRLYCFGRDGKQLAELAPEKSVLTETMEQSL 398

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           + +      ++   +VL SP CAS DQ+ +F +RG  F     E+
Sbjct: 399 RQI---APLLKTGDMVLLSPACASLDQFKSFEQRGDIFAQLAKEL 440


>gi|301155884|emb|CBW15353.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Haemophilus
           parainfluenzae T3T1]
          Length = 437

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 142/457 (31%), Positives = 232/457 (50%), Gaps = 49/457 (10%)

Query: 6   FRNHSIAVFGLGRSGLSAACALK--DSGVHVIAWDDHPCAVKQ-AKDMGIEVIDFREIPW 62
           ++N +I + GLG++GLS    L+   + + VI    HP    Q  K++ +      +  W
Sbjct: 5   YQNKTITIIGLGKTGLSCVEYLQSQQANIRVIDTRQHPAGADQLPKNVPLHTGSLNQ-QW 63

Query: 63  SIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            + S  +V+SPG+A+        ++ A    VE+IGDIELF R     +   P I +TG+
Sbjct: 64  LLESDIIVISPGLAVKTPE----IQTALSAGVEVIGDIELFCR-----AATKPIIGITGS 114

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T ++  
Sbjct: 115 NGKSTVTTLVYEMAKAAGIKVGMGGNIGIPALSL-LNEDCDLYVLELSSFQLETTYSLKA 173

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
           +   +LN++ DH+DR+  LE+Y   K +I   ++ A++ + D    K+ +     G + +
Sbjct: 174 AAATVLNVTEDHMDRYVDLEDYRQAKLRIYHNAETAVVNLED----KLTFGE---GENQA 226

Query: 242 R--ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLGL 297
           +  +S    Q+D  L  +       A  EVI    + T   +HN  N++ +  +   +G+
Sbjct: 227 KKVVSFAENQADYWLKTENGKQYLMAKEEVILPCDEATLVGRHNYMNILAATALAQAVGI 286

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAG 355
            +E I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L  +  ++ + G
Sbjct: 287 NLEAIRTALRQFKGLDHRFQLAHQANGVRWINDSKATNVGSTVAALAGLYVEGTLHLLLG 346

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLS------KTLDQALK 407
           G  K  DFS L   I          N   +  + FG  GK  + LS      +T++QA+ 
Sbjct: 347 GDGKGADFSELADLI----------NQPHISTYCFGRDGKQLAALSSQSHLFETMEQAI- 395

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           S +R   +++   +VL SP CAS DQ+ +F +RG  F
Sbjct: 396 SFLR--PHLKSGDMVLLSPACASLDQFASFEKRGEEF 430


>gi|70726733|ref|YP_253647.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus haemolyticus JCSC1435]
 gi|81174951|sp|Q4L5N4|MURD_STAHJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|68447457|dbj|BAE05041.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           haemolyticus JCSC1435]
          Length = 449

 Score =  183 bits (464), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 133/457 (29%), Positives = 229/457 (50%), Gaps = 31/457 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N  + V GL +SG  AA  L   G +V   D    +     K  + +G++++D
Sbjct: 2   LNYTGLENKDVLVVGLAKSGYEAAKLLIKLGANVTVNDGKDLSQDPHAKDLEALGVKIVD 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P S++     +V +PGI  T       ++ A Q +++I+ ++EL      +   ++
Sbjct: 62  GGH-PLSLLDNEPIIVKNPGIPYTVS----IIQEAYQRHLKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IA+TGTNGK++T +LI  + +K+    +L GNIG     + +  SPN + + E SS+Q
Sbjct: 112 PIIAITGTNGKTTTSSLIGDMFKKSRLTGRLSGNIGYVASKVAQETSPNEYLITELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV-TMSKHAIICINDHQCEKIAY 231
           +       P I ++ NI   HLD H TLENY N KK+I    +++  +  N HQ   I  
Sbjct: 172 LLGVEQYRPHIAIITNIYSAHLDYHETLENYQNAKKQIYKNQTENDYLICNYHQRHLIES 231

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           + N    ++   + Q +     +YI + F+       +  D      +HN++N++ + + 
Sbjct: 232 E-NLKAKTLYFSTQQEVDG---IYIKDGFIVYQGIRIINIDDLVLPGEHNLENILAAVLA 287

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
            +  G+ ++ I  +L +  G+ HRLQ I       + NDSKATN  +   A  + K+ I 
Sbjct: 288 SILAGVPIKAIIDSLTTFSGIDHRLQYIGTNRTNKYYNDSKATNTLATQFALNSFKQPIV 347

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKSV 409
           W+ GGL + +DF  L P++  +      G +   F      K+ ++  K + +A  ++  
Sbjct: 348 WLCGGLDRGNDFDELIPYMKNVRVMVVFGQTQEKF-----AKLGNSQGKLVVKATDIEDA 402

Query: 410 VRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFM 445
           V+ V++V  P+ +VL SP CAS+DQY  F ERG  F+
Sbjct: 403 VKKVQDVVEPNDVVLLSPACASWDQYKTFEERGERFI 439


>gi|161870654|ref|YP_001599827.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neisseria
           meningitidis 053442]
 gi|189082912|sp|A9M2H5|MURD_NEIM0 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|161596207|gb|ABX73867.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis 053442]
          Length = 445

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 224/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +GV V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGVEVAAYDAELKPERVAQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKDKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEYEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A+       G  +N T   TL++A++ 
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDALQIRRDLDGCDLNMTDCATLEEAVQK 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|302871367|ref|YP_003840003.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574226|gb|ADL42017.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 455

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 143/476 (30%), Positives = 237/476 (49%), Gaps = 55/476 (11%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD----------DHPCAVKQAKDMGIEVI 55
            +  S+ V GLGRSGL++A  LK  G  VI +D          D  CA +   +     I
Sbjct: 3   LKGKSVLVVGLGRSGLASASFLKKQGAFVIGFDEKAEDQFKKEDRNCAEESCDE-----I 57

Query: 56  DFREIPWSII---SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ 112
            + EIP  +I     +V+SPG+ L+       V LA++  VE+IG+IEL  R  +  ++ 
Sbjct: 58  YYCEIPDEVIDKIQLVVVSPGVPLS----KRIVVLAHKKGVEVIGEIELAYRFCKSKNI- 112

Query: 113 SPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSY 171
              +A+TGTNGK++T  L+  +L+K   DV + GNIGLP ++ +E  S N  +V+E SS+
Sbjct: 113 ---VAITGTNGKTTTTTLVGEILKKQHDDVVVCGNIGLPFIDTVETSSENTIFVLEISSF 169

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAY 231
           Q+E      P +G +LNI+PDHL+RH T+ENYV  K +I      A   + ++    I  
Sbjct: 170 QLETIKYFKPKVGCILNITPDHLNRHATMENYVKAKMRIFENIDEAGYTVLNYD-NGITR 228

Query: 232 DM-NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK------------ 278
           D+      ++   S       + ++++E        +++ F F  +T+            
Sbjct: 229 DLIGLAKRNVIVFSKNKNHFKNMVFVEE--------NKIYFTFGGKTQEVMKKDEIFIPG 280

Query: 279 KHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHS 338
           +HN++N + +    +  G+  + IK  L +  G+ HR++ +  +  + F NDSK TN  +
Sbjct: 281 EHNLENALAAIACTLPFGVAKDTIKDVLKTFKGVEHRIEFVTEINGIKFYNDSKGTNTDA 340

Query: 339 VIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFG--GKIN 395
              A    +  I  IAGG  K + F      I+ K+ K + +G +     +     G  N
Sbjct: 341 AEKAISAFESPIILIAGGYDKGESFERFAGLIAKKVKKVFLLGQTKQKIANELEKIGYQN 400

Query: 396 STLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             L  +L +A++   +  E  +   +VL SP CAS+D + N+ +RG  F   V+E+
Sbjct: 401 FELVSSLKEAVE---KSFEYAKSGDVVLLSPACASWDMFENYEQRGKMFKEYVNEL 453


>gi|46446885|ref|YP_008250.1| putative UDP-N-acetylmuramoylalanine-D-glutamate ligase murD
           [Candidatus Protochlamydia amoebophila UWE25]
 gi|62900536|sp|Q6MBS4|MURD_PARUW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|46400526|emb|CAF23975.1| putative UDP-N-acetylmuramoylalanine-D-glutamate ligase murD
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 444

 Score =  182 bits (462), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 137/458 (29%), Positives = 226/458 (49%), Gaps = 35/458 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD-------DHPCAVK-QAKDMGI 52
           M + ++      + GLG SG +AA  L+ SGV V+  D       + P  ++ +AK + I
Sbjct: 1   MPIENYFGKKALIIGLGVSGRAAASFLQTSGVKVLGVDRDYLQLENQPEILELKAKGLVI 60

Query: 53  EVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ 112
           +  D   I       +V+SPGI     + H  +K A++   E+IG+IEL  R    S   
Sbjct: 61  QA-DCETIDLKTFDLIVVSPGIP----SNHPLIKKAHEHKKEVIGEIELGCRASCHS--- 112

Query: 113 SPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLP----ILNLEYFSPNRFYVIEC 168
              I VTGTNGK++   LI+H+L  NG   +  GN+G P    IL L++       V+E 
Sbjct: 113 --IIGVTGTNGKTTVTLLITHILNANGLKAKALGNVGTPLTREILTLDF---QEIAVLEL 167

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI-VTMSKHAIICINDHQCE 227
           SSYQ++          V+LNI+PDHL+R+ T+ENY   K +I   + K   + +      
Sbjct: 168 SSYQLDTFQQQVLDEAVVLNITPDHLERYETMENYAKSKFQIGKCLKKSGKLFVERKAAV 227

Query: 228 KIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
           +  + +NF   +   + S    +D    +   FL+     E+  ++ Q  + H+++NL+ 
Sbjct: 228 EYQHLLNFPHSTYGYLPSCHTYTD----LCSVFLEGMQQFELPLEW-QGKENHDLENLLA 282

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +  +C + G+K ++  +AL +    +HR++ +     + F +DSK TN+ +V+ A  +  
Sbjct: 283 AYAICARRGIKPQQFLQALKTFQKPSHRVEFVLEKNGIHFYDDSKGTNIDAVMRAVQSIN 342

Query: 348 RRIYWIAGGLSKSDDF-STLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
           R ++ IAGG+ K   + + L  F   + K Y IG +A          I   +   LD A+
Sbjct: 343 RPVFLIAGGVDKGASYVAWLNVFKGHVKKVYAIGQAANKIQKELSLHIRVQIEANLDDAV 402

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           K   +D +       VL SPGCASFD + ++  RG  F
Sbjct: 403 KQAYQDAKE---GDAVLLSPGCASFDMFKDYIHRGEEF 437


>gi|119944901|ref|YP_942581.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Psychromonas
           ingrahamii 37]
 gi|119863505|gb|ABM02982.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Psychromonas
           ingrahamii 37]
          Length = 445

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 147/466 (31%), Positives = 230/466 (49%), Gaps = 48/466 (10%)

Query: 8   NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAK-DMGIEVIDFREIPWSIIS 66
           N  IAV GLG +GLS    L   G  V  +D       + K D  +++I   E+ + +++
Sbjct: 3   NQQIAVLGLGETGLSCVNFLLKQGEQVTVFDTRQSPPGEDKLDSSVKLIK-GELSFELLA 61

Query: 67  ---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRE-RRFSSLQSPFIAVTGTN 122
               ++ SPGIAL      +   LAN    EIIGDIELF RE  + +   +  + ++G+N
Sbjct: 62  KFNLIIASPGIALATPALQFA--LAN--GCEIIGDIELFARELSKPAYAHAKLVTISGSN 117

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIECSSYQIELTPTIDP 181
           GKS+  +L+  +       V +GGNIG+P L+L   SP    Y++E SS+Q+E T +++ 
Sbjct: 118 GKSTVTSLLGEMAVAAKIKVAVGGNIGIPALDL--LSPEIDLYILELSSFQLETTFSLNA 175

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
            I  LLNIS DH+DR+ +   Y   K ++    K A+   +D    K+ Y  N   HS++
Sbjct: 176 DIATLLNISEDHMDRYDSYAQYTAAKHRLYQQCKMALYNRDD----KLTYPKN---HSLN 228

Query: 242 RIS------SQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
           + S      +  L +D+D  I   FL  + +  +     + + KHN  N + +  +   +
Sbjct: 229 KTSFGFDKLAYGLVTDADKQI---FLAKNGSPILAAKQLKLSGKHNWMNTLAAFALGEAV 285

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI----Y 351
           GL    +  AL +  GL HR + +A + +V +INDSKATN+ +   A L     I    +
Sbjct: 286 GLSEIGMFTALQAYSGLPHRCEFVAEINNVRWINDSKATNIGAAQAALLGLSETIPGNVH 345

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI-----NSTLSKTLDQAL 406
            I GG  K  DFS L   + +I          ++ F   G KI      + L + L+QA+
Sbjct: 346 VILGGDGKGADFSELALVLKEI-------QGMIVCFGVDGKKIAAQHKRALLVENLEQAV 398

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           +++       Q   +V+ SP CAS D Y NF +RG  F   V  +P
Sbjct: 399 ENIFT---TAQAGDLVILSPACASLDMYKNFMQRGDHFKRLVKALP 441


>gi|113955473|ref|YP_731457.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. CC9311]
 gi|113882824|gb|ABI47782.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           CC9311]
          Length = 466

 Score =  182 bits (462), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 137/455 (30%), Positives = 218/455 (47%), Gaps = 33/455 (7%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAW--DDHPCA---VKQAKDMGIEV-----IDFREIP- 61
           + GLGRSG+ AA  L   G HV+    DD P      +Q +D GI+      ++F     
Sbjct: 6   IVGLGRSGVGAARLLHAQGHHVVVLERDDGPAQQFKAQQLRDQGIQTELGCPLEFSSFQR 65

Query: 62  W-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           W   I  +V+SPGI       H  +       V + G++ +  +    +  + P+I +TG
Sbjct: 66  WLDQIEQVVISPGIPWD----HPTLMQLRDHGVTVRGEMAVAWQ----ALCKCPWIGITG 117

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIG--LPILNLEYFSPNR----FYVIECSSYQIE 174
           TNGK++   L+ HVL + G    + GN+G     L L+   P +    + V+E SSYQIE
Sbjct: 118 TNGKTTVTHLLHHVLNQAGLYAPMAGNVGDSAAELGLQCMDPAQTKPDWIVMEMSSYQIE 177

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN 234
               + P+IG+   ++PDHL+RH +++ Y +IKK ++  S+HA++  +D   +    D  
Sbjct: 178 SAIEVRPTIGIWTTLTPDHLERHGSMDAYRDIKKGLLQRSEHAVLNADDADLQSRHADWP 237

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVI-FDFSQETKKHNIQNLVTSAVVCM 293
                IS   ++   S+ +L+I+     CS    +   +      +HN QN++      +
Sbjct: 238 D-AQWISSAQNKCEPSNLELWINPEGFVCSKKGALFPANALAMLGEHNRQNMLLVTAAAL 296

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
           Q GL+ + I+R L S  G+ HRL+++  L  +   NDSKATN  +   A       I  +
Sbjct: 297 QTGLEAQAIERGLRSFPGVPHRLESLGSLHGMNVFNDSKATNYDAAAVALQAVPSPIALL 356

Query: 354 AGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFF---HHFGGKINSTLSKTLDQALKSV 409
           AGGLSK  D S     +  K+      G+   +      + G   + T   T+  A+ + 
Sbjct: 357 AGGLSKQGDASGWLQLLHDKVCSIALFGSDRDILLGLIRNSGYTGDVTSHPTMADAVAAA 416

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +    N    S+ L SP CASFDQY +F  RG  F
Sbjct: 417 IEQGRNRNAASL-LLSPACASFDQYKDFEARGNYF 450


>gi|317969026|ref|ZP_07970416.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. CB0205]
          Length = 459

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 143/460 (31%), Positives = 221/460 (48%), Gaps = 37/460 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD-----DHPCAVKQAKDMGIEVIDFREI-PWSIIS 66
           V GLGRSGL AA  L   G +V+  +     +H    +  +  GI V   + + P S   
Sbjct: 6   VLGLGRSGLGAARLLARRGANVLVLESGQGAEHQRKAENLRGEGIAVELGKPLAPESFEP 65

Query: 67  FL------VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            L      ++SPGI        W  +     N EI    E        +S  +P+I +TG
Sbjct: 66  LLTDCARVIVSPGIRWDHPTLIWLRQQGIPTNGEISTAWE--------ASGSTPWIGITG 117

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIG--LPILNLEYFSPNR----FYVIECSSYQIE 174
           TNGK++   L++H+L++ G D  + GN+G     L LE FS  +      V+E SSYQIE
Sbjct: 118 TNGKTTVTHLVAHLLKQGGIDAPMCGNVGHSAAELALERFSDGQTRPQALVVELSSYQIE 177

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN 234
             P + P+IG+   ++PDHL+RH TLENY  IK+ +  + + AI  +N    +  A+   
Sbjct: 178 SAPELAPAIGLWTTLTPDHLERHGTLENYRAIKRGL--LERSAIQVLNGDDPDLCAHAAT 235

Query: 235 FIGH----SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
           +       + SR ++ +   D  L+I+ + +   + + +  +       HN QN++ +  
Sbjct: 236 WPNARWITASSREAALAKGIDPWLWIEGNQVMERSGALLPANALAMPGAHNRQNMLMALA 295

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           V ++LGL    ++ AL +  G+ HRL+ I  L  V +INDSKATN  +   A    +  +
Sbjct: 296 VGLELGLSGPAMEAALRAFPGVPHRLELIRSLDGVDWINDSKATNYDAAEVALRAVEGPL 355

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF---GGKINS-TLSKTLDQAL 406
             +AGG +K  D S     + + AKA  +  +A   F      GG          L +A+
Sbjct: 356 VALAGGEAKQGDASAWIAALQRSAKAVVLFGAAQSHFQELLLSGGYTGVIQCCDALPEAV 415

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
            +  R +   +    VL SP CASFDQY +F  RG  F S
Sbjct: 416 -AAARQLSQREHCRAVLLSPACASFDQYRDFEARGEHFRS 454


>gi|33240888|ref|NP_875830.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus subsp. marinus str. CCMP1375]
 gi|60390538|sp|Q7VAM1|MURD_PROMA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|33238417|gb|AAQ00483.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
          Length = 470

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 148/467 (31%), Positives = 227/467 (48%), Gaps = 45/467 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAV--KQAKDMGIEVIDFR-EIPWSIISF-- 67
             GLGRSG++AA  L D G  V  ++    A   K + ++  E I     +P +  SF  
Sbjct: 13  AIGLGRSGVAAARYLNDQGEKVQIFESSKKASFGKLSGNLEKEGIKVNLGVPLNFSSFQP 72

Query: 68  -------LVLSPGIALTGENAHWCVKLANQFNVE-IIGDIELFVRERRFSSLQSPFIAVT 119
                  +++SPGI        W     NQ     II + E+ +  R   +  +P++ +T
Sbjct: 73  ILEKLALVIVSPGIP-------WDHPTLNQLRKRGIIVESEINLAWRALKN--TPWVGIT 123

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIG-------LPILNLEYFSPNRFYVIECSSYQ 172
           GTNGK++   +++HVL  +  +  +GGN+G       L +       P ++ ++E SSYQ
Sbjct: 124 GTNGKTTVTHMLNHVLNNSFIESTIGGNVGKAATEIALALRKSTKHKP-KWLIMELSSYQ 182

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD 232
           IE  P I P IG+   ++PDHL+RH +LENY  IK+ ++  S   I   +D    K   +
Sbjct: 183 IETAPEISPEIGIWTTLTPDHLERHGSLENYFAIKRTLIANSSIRIYNADDKYLSKNRLN 242

Query: 233 MNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS-QETKKHNIQNLVTSAVV 291
           +   G  +S     S  +  D +I  + +     +E+    + Q    HN+QNL+  +  
Sbjct: 243 LPK-GLWVSAQKYNSNINQLDFWISSNGMVIEQGNELFHSSALQLPGDHNLQNLLLVSAA 301

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
             ++GL    I+ AL+S  G+THRL+ + ++  +   NDSKATN  S           + 
Sbjct: 302 ARKIGLSGMAIENALISFAGITHRLEKVDKIIDIDIFNDSKATNFDSAEIGLKATSAPVI 361

Query: 352 WIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSA-----MLFFHHFGGKI--NSTLSKTLD 403
            IAGGLSK   +      I  K+     IG S      ++  H F G+I     L K +D
Sbjct: 362 LIAGGLSKQGIYLDWINQIKEKVCAVILIGESRVKLQHLIKSHGFRGEIVCYEKLDKAVD 421

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           +A+K  V+     +  SI LFSPGCASFDQY+NF ERG  F   + E
Sbjct: 422 KAIKLGVK----FRAKSI-LFSPGCASFDQYSNFEERGDHFKKLIKE 463


>gi|317046895|ref|YP_004114543.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Pantoea sp. At-9b]
 gi|316948512|gb|ADU67987.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Pantoea sp. At-9b]
          Length = 438

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 136/463 (29%), Positives = 219/463 (47%), Gaps = 40/463 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ +R   + + GLG +GLS        GV     D    P  + +  +     +     
Sbjct: 1   MADYRGRKVVIIGLGLTGLSCVDFFLAQGVTPRVMDTRVSPPGLDKLPEQVERYVGGLNN 60

Query: 61  PWSIISFLVL-SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + + L++ SPGIAL    AH  +  A    +EI+GDIELF RE      Q+P +A+T
Sbjct: 61  DWLLAADLIIASPGIAL----AHPALSEAADAGIEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + R  G+ V +GGNIGLP L+L   SP + YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMARAAGWQVGVGGNIGLPALSL-LKSPAQLYVLELSSFQLETTYSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKI-AYDMNFIG 237
             +   +LN++ DH+DR+   ++ Y   K +I   ++  ++  +D     +   D   + 
Sbjct: 171 KAAAATILNVTEDHMDRYPLGMQQYRAAKLRIYENARVCVVNADDGMTMPVRGADTRCVS 230

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
             I  I    L          ++L+      +  D  +   +HN  N + +  +   + +
Sbjct: 231 FGID-IGDYHLNRQQ----GSTWLRVKGEKVLNTDEMKLVGQHNYTNALAALALADAVNI 285

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAG 355
                 +AL +  GL HR Q +     + +INDSKATN+ S   A   L  K  ++ + G
Sbjct: 286 PRASSLKALTTFTGLPHRFQLVHEAHGIRWINDSKATNVGSTEAALNGLQVKGTLWLLLG 345

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALKS 408
           G  KS DFS L  ++         G++  LF F   G  +       +T ++TL QA+  
Sbjct: 346 GDGKSADFSPLARYVQ--------GDNVRLFCFGRDGDALAALRPEIATRTETLQQAMAQ 397

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +       Q   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 398 I---ASQAQAGDMVLLSPACASLDQFRNFEQRGDQFAQLAKEL 437


>gi|327392722|dbj|BAK10144.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase MurD [Pantoea
           ananatis AJ13355]
          Length = 438

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 139/464 (29%), Positives = 217/464 (46%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ +R   + + GLG +GLS        GV     D    P  + +  +     +     
Sbjct: 1   MADYRGRKVVIIGLGLTGLSCVDFFVAQGVTPRVMDTRMSPPGLDKLPEQVERYVGGINS 60

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + +  +V SPGIAL    AH  +  A    +EI+GDIELF RE      Q+P +A+T
Sbjct: 61  DWLLAADLIVASPGIAL----AHPALCEAADAGIEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G+ V +GGNIGLP L+L   +P + YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGWQVGVGGNIGLPALSL-LKAPAQLYVLELSSFQLETTHSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN++ DH+DR+   ++ Y   K +I   ++  ++  +D         M   G 
Sbjct: 171 KAAAATILNVTEDHMDRYPLGMQQYRAAKLRIYENAQVCVVNADD------GMTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +   A  E + +  + T   +HN  N + +  +   +G
Sbjct: 225 DARCVSFGIDIGDYHLNKQQGSIWLRAKGEKVLNTDEMTLVGQHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L       AL +  GL HR Q + +   V +INDSKATN+ S   A   L     ++ + 
Sbjct: 285 LPRSTSLSALAAYSGLPHRFQLVHQSRGVRWINDSKATNVGSTEAALKGLEVNGTLWLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL-------SKTLDQALK 407
           GG  KS DFS L          Y  G+   L+     G   + L       + TL QA++
Sbjct: 345 GGDGKSADFSPL--------ATYLQGDRIRLYCFGRDGDALAALRPDVAVRTDTLQQAME 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            + R    VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QIAR---QVQPDDMVLLSPACASLDQFRNFEQRGDVFAQLAREL 437


>gi|218961097|ref|YP_001740872.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase
           (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase)
           (D-glutamic acid adding enzyme) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729754|emb|CAO80666.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase
           (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase)
           (D-glutamic acid adding enzyme) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 472

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 140/456 (30%), Positives = 224/456 (49%), Gaps = 27/456 (5%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGV-----HVIAWDDHPCAVKQAKDMGIEVIDFREIP 61
           ++    + GL RSG+++A  LK+ GV      +    + P A K  KD   E        
Sbjct: 26  KDKKYGIIGLARSGIASAYKLKELGVIPFLSELRPAKEIPSAEKLEKDFPCEFGGHTNKL 85

Query: 62  WSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
                 L++SPGI L        ++ A + N+E+I +IEL  R     +  S  IAVTG+
Sbjct: 86  LEC-DCLIVSPGIPLNTP----ILQKAKEKNIELISEIELGYR---IKAKDSKIIAVTGS 137

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFY-VIECSSYQIELTPTID 180
           NGKS+TV+LI H+L   G    L GNIG    + +   P   Y V+E SS+Q++L  +  
Sbjct: 138 NGKSTTVSLIHHILTGLGKKSLLAGNIGDAFCSYDIEKPGWDYIVLEISSFQLDLINSFQ 197

Query: 181 PSIGVLLNISPDHLDRHHTLENY----VNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI 236
           P + VLLNI+PDH+DR+++ E+Y    VNI K    M+  A++  +  + +    D+   
Sbjct: 198 PDVAVLLNITPDHIDRYNSFEDYALSKVNIFKN-QEMTDTAVLFWDSPEVKHFTKDI--- 253

Query: 237 GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG 296
             +     S S   ++  Y+  ++++  + ++V   +      HN  N +++ +    L 
Sbjct: 254 -KARKLYFSLSPNDNAFAYLANNYIQFGSETKVPLSYFAIKGPHNYANAMSAMLAVYALI 312

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
            +  +I  A+     L HRL+ +  +  V F NDSKATN  SV  A  + ++ I  I GG
Sbjct: 313 PEPTKIAEAVKGFKSLPHRLEYVDTIKGVSFYNDSKATNTDSVRSALNSFEQPIRIIMGG 372

Query: 357 LSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
             K +D+S L   +  K+ KAY  G++       F GKI        +  ++    D + 
Sbjct: 373 SDKGEDYSVLAADLQKKVKKAYLTGDTREKMRKTFSGKIPLECIADFELTVRKAFSDSDE 432

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                I++ SP CASFD++NN+ ERG  F   V+ I
Sbjct: 433 GD---IIVLSPACASFDRFNNYEERGNFFKEIVARI 465


>gi|254495864|ref|ZP_05108774.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legionella
           drancourtii LLAP12]
 gi|254354900|gb|EET13525.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legionella
           drancourtii LLAP12]
          Length = 444

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 134/452 (29%), Positives = 223/452 (49%), Gaps = 32/452 (7%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAK------DMGIEVIDFREIPWSIIS 66
           V GLG++GLS A  L+ +    +A+D  P A   A+      D+ + V    E     ++
Sbjct: 8   VAGLGKTGLSVARYLRRTNKPFVAFDTRPQAPNLAEFTAEFPDVTVYVQHVPEDVLGQLT 67

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            ++ SPG++L        ++ A    + + GDIE   RE     + +P IA+TGTNGKS+
Sbjct: 68  DIIASPGLSLDTP----LLQYALHAGISVYGDIECLARE-----IHAPVIAITGTNGKST 118

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELTPTIDPSIGV 185
              L+  + +  GY+V + GNIG+P+L+ LE       +V+E SS+Q++LT ++ P +  
Sbjct: 119 VTTLVGEMAKAAGYNVAVAGNIGMPVLDMLEDEHQYDLWVLELSSFQLDLTSSLAPVVAT 178

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISS 245
           +LN+SPDHLDRHH+++ Y+  K+++   ++  +   +D   E     +  I    ++ ++
Sbjct: 179 ILNVSPDHLDRHHSMDAYIRAKQRVYHHAQVVLFNRDDAYTEPAGQVIRAISFGNNQPAT 238

Query: 246 QS---LQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEI 302
           +    +  +  +Y+        AT  V+         HN  N + +  +    G+  + I
Sbjct: 239 EDWGLINQEDKIYLAHGNSCFLATESVLI-----KGVHNWLNALAACALADAAGIPRQYI 293

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LNEKRRIYWIAGGLS 358
              L +  GL+HR Q +  L  V +INDSK TN+ + I A      + + RI  IAGG  
Sbjct: 294 ISVLTTFSGLSHRCQWVRTLDGVEWINDSKGTNIGATISAINGIGGSMQGRIVLIAGGQG 353

Query: 359 KSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           K  DFS L   I+   ++   IG  A          +  T + +LD A+ +V +     +
Sbjct: 354 KGADFSELAQPIADFVRSIVLIGEDADKIAAALADVVPITRASSLDNAV-AVAK--TQAK 410

Query: 418 LPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
              +VL SP CAS D + +F  RG  F S V 
Sbjct: 411 PGDVVLLSPACASLDMFRDFNHRGELFTSLVG 442


>gi|149910625|ref|ZP_01899263.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Moritella sp.
           PE36]
 gi|149806353|gb|EDM66328.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Moritella sp.
           PE36]
          Length = 445

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 146/474 (30%), Positives = 217/474 (45%), Gaps = 60/474 (12%)

Query: 5   SFRN--HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW 62
           S RN   SI + GLG++GLS        G+  +  D       Q            E+P 
Sbjct: 5   SERNMADSIVIIGLGQTGLSCVRYFLKQGIVPVVVDSRDAPPGQ-----------DELPA 53

Query: 63  SIISF--------------LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRF 108
            +  +              LV+SPGIA+        +  A Q  VE+IGDIELFVR    
Sbjct: 54  QVRLYKGGLHPEILLQAKQLVVSPGIAIATPE----IAAAQQHGVEVIGDIELFVR---- 105

Query: 109 SSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIE 167
            + ++P IA+TG+NGKS+   L+  +    G    +GGNIG+P L+ L+   P + YV+E
Sbjct: 106 -AAKAPIIAITGSNGKSTVTTLVGEMANAAGVKTAIGGNIGIPALDLLDVAEPYQLYVLE 164

Query: 168 CSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCE 227
            SS+Q+E T ++      +LN++ DHLDR+   E Y   K  I   ++  +   +D    
Sbjct: 165 LSSFQLETTHSLKAVAATVLNVTDDHLDRYPDFEAYRQAKLSIYQDAQTIVTNRDDVLTV 224

Query: 228 KIAYDMNFIG-HSISRISSQSLQSDSDLYIDE----SFLKCSATSEVIFDFSQETKKHNI 282
               D   +G HS+          D+D  + +    ++L       +  D  Q T  HN+
Sbjct: 225 CATQDNRDVGKHSVG-------ADDADYGLIQQQGCTWLAYQGEGIISADDLQITGVHNL 277

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
            N +++  +    G+   +    L    GL HR + I +L  V++IND+KATN+ + + A
Sbjct: 278 MNALSAIALLDAAGVDRIKTLPGLKQFTGLAHRCEFIRKLNDVMWINDTKATNVGATLAA 337

Query: 343 F----LNEKRRIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINST 397
                 + K R+Y IAGG  K  DF  L P +   IA  Y  G   + F    G   N+ 
Sbjct: 338 LDGLKSSVKGRLYLIAGGDGKGADFGPLVPALRDDIALTYCFGKDGVRF---AGLAENTK 394

Query: 398 LSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           L   LD A+  +    + VQ    VL SP CAS D Y NF  RG  F + V  +
Sbjct: 395 LVADLDTAIAEI---SQLVQPGDWVLLSPACASIDMYANFMARGDHFRALVKAL 445


>gi|318042232|ref|ZP_07974188.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. CB0101]
          Length = 462

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 136/465 (29%), Positives = 221/465 (47%), Gaps = 39/465 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFR-EIPWSIISF-- 67
           V GLGRSG+ AA  L   G  V+  +  D P   ++A  +  E I     +P    SF  
Sbjct: 11  VLGLGRSGVGAARLLHQRGASVLVLESGDGPALQERADALRREGIAVHLGVPLEPASFTA 70

Query: 68  -------LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
                  +++SPGI       H  +K   Q  +   G+I         +S   P+I +TG
Sbjct: 71  LEVQPARVIVSPGIRWD----HPTLKALRQQGIRTDGEITTAWE----ASAGVPWIGITG 122

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYF-----SPNRFYVIECSSYQIEL 175
           TNGK++   LI+H+L + G D  + GN+G     L        +P  + V+E SSYQIE 
Sbjct: 123 TNGKTTVTHLIAHLLEQAGLDAPMCGNVGFSAAELALARSGANAPT-WLVVELSSYQIES 181

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH--QCEKIAYDM 233
            P + P IGV   ++PDHL+RH TL+NY  IK+ ++  S   ++  +D   +    ++D 
Sbjct: 182 APALAPRIGVWTTLTPDHLERHGTLDNYRAIKRSLLEHSTVRVLNADDPDLRSRAASWDQ 241

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVI-FDFSQETKKHNIQNLVTSAVVC 292
                + SR  +++   +  L+I+ + + C A+  ++  D       HN QN++ +  V 
Sbjct: 242 ARWVTAESREQARAAGIEPHLWIEANQV-CQASGPLLPADALAMPGAHNRQNMLMAVAVG 300

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
           +++GL  E++  AL    G+ HRL+ I     V + NDSKATN  +   A    +  +  
Sbjct: 301 LEVGLSAEQMAAALRCFPGVPHRLELIRERDGVRWFNDSKATNYDAAEVALRALQGPLVV 360

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSA------MLFFHHFGGKINSTLSKTLDQAL 406
           +AGG +K  + +     + + A+A  +  +A      +L   H+ G ++     +    L
Sbjct: 361 LAGGEAKQGEAAGWLAGLEREARAVVLFGAARDTFQQLLEASHYSGAVHRVAGLSEAVPL 420

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              +   +N +    VL SP CASFDQY +F  RG  F   V  +
Sbjct: 421 AQRLAAEQNCR---AVLLSPACASFDQYRDFEARGDHFRQLVQSL 462


>gi|307611494|emb|CBX01167.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Legionella
           pneumophila 130b]
          Length = 447

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 137/465 (29%), Positives = 226/465 (48%), Gaps = 46/465 (9%)

Query: 8   NHSI-AVFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKDMGIEVIDFREIPWS 63
           NHS+  V GLG++GLS A  LK +    + +D   + P   +   +     I  ++ P  
Sbjct: 2   NHSLYLVAGLGKTGLSIARYLKRNNKSFVVFDTRKEAPGVAEFQNEFPDVPIYLQQTPDE 61

Query: 64  IISFL---VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           +IS +   + SPG+AL        ++ A Q    I GDIE   RE     + +P IA+TG
Sbjct: 62  VISQVTDVITSPGLALDTP----VLERARQAGASIYGDIECLARE-----ISAPVIAITG 112

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELTPTI 179
           TNGKS+   L+  + +  G+ V + GNIG P+L+ L+       +V+E SS+Q++LT ++
Sbjct: 113 TNGKSTVTTLVGEMAKAAGFRVAVAGNIGTPVLDMLDDEHHYDLWVLELSSFQLDLTYSL 172

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKI------VTMSKHAIICINDHQCEKIAYDM 233
            P +  +LN++PDHLDRHHT+E Y   K++I      V  ++  +  +    C+     +
Sbjct: 173 SPVVATILNVTPDHLDRHHTMEAYTQAKQRIYRGAKAVLFNREDVYTVPHQSCQADIKCI 232

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
           +F   + S  +   ++ ++ +Y+ +   +      ++         HN  N + +  +  
Sbjct: 233 SFGKDAPSMGNWGLIEQENTIYLAKGMERLLPVESILI-----KGVHNWMNALAACALAE 287

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LNEKRR 349
             G+ ++ I   L +  GL HR Q +  +  V +INDSK TN+ + I A      + + +
Sbjct: 288 AAGISMQHILNVLKTFPGLPHRCQWVREVDGVGWINDSKGTNIGATISAINGIGGSMQGK 347

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLD----Q 404
           I  IAGG  K  DF  L   +S+  ++   IG  A         KI S L+K +      
Sbjct: 348 IVLIAGGQGKGADFQELAQPVSEFVRSIVLIGEDA--------DKIESALAKVVPVVRAS 399

Query: 405 ALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQV 448
           +L+  V   +    P  +VL SP CAS D + +F  RG  F S V
Sbjct: 400 SLEGAVTIAKTCAKPGDVVLLSPACASLDMFRDFNHRGDVFTSSV 444


>gi|262273815|ref|ZP_06051628.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Grimontia hollisae
           CIP 101886]
 gi|262222230|gb|EEY73542.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Grimontia hollisae
           CIP 101886]
          Length = 445

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 139/461 (30%), Positives = 222/461 (48%), Gaps = 37/461 (8%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR 58
           MK  + +N  I V GLG +GLS    L  KD G  V   D    A     D   + +   
Sbjct: 1   MKTDAAKN--IVVIGLGMTGLSVVHHLVRKDDGATVKVIDTR--ATPPGADQLPQGVALH 56

Query: 59  EIPWSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
              W++        +V SPGIAL        +K+A +  +EI+GDIELF R+     +++
Sbjct: 57  AGGWNMDWLLSADLIVASPGIALATPE----LKVAAEKGIEIVGDIELFARD-----VEA 107

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           P I +TG+NGKS+  +L+  +    G +V +GGNIG   L++   + +  YV+E SS+Q+
Sbjct: 108 PVIGITGSNGKSTVTSLVGEMANAAGINVGVGGNIGFAALDM-LANGHDLYVLELSSFQL 166

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T +++    V LN+S DH+DR+  + +Y + K +I   +K A+   +D Q +  +   
Sbjct: 167 ETTSSLNLDAAVFLNLSEDHMDRYEGMADYRDAKLRIFDQAKLAVWNRDDGQTKSGSGAA 226

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
              G S S   + + Q  ++ ++        A SE+         +HN+ N + +  +  
Sbjct: 227 VSFGFS-SGEYTLTEQGGAE-WLTAKGEPVMAVSEIAL-----VGRHNVANCLAAMALAD 279

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIY 351
             G+  +  ++A+    GL HR Q +     V+++NDSKATN  S + A   L    R++
Sbjct: 280 AAGIDRKAQRKAMREYRGLPHRCQQVVEHNGVLWVNDSKATNPASTLAALDGLQLAGRLH 339

Query: 352 WIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVV 410
            + GG  K  DFS L P +  +    Y  G     F       +   ++ T+ QA+    
Sbjct: 340 LLVGGDGKGADFSLLKPVLDTLNVTLYCYGRDRQAFTSLVEKPV---VTDTMQQAMDIA- 395

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              EN     +VL SP CAS DQ+ NF  RG  F +  +EI
Sbjct: 396 --AENANPGDMVLLSPACASLDQFTNFMVRGDMFAAYANEI 434


>gi|148358649|ref|YP_001249856.1| UDP-N-muramoylalanine-D-glutamate ligase [Legionella pneumophila
           str. Corby]
 gi|296108261|ref|YP_003619962.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148280422|gb|ABQ54510.1| UDP-N-muramoylalanine-D-glutamate ligase [Legionella pneumophila
           str. Corby]
 gi|295650163|gb|ADG26010.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 447

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 140/469 (29%), Positives = 228/469 (48%), Gaps = 54/469 (11%)

Query: 8   NHSI-AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW---- 62
           NHS+  V GLG++GLS A  LK +    + +D      K+A  +     +F ++P     
Sbjct: 2   NHSLYLVAGLGKTGLSIARYLKRNNKSFVVFDTR----KEAPGLAEFQNEFPDVPIYLQQ 57

Query: 63  ------SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                 S ++ ++ SPG+AL        ++ A Q    I GDIE   RE     + +P I
Sbjct: 58  TPDEVISQVTDVITSPGLALDTP----VLERARQAGASIYGDIECLARE-----ISAPVI 108

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIEL 175
           A+TGTNGKS+   L+  + +  G+ V + GNIG P+L+ L+       +V+E SS+Q++L
Sbjct: 109 AITGTNGKSTVTTLVGEMAKAAGFRVAVAGNIGTPVLDMLDDEHHYDLWVLELSSFQLDL 168

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND-----HQ-CEKI 229
           T ++ P +  +LN++PDHLDRHHT+E Y   K++I + +K  +    D     HQ C+  
Sbjct: 169 TYSLSPVVATILNVTPDHLDRHHTMEAYTQAKQRIYSGAKAVLFNREDVYTVPHQSCQAD 228

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
              ++F   + S  +   ++ ++  Y+ +   +      ++         HN  N + + 
Sbjct: 229 IKCISFGKDAPSMGNWGLIEQENTTYLAKGMERLLPVESILIK-----GVHNWMNALAAC 283

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LN 345
            +    G+ ++ I   L +  GL HR Q +  +  V +INDSK TN+ + I A      +
Sbjct: 284 ALAEAAGISMQHILNVLKTFPGLPHRCQWVREVDGVGWINDSKGTNIGATISAINGIGGS 343

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLD- 403
            + +I  IAGG  K  DF  L   +S+  ++   IG  A         KI S L+K +  
Sbjct: 344 MQGKIVLIAGGQGKGADFQELAQPVSEFVRSIVLIGEDA--------DKIESALAKVVPV 395

Query: 404 ---QALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQV 448
               +L+  V   +    P  +VL SP CAS D + +F  RG  F S V
Sbjct: 396 VRASSLEGAVTIAKTCAKPGDVVLLSPACASLDMFRDFNHRGDVFTSSV 444


>gi|315125601|ref|YP_004067604.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pseudoalteromonas
           sp. SM9913]
 gi|315014114|gb|ADT67452.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pseudoalteromonas
           sp. SM9913]
          Length = 444

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 142/472 (30%), Positives = 219/472 (46%), Gaps = 62/472 (13%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKDMGIEVID 56
           L+  +N  I V GLG +GL     L    +  +V+   ++P  V    + A  +     +
Sbjct: 4   LNEIKNKHITVLGLGVTGLGIVRFLLSQSIQPYVVDSRENPPGVDWLNQHAPQLKTHFGN 63

Query: 57  FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                 S    +++SPG+ L        V  A    VE+IGD+ELF R         P +
Sbjct: 64  LENAALSACDMIIISPGLGLKTP----AVAKAINAGVEVIGDVELFARINS-----KPVV 114

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           AVTG+NGKS+ V L   VL+  GY V LGGNIG  +L+L     + F V+E SS+Q++ T
Sbjct: 115 AVTGSNGKSTVVTLAYEVLKTAGYKVALGGNIGTAVLDLLDGDFDVF-VLELSSFQLDTT 173

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI 236
            ++  +   +LNIS DHLDR+ + + Y++ K  I   ++H +I ++D Q           
Sbjct: 174 RSLKTTSATVLNISEDHLDRYDSYQAYIDSKLSIYNGAEHLVINVDDIQT---------- 223

Query: 237 GHSISRISSQSL---QSDSDLYI------------DESFLKCSATSEVIFDFSQETKKHN 281
            H +SR  +  L   ++  D ++            DE++L  S  + V         KHN
Sbjct: 224 -HPVSRTLAPQLSFGETQGDYHLAQHNNEAHFMVKDEAYLPVSTLAVV--------GKHN 274

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
             N +    +     +     K AL    GL HR Q +     V + NDSKATN+ + I 
Sbjct: 275 YLNTLAVMALLSPFTITKAHYKTALAQFNGLAHRCQFVGEFNDVKYFNDSKATNVGATIA 334

Query: 342 A---FLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAY--FIGNSAMLFFHHFGGKINS 396
           A      E++ +  IAGG +K  D   L P+I K  KA   F  ++  L      G + +
Sbjct: 335 AIDSLAGEQQNLVVIAGGDAKGADLEVLKPYIEKHVKALICFGKDAKDLVALSAKGHLTN 394

Query: 397 TLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
            +S+ +  A K + +  +       VL +P CAS D YNN+ +RG  F+  V
Sbjct: 395 NMSEAVALA-KQLSKSGDT------VLLAPACASIDMYNNYMQRGDDFVQSV 439


>gi|312794105|ref|YP_004027028.1| UDP-N-acetylmuramoylalanine/d-glutamate ligase
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312181245|gb|ADQ41415.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 458

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 138/480 (28%), Positives = 242/480 (50%), Gaps = 63/480 (13%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA--VKQAKDMGIEVID---FREI 60
            +  ++ V G+GRSGL++A  LK  G  VI +D+       K+ ++   E++D   + EI
Sbjct: 3   LKGKNVLVVGIGRSGLASARFLKKQGAFVIGFDEKAEDQFKKEDRNCAQELLDEIYYCEI 62

Query: 61  PWSII---SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
           P   +     +V+SPG+ L+       + LA++  +E+IG+IEL  R  +  ++    +A
Sbjct: 63  PDEAVDKVQLVVVSPGVPLS----KRPLVLAHKKGIEVIGEIELAYRFCKSKNI----VA 114

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELT 176
           +TGTNGK++T  L+  +L+K   DV + GNIGLP ++ +E  S N  +V+E SS+Q+E  
Sbjct: 115 ITGTNGKTTTTTLVGEILKKQYEDVVVCGNIGLPFIDTIETSSENTIFVLEISSFQLETI 174

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYV----------------------NIKKKIVTMS 214
               P +G +LNI+PDHL+RH T+ENY+                      NI + ++ ++
Sbjct: 175 KYFKPKVGCILNITPDHLNRHMTMENYIKAKMRIFENIDEMGYTVLNYDNNITRDLIGLA 234

Query: 215 KHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS 274
           K  +I  + ++C+    +M F+       + +  ++   +  DE F+             
Sbjct: 235 KGNVIVFSKNKCQ--FKNMVFVEKDTIYFTFEG-KTQEIMKKDEIFI------------- 278

Query: 275 QETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKAT 334
               +HN++N + +    +  G++ + I++ L +  G+ HR++ +A +  + F NDSK T
Sbjct: 279 --PGEHNLENALAAISCTLPFGIEKDTIEQVLKTFRGVEHRIEFVAEINGIKFYNDSKGT 336

Query: 335 NLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFG-- 391
           N  +   A    +  I  IAGG  K + F      ++ K+ K + +G +           
Sbjct: 337 NTDAAEKALRAFESPIILIAGGYDKGESFEKFASLVAKKVKKVFLLGQTKHKIASELEKI 396

Query: 392 GKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           G  N  L  TL +A++   +  E  Q   IVL SP CAS+D + N+ +RG  F   V+E+
Sbjct: 397 GYKNFELVSTLKEAVR---KSFECAQNGDIVLLSPACASWDMFENYEQRGRMFKEYVNEL 453


>gi|319776623|ref|YP_004139111.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Haemophilus
           influenzae F3047]
 gi|329124136|ref|ZP_08252683.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Haemophilus
           aegyptius ATCC 11116]
 gi|317451214|emb|CBY87447.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Haemophilus
           influenzae F3047]
 gi|327467561|gb|EGF13059.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Haemophilus
           aegyptius ATCC 11116]
          Length = 437

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 134/456 (29%), Positives = 234/456 (51%), Gaps = 41/456 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNIMIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        +K      VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPEIQTVLKAG----VEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAATILNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q + +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLVHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           ++ + GG  K  DFS L   I++     Y  G    L    F  +  S L +T++QA+ +
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGAL-LAKFSSQ--SYLFETMEQAI-A 395

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
            +R    +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 396 FLRPT--LQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|53803416|ref|YP_114845.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylococcus
           capsulatus str. Bath]
 gi|62900496|sp|Q604V5|MURD_METCA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|53757177|gb|AAU91468.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Methylococcus
           capsulatus str. Bath]
          Length = 459

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 129/455 (28%), Positives = 225/455 (49%), Gaps = 35/455 (7%)

Query: 11  IAVFGLGRSGLSAA---------CALKDSGVHVIAWDDHPCAVKQA-KDMGIEVIDFREI 60
           + V GLG +GLS           CA+ DS +      D    +++A  D+ + + DF   
Sbjct: 25  VIVLGLGATGLSTVRFLRCHGFECAVMDSRLAPPGLQD----LREAFPDVPLFLGDFSRS 80

Query: 61  PWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
             +  + LV+SPG++L        ++ +++  V + GD++LF        +++P +A+TG
Sbjct: 81  ALAAATHLVVSPGLSLDLAE----IRESHRCGVRVFGDLDLFA-----CCVRAPVVAITG 131

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
            NGKS+   L+  + +  G +  +GGN+G P+L+L   +    YV+E SS+Q+E +   +
Sbjct: 132 ANGKSTVTTLVGLMAKAAGVNAAVGGNLGTPMLDL-LDAAAELYVLELSSFQLERSELFE 190

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
             +  +LNISPDH+DR+  L +Y   K+++       ++ +N  Q + +   M   G   
Sbjct: 191 ADVATVLNISPDHMDRYPDLASYAEAKRRV--FRGEGLMVLN--QDDPLVAAMYRPGRRA 246

Query: 241 SRI---SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
            R    S   L      +   ++L       +  D  +   +HN+ N + +  +    G 
Sbjct: 247 VRFGLGSGDELDYSLARWEGRAWLLAKGVPLLPADEVRIKGRHNLANALAAVAIADACGF 306

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGL 357
             + +   L +  GL HR+Q +A +G V ++NDSKATN+ + I A    + ++  IAGG 
Sbjct: 307 DRQAMVGVLRTFPGLDHRMQWVADIGGVAYVNDSKATNVGACIAALSGLEGKVVLIAGGD 366

Query: 358 SKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENV 416
            K  DFS+L P  + K+  A  +G    L      G + +   KT+ +A+++  R V   
Sbjct: 367 GKGADFSSLVPVAAEKLRAAVLMGRDGPLIDEVLKGVVPTIRVKTMFEAVRA-ARGV--A 423

Query: 417 QLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           Q    VL +P CAS DQY +++ERG  F + V  +
Sbjct: 424 QSGDTVLLAPACASLDQYEDYQERGRDFAATVRSL 458


>gi|239994437|ref|ZP_04714961.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alteromonas
           macleodii ATCC 27126]
          Length = 510

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 143/502 (28%), Positives = 231/502 (46%), Gaps = 69/502 (13%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKDMGIEVIDF------ 57
           R HS  V GLG +G +    L      V A+D   +         D+  ++  F      
Sbjct: 6   REHSYVVGGLGVTGQACVRFLLQKQATVKAFDTRANFTLVTDPDSDLDTDMQAFMAEKVT 65

Query: 58  ----REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
                E  +  +  LVLSPG+AL  E     V LA +  VE+IGD+ELF R    +S  +
Sbjct: 66  CTALSEDYFDGVDTLVLSPGLALDIEQ----VALAQKCGVEVIGDVELFARLNASTSDAT 121

Query: 114 P---FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSS 170
           P    + +TG+NGK++   L++H+L+  G      GN+G P+L     S     V+E SS
Sbjct: 122 PAKRVVGITGSNGKTTVTLLVNHLLKNCGVKSIEAGNVGRPVLE-ALQSDADVVVMELSS 180

Query: 171 YQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAII----------- 219
           +Q+E T ++      +LNIS DHLDRH TLE Y++ K +I   +K A++           
Sbjct: 181 FQLETTSSLVLEAATVLNISDDHLDRHGTLEAYIDAKHRIFDNAKSAVVWRDGEFVAPYE 240

Query: 220 -------------CINDHQCEKIAYDMNF---------IGHSISRISSQSLQSDSDLYID 257
                         ++D +    + + +          +G S +  +  S   D     D
Sbjct: 241 QLITDAKGIAASNAVSDGESNAASNEESLASKNIVEYGLGESTTGFAIASFDGDDSARDD 300

Query: 258 ESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHR 315
           E  L  +   E +   S       HN+ N++ +  +C+QLG+      + L S     HR
Sbjct: 301 EQSLYITFKDEKLIALSDIHLAGMHNVLNIMAALGICLQLGVSPALAVKHLRSFKAAPHR 360

Query: 316 LQTIARLGHVIFINDSKATNLHSVIHAFLNE----KRRIYWIAGGLSKSDDFSTLFPFIS 371
              IAR+  + +I+DSKATN+ + + A        + ++  IAGG +K  D ++L P+++
Sbjct: 361 CVEIARVNDIRYIDDSKATNIGATVAALEGLAPTIQGKLILIAGGDAKGADIASLSPYLT 420

Query: 372 K-IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPS-IVLFSPGCA 429
           K ++  + +G  A LF   F    ++T   T+  A+K+  R    +  P  +VL SP CA
Sbjct: 421 KYVSHVFALGKDAHLFEKSFA---HTTRVATMKDAVKAATR----LAAPGDVVLLSPACA 473

Query: 430 SFDQYNNFRERGFSFMSQVSEI 451
           S D + N+  RG  F   V ++
Sbjct: 474 SLDMFKNYMHRGDVFKQDVHDL 495


>gi|253988592|ref|YP_003039948.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780042|emb|CAQ83203.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Photorhabdus
           asymbiotica]
          Length = 423

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 129/395 (32%), Positives = 199/395 (50%), Gaps = 37/395 (9%)

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            +V+SPGIAL    A   ++ A    +EI+GDIELF RE       +P IA+TG+NGKS+
Sbjct: 55  LIVVSPGIAL----ATAELQAAADAGIEIVGDIELFCREA-----TTPIIAITGSNGKST 105

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
             +L+  + +  G+ V +GGNIGLP L L   S  + YV+E SS+Q+E T ++  +   +
Sbjct: 106 VTSLVGEMAKAAGWQVGVGGNIGLPALELLKQS-CQLYVLELSSFQLETTYSLKAAAATV 164

Query: 187 LNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISS 245
           LN++ DH+DR+   L  Y   K ++   +K  I+ + D         +   G     +S 
Sbjct: 165 LNVTEDHMDRYPQGLSQYRAAKLRVYHQAKRCIVNVQD------TLTLPETGMDSRCVSV 218

Query: 246 QSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRA 305
                D  L  + +FLK    S +  +  + T +HN  N + +  +   +G+  E     
Sbjct: 219 GVDCGDYQLDSENAFLKVHNQSLLAANEIKLTGRHNYVNGLVALALADAVGIPREASLAT 278

Query: 306 LLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDF 363
           L    GL HR Q +     V +INDSKATN+ S   A   LN +  +Y + GG  KS DF
Sbjct: 279 LTVYPGLNHRFQLVHLNNGVRWINDSKATNVGSTEAALNGLNLEGTLYLLLGGDGKSADF 338

Query: 364 STLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALKSVVRDVENV 416
           S L PF+         G+   L+ F   G ++       +TL++T++QA++ +      +
Sbjct: 339 SPLKPFLC--------GDKVRLYCFGRDGKRLAQLRPEIATLTETMEQAIRDI---APRL 387

Query: 417 QLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
               +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 388 VAGDMVLLSPACASLDQFRNFEQRGHEFARLAEEL 422


>gi|300173574|ref|YP_003772740.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           gasicomitatum LMG 18811]
 gi|299887953|emb|CBL91921.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           gasicomitatum LMG 18811]
          Length = 448

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 136/472 (28%), Positives = 236/472 (50%), Gaps = 42/472 (8%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD----DHPCAVKQAKDMGIEVID 56
           MK+  F N  + VFG  RSG +AA  L + G  V   +    +     +Q    G++ I+
Sbjct: 1   MKIQDFNNKKVMVFGWARSGKAAAQRLLELGAQVTVVNGGEFEDDMVYRQLLAAGVQFIN 60

Query: 57  FREIPWSIISF--LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP 114
             +      SF  L+ +PGI    E A   VK A +  + I+ ++ +       SS +  
Sbjct: 61  HDDAVSLNTSFDYLIKNPGINY--ETA--LVKQAKKLKIPILTEVAV-----ALSSFEGR 111

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQI 173
            IAVTG+NGK++T +LI  +L+ +G  V   GNIG+P+   ++  + +   ++E SS+Q+
Sbjct: 112 LIAVTGSNGKTTTTSLIRDMLKSDGQKVTTAGNIGIPVCEVIKDLTADDTLLLELSSFQL 171

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIA 230
             TP I P I ++ NI  +HLD H T ENYV  K ++    T ++  ++  +    ++  
Sbjct: 172 MGTPDIRPDIALITNIFANHLDYHGTRENYVAAKFQLTKNQTSNQLLVLNADGQDTDEFI 231

Query: 231 YDMNFIGHSISRISSQ-SLQSDS-DLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
              +    + SRI +  ++++D+ DL I ++ L   +  +++         HN++N+V +
Sbjct: 232 KKTHAKVVAFSRIKNDYTVRTDNVDLIISDNHLMPLSGIKLV-------GPHNLENIVAA 284

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
             V    G+    I+  L + GG+ HRLQ +     V+F NDSKAT++ +   A  +  +
Sbjct: 285 VTVAKLAGVHDTAIRHVLETFGGVEHRLQHVLTDNGVVFYNDSKATDIEATQTALNSFHQ 344

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSK------TL 402
              W+AGGL + DD   L P +S +         A++ F     KI +          T+
Sbjct: 345 PTIWLAGGLDRGDDLMRLLPNLSHV--------KAVIAFGETQQKIVAVARAANKPVITV 396

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGI 454
           D   ++V   V+      +VL SP  AS+DQY +F ERG  +++++ ++ G+
Sbjct: 397 DDVEQAVPVAVKLAVTGDVVLLSPAAASWDQYKSFEERGERYVTELKKVLGL 448


>gi|118602749|ref|YP_903964.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567688|gb|ABL02493.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 433

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 133/451 (29%), Positives = 228/451 (50%), Gaps = 48/451 (10%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKDMGIEVIDFREIPWSI----- 64
           V GLG++G S A  L +  +     D   + P   K        ++      W++     
Sbjct: 4   VLGLGKTGFSIARFLSEQNIDYKIADSRTNPPLLSKYPDAFSKSLLTLGS--WTLDLLKK 61

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
           +  + +SPGIA       W    A + N+ +I DIELF    RF+  ++P I +TG+NGK
Sbjct: 62  VDEIFISPGIAQNESIVIW----AKEQNIPVISDIELF---SRFA--KAPIIGITGSNGK 112

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILN-----LEYFSPNRFYVIECSSYQIELTPTI 179
           S+   L++ ++   G  V +GGNIG P+L+     +EY      YV+E SSYQ++ +  +
Sbjct: 113 STVTQLLTQMIINAGMQVAMGGNIGTPVLDCLNEKIEY------YVLELSSYQLDYSHHL 166

Query: 180 DPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHS 239
           +  +GV+LNI+PDHLDR+   ++Y+N K  +    +H +I + D        +    G S
Sbjct: 167 NLIVGVVLNITPDHLDRYQNFKHYINSKLSLYQHCQHLVINL-DEPLTPPKVNAKCFGIS 225

Query: 240 ISRISSQ--SLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
           I + +    ++      Y+ +      + +EV     Q   +HN +N++ +  +  Q+ L
Sbjct: 226 IPKQADDFGTVTCHDTYYLLKGDNVLMSINEV-----QLIGEHNTRNILAALALGDQIRL 280

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV---IHAFLNEKRRIYWIA 354
            +  + +++ +  GL HRL+ +A+  ++ + NDSKATN  S    I A + + + I  I 
Sbjct: 281 PIISMIQSIKNFKGLEHRLEWVAKKQNIDYYNDSKATNAISTITAIQALMRKHQNIVLIL 340

Query: 355 GGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           GG++K ++++ LF  I+K I     IG SA  F        N++ +KT+  A+      +
Sbjct: 341 GGIAKQENYTPLFKLINKSITSVILIGQSAQQFEQEIN--TNTSHAKTMKDAVNVAHSMI 398

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
            N      +L SPGCASFD +++F  RG +F
Sbjct: 399 NN----GTILLSPGCASFDMFDDFEHRGRAF 425


>gi|52842822|ref|YP_096621.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|62900494|sp|Q5ZSA3|MURD_LEGPH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|52629933|gb|AAU28674.1| UDP-N-muramoylalanine-D-glutamate ligase [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 447

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 226/469 (48%), Gaps = 54/469 (11%)

Query: 8   NHSI-AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW---- 62
           NHS+  V GLG++GLS A  LK +    + +D      K+A  +     +F ++P     
Sbjct: 2   NHSLYLVAGLGKTGLSIARYLKRNNKSFVVFDTR----KEAPGLAEFQNEFPDVPIYLQQ 57

Query: 63  ------SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                 S ++ ++ SPG+AL        ++ A Q    I GDIE   RE     + +P I
Sbjct: 58  TPDEVISQVTDVITSPGLALDTP----VLERARQAGASIYGDIECLARE-----ISAPVI 108

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIEL 175
           A+TGTNGKS+   L+  + +  G+ V + GNIG P+L+ L+       +V+E SS+Q++L
Sbjct: 109 AITGTNGKSTVTTLVGEMAKAAGFRVAVAGNIGTPVLDMLDDEHHYDLWVLELSSFQLDL 168

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI------VTMSKHAIICINDHQCEKI 229
           T ++ P +  +LN++PDHLDRHHT+E Y   K++I      V  ++  +  +    C+  
Sbjct: 169 TYSLSPVVATILNVTPDHLDRHHTMEAYTQAKQRIYRGAKAVLFNREDVYTVPHQSCQAD 228

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
              ++F   + S  +   ++ ++  Y+ +   +      ++         HN  N + + 
Sbjct: 229 IKCISFGKDAPSMGNWGLIEQENTTYLAKGMERLLPVESILI-----KGVHNWMNALAAC 283

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LN 345
            +    G+ ++ I   L +  GL HR Q +  +  V +INDSK TN+ + I A      +
Sbjct: 284 ALAEAAGISMQHILNVLKTFPGLPHRCQWVREVDGVGWINDSKGTNIGATISAINGIGGS 343

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLD- 403
            + +I  IAGG  K  DF  L   +S+  ++   IG  A         KI S L+K +  
Sbjct: 344 MQGKIVLIAGGQGKGADFQELAQPVSEFVRSIVLIGEDA--------DKIESALAKVVPV 395

Query: 404 ---QALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQV 448
               +L+  V   +    P  +VL SP CAS D + +F  RG  F S V
Sbjct: 396 VRASSLEGAVTIAKTCAKPGDVVLLSPACASLDMFRDFNHRGDVFTSSV 444


>gi|16273062|ref|NP_439294.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae Rd KW20]
 gi|260580220|ref|ZP_05848050.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Haemophilus
           influenzae RdAW]
 gi|1171072|sp|P45063|MURD_HAEIN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|1574691|gb|AAC22791.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase (murD) [Haemophilus
           influenzae Rd KW20]
 gi|260093504|gb|EEW77437.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Haemophilus
           influenzae RdAW]
          Length = 437

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 234/456 (51%), Gaps = 41/456 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAATVLNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q + +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLVHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           ++ + GG  K  DFS L   I++     Y  G    L    F  +  S L  T++QA++ 
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGAL-LAKFSSQ--SYLFDTMEQAIEF 396

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +      +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 397 L---RPTLQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|319411051|emb|CBY91451.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase
           (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase;
           D-glutamic acid adding enzyme) [Neisseria meningitidis
           WUE 2594]
          Length = 445

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 223/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEYEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A+++
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEAVQT 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAEAC---DIVLLSPACASFDMFKGYAHRSEVFIE 440


>gi|54298605|ref|YP_124974.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legionella
           pneumophila str. Paris]
 gi|62900489|sp|Q5X1S4|MURD_LEGPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|53752390|emb|CAH13822.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Legionella
           pneumophila str. Paris]
          Length = 447

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 226/469 (48%), Gaps = 54/469 (11%)

Query: 8   NHSI-AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW---- 62
           NHS+  V GLG++GLS A  LK +    + +D      K+A  +     +F ++P     
Sbjct: 2   NHSLYLVAGLGKTGLSIARYLKRNNKSFVVFDTR----KEAPGLAEFQNEFPDVPIYLQQ 57

Query: 63  ------SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                 S ++ ++ SPG+AL        ++ A Q    I GDIE   RE     + +P I
Sbjct: 58  TPDEVISQVTDVITSPGLALDTP----VLERARQAGASIYGDIECLARE-----ISAPVI 108

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIEL 175
           A+TGTNGKS+   L+  + +  G+ V + GNIG P+L+ L+       +V+E SS+Q++L
Sbjct: 109 AITGTNGKSTVTTLVGEMAKAAGFRVAVAGNIGTPVLDMLDDEHHYDLWVLELSSFQLDL 168

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI------VTMSKHAIICINDHQCEKI 229
           T ++ P +  +LN++PDHLDRHHT+E Y   K++I      V  ++  +  +    C+  
Sbjct: 169 TYSLSPVVATILNVTPDHLDRHHTMEAYTQAKQRIYRGAKAVLFNREDVYTVPHQSCQTD 228

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
              ++F   + S  +   ++ ++  Y+ +   +      ++         HN  N + + 
Sbjct: 229 IKCISFGKDAPSMGNWGLIEQENTTYLAKGMERLLPVESILIK-----GVHNWMNALAAC 283

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LN 345
            +    G+ ++ I   L +  GL HR Q +  +  V +INDSK TN+ + I A      +
Sbjct: 284 ALAEAAGISMQHILNVLKTFPGLPHRCQWVREVDGVGWINDSKGTNIGATISAINGIGGS 343

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLD- 403
            + +I  IAGG  K  DF  L   +S+  ++   IG  A         KI S L+K +  
Sbjct: 344 MQGKIVLIAGGQGKGADFQELAQPVSEFVRSIVLIGEDA--------DKIESALAKVVPV 395

Query: 404 ---QALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQV 448
               +L+  V   +    P  +VL SP CAS D + +F  RG  F S V
Sbjct: 396 VRASSLEGAVTIAKTCAKPGDVVLLSPACASLDMFRDFNHRGDVFTSSV 444


>gi|289549042|ref|YP_003474030.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thermocrinis albus
           DSM 14484]
 gi|289182659|gb|ADC89903.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thermocrinis albus
           DSM 14484]
          Length = 422

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 136/446 (30%), Positives = 211/446 (47%), Gaps = 40/446 (8%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL 70
           + V+GLG SGL+A   LK  G+  I  DD     K   D  + + +        +  LVL
Sbjct: 4   VLVWGLGASGLAALQLLKSKGIEAIGGDD-----KHKTDWRLLLEE--------VDTLVL 50

Query: 71  SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVAL 130
           SPGI      +H   + A +  +E+IG++EL  R       +   IA+TGT+GKS+T  L
Sbjct: 51  SPGIP----PSHPIWQEAVRKGIEVIGELELAWR-----FFEGTAIAITGTDGKSTTTRL 101

Query: 131 ISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNIS 190
              +LR     V+ GGNIG+P   L   +P    V+E SS+Q +   T  P +G  LN S
Sbjct: 102 SYLILRSYFSHVEEGGNIGVPFSYLVMKNPKALAVLEVSSFQGKTLKTFRPHVGAFLNFS 161

Query: 191 PDHLDRHHTLENYVNIKKKIVT-MSKHAIICINDHQCEKIAYDMNFIGHSI--SRISSQS 247
            DHLD H  L +Y+  K  I +  +    I +N  Q  K+  D       +         
Sbjct: 162 EDHLDWHPDLRDYLWSKYNIFSRQTPEDWILLNGTQ--KVTRDTPSPARKVFFGDGCEAH 219

Query: 248 LQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALL 307
           ++ D   + +E          +         KHN+ N + + V+   +G+  + +K  L 
Sbjct: 220 VKEDGAYWSEEKLFSVEDIKLI--------GKHNLYNALVACVIGRIMGVPTDRMKEVLR 271

Query: 308 SCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN-EKRRIYWIAGGLSKSDDFSTL 366
              GL HRL+ +   G V+  NDSK+T  +++  A  +    R+  IAGG  K   F  L
Sbjct: 272 DFRGLPHRLELVGDFGGVLVYNDSKSTTPNALQAALGSMPDGRVILIAGGKDKGASFEHL 331

Query: 367 FPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFS 425
            P ++ K+  A  IG +       + G    +L+ +LD+A++   R+ +      I+LFS
Sbjct: 332 CPLVTQKVKHAVLIGEAKRRIADAWKGCTQVSLASSLDEAIRMAQREAKP---GDILLFS 388

Query: 426 PGCASFDQYNNFRERGFSFMSQVSEI 451
           P C+SFD ++N+ ERG +F   V EI
Sbjct: 389 PACSSFDMFSNYEERGETFKKLVREI 414


>gi|254671173|emb|CBA08279.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis alpha153]
          Length = 445

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 223/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A+++
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQT 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|54295453|ref|YP_127868.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Legionella
           pneumophila str. Lens]
 gi|62900487|sp|Q5WTI5|MURD_LEGPL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|53755285|emb|CAH16779.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Legionella
           pneumophila str. Lens]
          Length = 447

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 227/469 (48%), Gaps = 54/469 (11%)

Query: 8   NHSI-AVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW---- 62
           NHS+  V GLG++GLS A  LK +    + +D      K+A  +     +F ++P     
Sbjct: 2   NHSLYLVAGLGKTGLSIARYLKRNNKSFVVFDTR----KEAPGLAEFQNEFPDVPIYLQQ 57

Query: 63  ------SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
                 S ++ ++ SPG+AL        ++ A Q    I GDIE   RE     + +P I
Sbjct: 58  TPDEVISQVTDVITSPGLALDTP----VLESARQAGALIYGDIECLARE-----ISAPVI 108

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIEL 175
           A+TGTNGKS+   L+  + +  G+ V + GNIG P+L+ L+       +V+E SS+Q++L
Sbjct: 109 AITGTNGKSTVTTLVGEMAKAAGFRVAVAGNIGTPVLDMLDDEHHYDLWVLELSSFQLDL 168

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI------VTMSKHAIICINDHQCEKI 229
           T ++ P +  +LN++PDHLDRHHT+E Y   K++I      V  ++  +  +    C+  
Sbjct: 169 TYSLSPVVATILNVTPDHLDRHHTMEAYTQAKQRIYRGAKAVLFNREDVYTVPHQSCQAD 228

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
              ++F   + S  +   ++ ++ +Y+ +   +      ++         HN  N + + 
Sbjct: 229 IKCISFGKDAPSMGNWGLIEQENTIYLAKGMERLLPVESILI-----KGVHNWMNALAAC 283

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LN 345
            +    G+ ++ I   L +  GL HR Q +  +  V +INDSK TN+ + I A      +
Sbjct: 284 ALAEAAGISMQHILNVLKTFPGLPHRCQWVREVDGVGWINDSKGTNIGATISAINGIGGS 343

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLD- 403
            + +I  IAGG  K  DF  L   +S+  ++   IG  A         KI S L+K +  
Sbjct: 344 MQGKIVLIAGGQGKGADFQELAQPVSEFVRSIVLIGEDA--------DKIESALAKVVPV 395

Query: 404 ---QALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQV 448
               +L+  V   +    P  +VL SP CAS D + +F  RG  F S V
Sbjct: 396 VRASSLEGAVTIAKTCAKPGDVVLLSPACASLDMFRDFNHRGDVFTSSV 444


>gi|330446841|ref|ZP_08310492.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491032|dbj|GAA04989.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 446

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 137/453 (30%), Positives = 222/453 (49%), Gaps = 40/453 (8%)

Query: 9   HSIAVFGLGRSGLSAACAL----KDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSI 64
           ++I V GLG +GLS    L    +   + VI   D+P      +D   E +      W+ 
Sbjct: 8   NTIVVIGLGMTGLSVVNHLMRLPQSLTIKVIDTRDNP----PGQDQLPESVALCSGQWNT 63

Query: 65  -----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   ++ SPGIAL        + LA +  VEIIGDIELF RE     +  P +A+T
Sbjct: 64  EWLLSADMIIASPGIALATPE----LVLAAEAGVEIIGDIELFARE-----VDKPVVAIT 114

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+  +L+  + ++ G DV +GGNIG   L++     ++ YV+E SS+Q+E T ++
Sbjct: 115 GSNGKSTVTSLVGEMAKEAGIDVGVGGNIGFAALDM-LAQQHQLYVLELSSFQLETTSSL 173

Query: 180 DPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           + +  V LN+S DH+DR+   L  Y   K +I   +K A+   +D   +   +       
Sbjct: 174 ELTAAVYLNLSEDHMDRYPGGLAQYSQAKMRIFDHAKLAVFNRDDLATKPTQFSGAMTSF 233

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLK 298
                +   +  D   ++  +     A +++         +HN+ N + +  +    G+ 
Sbjct: 234 GFDEQAYGIVSVDGKEWLVVNGEAVMAVADIAL-----VGRHNVANCLAALALADAAGVP 288

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGG 356
            +   RA+    GL HR Q       V ++NDSKATNL S + A   L  + +++ + GG
Sbjct: 289 RDASCRAMQHYTGLAHRCQLAVNRHGVRWVNDSKATNLASTLAALNGLQLEGKLHLLMGG 348

Query: 357 LSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLS-KTLDQALKSVVRDVE 414
            SK  +FS L P ++ +  + Y  G       H F    N+ +S +T+ +A++ V R   
Sbjct: 349 DSKGAEFSELKPVLADLNVQLYSFGRDR----HLFDDVTNNVISVETMSEAMEQVSR--- 401

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQ 447
            VQ   +VL SP CAS+DQ+ NF  RG +F+ Q
Sbjct: 402 TVQSGDMVLLSPACASWDQFANFMARGDAFVEQ 434


>gi|220933947|ref|YP_002512846.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|219995257|gb|ACL71859.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 442

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 134/457 (29%), Positives = 218/457 (47%), Gaps = 43/457 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQ----AKDMGIEVIDFREIPWSIIS 66
           + GLG +G+S A  L+  G      D    P   ++    A +  ++   F    ++ + 
Sbjct: 9   IVGLGATGISVARHLRARGESFRVADSRAEPPGREELRRLAPEARLDAGPFDPALFTGVK 68

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            L++SPG+++    A   ++ A     EI+GDIELF RE R     +P +A+TG+NGKS+
Sbjct: 69  RLIVSPGVSV----AEPAIQAARAAGAEILGDIELFAREAR-----APVVAITGSNGKST 119

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
             AL+  + R  G +V +GGN G+P L+L   +    YV+E SS+Q+E T ++ P    +
Sbjct: 120 VTALVGEMARAAGLNVAVGGNFGIPALDLLNDADVELYVLELSSFQLETTESLAPVAATV 179

Query: 187 LNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQ-------CEKIAYDMNFIGHS 239
           LNIS DHLDR+ +LE+Y   K++I   ++ A+I  +D +         ++++ ++  G  
Sbjct: 180 LNISADHLDRYESLEDYAAAKERIFRRTETAVINRDDPRVWSMAGGARRVSFGLDVPGEG 239

Query: 240 ----ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
               + R +   L      +  ES L+ +              +HN  N + +  +    
Sbjct: 240 DWGLVERDAEPWLAQGEIPWFAESRLRIAG-------------RHNTANALAALALGQAA 286

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           GL  E +  AL    GL HR Q + RL  V + NDSK TNL + + A      ++  IAG
Sbjct: 287 GLPGEAMVEALTQFSGLPHRCQWVTRLHGVSWYNDSKGTNLGATLAALEGFPGQVVLIAG 346

Query: 356 GLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVE 414
           G  K  DF+ L   +   A+A   +G  A        G++      ++     +V     
Sbjct: 347 GQGKGQDFAPLGDAVVGKARAVVLLGEDAPHIATALDGRVPVV---SVASMEAAVAEAAR 403

Query: 415 NVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             Q    VL SP CAS D ++N+  RG  FM+ V  +
Sbjct: 404 LAQSGDSVLLSPACASLDMFDNYMHRGEVFMAAVRRL 440


>gi|317495036|ref|ZP_07953408.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Gemella moribillum
           M424]
 gi|316914808|gb|EFV36282.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Gemella moribillum
           M424]
          Length = 446

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 152/472 (32%), Positives = 229/472 (48%), Gaps = 57/472 (12%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSG--VHVIAWDD--HPCAVKQAKDMGIEVIDFREI 60
           + +N  I V G  RSG S    LK  G  V + ++DD  +    ++ +++GIE+ID    
Sbjct: 3   NLKNKRILVLGFARSGYSTVKILKKLGYDVKLNSYDDLSNDEKAQELRELGIEIIDGGH- 61

Query: 61  PWSI---ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
           P  +   I  +V +PGI    E     V++     ++II +IEL      FS      +A
Sbjct: 62  PLELLETIDLIVKNPGIKYQIEFLQKAVEMG----IDIITEIEL--ANTLFS---IDMVA 112

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177
           +TGTNGK++T  +   +L+K   DV L GNIG P + + Y  P    V E SS+Q+E T 
Sbjct: 113 ITGTNGKTTTTQMTYDILKKANKDVFLAGNIGYPSIEVAYNHPKSLIVTEVSSFQLEGTK 172

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKI-VTMSKHAIICINDHQCEKIAYDMNFI 236
              PSI V+ N+   HLD H  LENY N KKKI V  +K   + IN  + EK  Y+ + I
Sbjct: 173 YFKPSIAVITNLGEGHLDYHGNLENYQNAKKKIYVNQTKDDFLIINIKEKEK--YNFDKI 230

Query: 237 GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQ 294
             +I    ++   S +D+YI E+ +    T   +FD ++      HN++N + +A++   
Sbjct: 231 KSTIIFYDTKENIS-TDVYIKENIVMFRETE--LFDSTKLKLPGMHNVENAINAAIISYL 287

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
            G   + I++ L +  G+ HRLQ +     V + NDSKATN  +   A     + I  I 
Sbjct: 288 KGASTDAIQQVLYNFSGVKHRLQYVGEYKGVKYYNDSKATNPVATTTALSGFDKNIILIC 347

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFF-----HHF----------GGKINSTLS 399
           GG  +  DF  L P++SKI     +G S  L +     H+             K+ S+L+
Sbjct: 348 GGKDRGIDFKELIPYLSKIKVMVVVGESKELLYSLAIQHNVKCIKAIKVADATKLASSLA 407

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           K  D                  VL SP CAS+DQY  F +RG  F++   +I
Sbjct: 408 KNGDT-----------------VLLSPACASWDQYKCFEDRGDEFITMFEKI 442


>gi|90407782|ref|ZP_01215960.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Psychromonas
           sp. CNPT3]
 gi|90311142|gb|EAS39249.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Psychromonas
           sp. CNPT3]
          Length = 445

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 136/454 (29%), Positives = 230/454 (50%), Gaps = 33/454 (7%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFREIPWSIISF- 67
           +AV G G+SG+S+   L  +G  V  +D  +HP  V +  D  +E+         +++F 
Sbjct: 6   VAVIGAGKSGISSVNFLLRAGYQVSLFDTREHPPGVDKL-DARVELFCGPLNASFLVNFK 64

Query: 68  -LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL-QSPFIAVTGTNGKS 125
            LV+SPGIAL    A   ++       E+IGDIELF R  +  S   +  + +TG+NGK+
Sbjct: 65  LLVVSPGIAL----ATPALQQVKDAGCELIGDIELFARVLKTPSYAHAKVVTITGSNGKT 120

Query: 126 STVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIECSSYQIELTPTIDPSIG 184
           +  +L+  +   +  +V +GGNIG P L+L    PN   Y++E SS+Q+E T +++  I 
Sbjct: 121 TVTSLLGEMASASPLNVAIGGNIGTPALDL--LDPNINLYILELSSFQLETTTSLNADIA 178

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRIS 244
            +LNIS DHLDR+ + ++Y+  K  I    K A+  I D Q + ++  ++ I        
Sbjct: 179 TILNISADHLDRYRSYDHYIQSKHIIYQQCKKALFNIEDAQTKPLSCALDQICFGAENAD 238

Query: 245 SQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVVCMQLGLKVEEI 302
            Q ++ +++ +I       S  SE + +    + + +HN  N + +  +   +GL    +
Sbjct: 239 FQLVKQNNETFI-------SMGSETLLNVKKLKLSGRHNWMNALAALALGDAVGLDKNIM 291

Query: 303 KRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR----RIYWIAGGLS 358
              L +  GL HR + +A++  V +INDSK TN+ +   A +   +    +++ I GG  
Sbjct: 292 LAVLENYQGLEHRCEFVAQVHGVRWINDSKGTNVGATQAALMGLSQSISGKVHVILGGQG 351

Query: 359 KSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           K  DFS L P  +++    F  G  A L        ++  + +  D A ++V    +   
Sbjct: 352 KGADFSLLRPVFNEVQGDIFCFGEDAALI-----ASVDPRIQRVDDLA-QAVCLAEQAAT 405

Query: 418 LPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              IV+FSP CAS D Y NF +RG  F + V+ +
Sbjct: 406 AGDIVMFSPACASLDMYKNFMQRGDHFKTLVNAL 439


>gi|145630236|ref|ZP_01786018.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae R3021]
 gi|144984517|gb|EDJ91940.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae R3021]
          Length = 437

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 233/456 (51%), Gaps = 41/456 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI     P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKKPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAATVLNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q   +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLAHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           ++ + GG  K  DFS L   I++     Y  G    L    F  +  S L +T++QA++ 
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGAL-LAKFSSQ--SYLFETMEQAIEF 396

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +      +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 397 L---RPTLQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|227356426|ref|ZP_03840814.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Proteus mirabilis
           ATCC 29906]
 gi|227163536|gb|EEI48457.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Proteus mirabilis
           ATCC 29906]
          Length = 436

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 228/463 (49%), Gaps = 42/463 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++   + + GLG +GLS        GV   VI    HP  + K   D+      F +
Sbjct: 1   MANYQGKKVVIVGLGITGLSCVDFFIRQGVTPKVIDTRQHPAGLDKLPADVEYHTGSFHQ 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
           +  +    +V SPGIAL+       +  A    VEI+GDIELF RE +     +P +A+T
Sbjct: 61  VWLNDADLIVSSPGIALSTPE----LVEARDHGVEIVGDIELFCREAK-----APIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + + +G  V +GGNIG+P L L    P   YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKADGIPVGVGGNIGVPALTL-LTQPYDLYVLELSSFQLETTYSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIA-YDMNFIG 237
             +   +LNIS DH++R+   LE Y   K +I   +K  +   +D     +A  D   + 
Sbjct: 171 TAAAATVLNISEDHMNRYPLGLEQYREAKLRIYDNAKTCVYNADDVLTLPLAGKDARCVS 230

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
             I +   Q    +++ Y++ +     ATS++       + +HN  N + +  +   +G+
Sbjct: 231 FGIGQGDYQ--LDNTNRYLNVNGENILATSQMFL-----SGQHNYTNALAALALADAVGI 283

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAG 355
             +     L +  GL HR Q +     V +INDSKATN+ S   A   L  +  ++ + G
Sbjct: 284 SRKASLAVLNTYHGLAHRFQLVYSHNGVRWINDSKATNVGSTEAALRGLEVEGTLHLLLG 343

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALKS 408
           G  KS DFS L P++S        G++  L+ F   G  +       S L+ T+++A++ 
Sbjct: 344 GDGKSADFSALLPYLS--------GDNIRLYCFGQDGQALANLRPQVSQLTATMEEAMRL 395

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +      VQ   +VL SP CAS DQ+ +F +RG  F     E+
Sbjct: 396 L---APTVQTGDMVLLSPACASLDQFKSFEQRGDEFARLAQEL 435


>gi|197285919|ref|YP_002151791.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Proteus
           mirabilis HI4320]
 gi|194683406|emb|CAR44151.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Proteus mirabilis
           HI4320]
          Length = 436

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 228/463 (49%), Gaps = 42/463 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++   + + GLG +GLS        GV   VI    HP  + K   D+      F +
Sbjct: 1   MANYQGKKVVIVGLGITGLSCVDFFIRQGVTPKVIDTRQHPAGLDKLPADVEYHTGSFHQ 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
           +  +    +V SPGIAL+       +  A    VEI+GDIELF RE +     +P +A+T
Sbjct: 61  VWLNDADLIVSSPGIALSTPE----LVEARDHGVEIVGDIELFCREAK-----APIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + + +G  V +GGNIG+P L L    P   YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKADGIPVGVGGNIGVPALTL-LTQPYDLYVLELSSFQLETTYSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIA-YDMNFIG 237
             +   +LNIS DH++R+   LE Y   K +I   +K  +   +D     +A  D   + 
Sbjct: 171 TAAAATVLNISEDHMNRYPLGLEQYREAKLRIYDNAKTCVYNADDVLTLPLAGKDARCVS 230

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
             I +   Q    +++ Y++ +     ATS++       + +HN  N + +  +   +G+
Sbjct: 231 FGIGQGDYQ--LDNTNRYLNVNGENLLATSQMFL-----SGQHNYTNALAALALADAVGI 283

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAG 355
             +     L +  GL HR Q +     V +INDSKATN+ S   A   L  +  ++ + G
Sbjct: 284 SRKASLAVLNTYHGLAHRFQLVYSHNGVRWINDSKATNVGSTEAALRGLEVEGTLHLLLG 343

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALKS 408
           G  KS DFS L P++S        G++  L+ F   G  +       S L+ T+++A++ 
Sbjct: 344 GDGKSADFSALLPYLS--------GDNIRLYCFGQDGQALANLRPQVSQLTATMEEAMRL 395

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +      VQ   +VL SP CAS DQ+ +F +RG  F     E+
Sbjct: 396 L---APTVQTGDMVLLSPACASLDQFKSFEQRGDEFARLAQEL 435


>gi|269468117|gb|EEZ79827.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [uncultured SUP05
           cluster bacterium]
          Length = 434

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 227/458 (49%), Gaps = 47/458 (10%)

Query: 13  VFGLGRSGLSAA---------CALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           V GLG +GLS A           L DS ++    DD+   V++       + D+++   +
Sbjct: 4   VLGLGDTGLSIARFLSKQHIAYRLADSRLNPPMLDDY---VEEFPGSIPVLGDWKQALLA 60

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
            +  + +SPGIA T     W    A   N+ ++ DIELF    RF  +++P I +TG+NG
Sbjct: 61  DVDEVFISPGIAQTQSIVIW----ARDKNIPVVSDIELF---SRF--VKAPVIGITGSNG 111

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+   L+  ++  +   V +GGNIG P L+        +YV+E SSYQ++ T  +    
Sbjct: 112 KSTVTQLLGDMITNSDKKVAVGGNIGKPALDC-LDDQIDYYVLELSSYQLDYTNQLKLLT 170

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND------HQCEKIAYDMNFIG 237
           GV+LNI+PDHLDR+ + ++Y + K  +    +  ++ +++      +  +    DM    
Sbjct: 171 GVVLNITPDHLDRYDSFDDYTDSKLSLYRYCQDLVVNLDEVIVPKKNNAKHFGIDMPKRA 230

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
                ++          Y+ +      + SE+     Q   +HN+ N++ +  +  Q+GL
Sbjct: 231 DDFGTVTCH-----GSCYLIKGDDVVMSVSEM-----QLIGEHNVANMLAALALGDQIGL 280

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH---AFLNEKRRIYWIA 354
            VE + +++ +  GL HRL+ +A+   V + NDSKATN  S I    A +++   I  IA
Sbjct: 281 SVELMAQSIKNFKGLEHRLEWVAKKQGVDYYNDSKATNSISTIQALKALIDKHENIVLIA 340

Query: 355 GGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           GG++K +D+S +F  I + +     IG SA      FG  +N     +  Q +   V   
Sbjct: 341 GGIAKEEDYSVMFKLIDENVFGVVLIGQSAA----DFGQSLNRP-QVSYAQTMSEAVNLA 395

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             +    +++ SP CASFD + NF ERG +F  QV E+
Sbjct: 396 SGMLNDGVIVLSPACASFDMFANFEERGQAFKDQVFEL 433


>gi|325142974|gb|EGC65331.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis 961-5945]
 gi|325198898|gb|ADY94354.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis G2136]
          Length = 445

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 223/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNSDDVFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL   E+   + +  GL HR++ I +   V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPRNELLEHVKTFQGLPHRVEKIGKKNGVVFIDDSKGTNVGATAAAITGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A++ 
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQK 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|261391934|emb|CAX49396.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase
           (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase;
           D-glutamic acid adding enzyme) [Neisseria meningitidis
           8013]
          Length = 445

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 223/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNSDDVFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I +   V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGKKNGVVFIDDSKGTNVGATAAAITGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A++ 
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQK 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|145641278|ref|ZP_01796858.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae R3021]
 gi|145274115|gb|EDK13981.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 22.4-21]
          Length = 437

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 234/456 (51%), Gaps = 41/456 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTLE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAATVLNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q   +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLAHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           ++ + GG  K  DFS L   I++     Y  G    L    F  +  S L +T++QA++ 
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGAL-LAKFSSQ--SYLFETMEQAIEF 396

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +      +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 397 L---RPTLQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|301169876|emb|CBW29480.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Haemophilus
           influenzae 10810]
          Length = 437

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 137/467 (29%), Positives = 242/467 (51%), Gaps = 51/467 (10%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  K++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPKNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   ++  ++   D    K+ +     G 
Sbjct: 170 LKAAAATVLNVTEDHMDRYVDLEDYRQAKLRIYHNAEVGVLNNED----KLTFGE---GE 222

Query: 239 SISRISSQSLQSDSDLYIDESFLK--CSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQ 294
           + ++ +    ++ +D ++     K    A  EVI    + T   +HN  N++ +  +   
Sbjct: 223 NQAKQTVSFAENSADYWLKTENGKQYLMAKDEVILPCEEVTLVGRHNYMNILAATALAQA 282

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYW 352
           +G+ ++ I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L  + +++ 
Sbjct: 283 VGINLDAIRTALCHFKGLDHRFQLAHQANGVRWINDSKATNVGSTVAALAGLYVEGKLHL 342

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG------GKINST--LSKTLDQ 404
           + GG  K  DFS L   I          N   +  + FG       K++S   L +T++Q
Sbjct: 343 LLGGDGKGADFSELAELI----------NQPQIICYCFGRDGAQLAKLSSQSHLFETMEQ 392

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVS 449
           A+ + +R +  +Q   +VL SP CAS DQ+ +F +RG  F+ ++Q S
Sbjct: 393 AI-AFLRPI--LQSGDMVLLSPACASLDQFASFEKRGEEFTRLAQCS 436


>gi|260435255|ref|ZP_05789225.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           WH 8109]
 gi|260413129|gb|EEX06425.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           WH 8109]
          Length = 461

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 141/469 (30%), Positives = 232/469 (49%), Gaps = 47/469 (10%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDM---GIEVIDFREIPWSIISF 67
           V GLGRSGL AA  LK     V+ ++  D+      +K +   GI V+  +  P ++ SF
Sbjct: 6   VVGLGRSGLGAARLLKQQNRDVVVFERGDNEALQHTSKTLAEEGIRVVLGQ--PLALESF 63

Query: 68  ---------LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIA 117
                    +V+ PGI          V+L ++  +++ G+++L      + +LQ  P+I 
Sbjct: 64  NDWRNNLGAVVIGPGIPWDHPT---LVQLRSE-GIKVRGEMDLA-----WDALQQIPWIG 114

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEY-----FSPNR-FYVIECSSY 171
           +TGTNGK++   L+SHVL  +G    +GGN+GL   +L +      +P   + V+E SSY
Sbjct: 115 ITGTNGKTTVTHLLSHVLEASGLTAPMGGNMGLSAADLAFQIGSGATPRPDWLVMELSSY 174

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH--QCEKI 229
           QIE  P + P IG+   ++PDHL+RH +LE Y  IK+ ++  S+ A+   +D   + ++ 
Sbjct: 175 QIEAAPAVAPKIGIWTTLTPDHLERHGSLEAYRAIKRGLLERSECALFNADDPDLRQQRR 234

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYID-ESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           ++D    G  +S   ++     +DL+ID E  ++ +AT     D      +HN QNL+  
Sbjct: 235 SWDR---GTWVSSEGARPDDQPADLWIDDEGMVRNNATRLFAADALAMPGRHNRQNLLLV 291

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR 348
           A   +++GL  ++I  AL +  G+ HRL+ +  L      NDSKATN  +   A    + 
Sbjct: 292 AAASLKVGLSPQQIADALRTFPGVPHRLEKLGTLAGASVFNDSKATNYDAAEVALRAVQG 351

Query: 349 RIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSA-----MLFFHHFGGKINSTLSKTL 402
            +  +AGG +K  D       + +K       G  A     +     + G++       L
Sbjct: 352 PVVVLAGGQTKQGDAGGWLEQLHTKACSLIVFGAGADELASLAKAAGYPGELQQC--PEL 409

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           + A+      V+  Q  S +L SP CASFDQY +F  RG  F + +  +
Sbjct: 410 ESAVNLAETAVQRHQA-STLLLSPACASFDQYRDFEARGEHFRTLIQPL 457


>gi|86605662|ref|YP_474425.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. JA-3-3Ab]
 gi|118595697|sp|Q2JVR9|MURD_SYNJA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|86554204|gb|ABC99162.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           JA-3-3Ab]
          Length = 469

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 148/470 (31%), Positives = 234/470 (49%), Gaps = 52/470 (11%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAV---KQAK--DMGIEV---IDFREIPWSI 64
           V GLG +G SAA  L+  G  V  WD+    +   +QA+    GI V     F+ +P   
Sbjct: 5   VLGLGIAGWSAARLLRAQGKEVWVWDEQDSELLRQRQAELEREGIPVHLGQPFQLLP--G 62

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIAVTGTNG 123
           +  +V+SPGIA      H  ++ A +  +E++G+ EL      +  L+  P++ +TGTNG
Sbjct: 63  VKQVVVSPGIAWD----HPLLQEARRQGIEVVGEAELA-----WPFLEHLPWVGITGTNG 113

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPI--LNLEYFSPNR---FYVIECSSYQIELT-- 176
           KS+T AL++ + +  G +    GNIGLP+  + LE +   R   + V E SSYQ+E +  
Sbjct: 114 KSTTTALVAEMFKVAGLEGIPCGNIGLPLSQVALETWQGRRQPAWIVAELSSYQLEASRH 173

Query: 177 -----PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAY 231
                P   P IGV    +PDHL+RH TLE Y   K +++  ++  ++   D    +   
Sbjct: 174 LMQSSPGSPPRIGVWTTFTPDHLERHGTLERYAGFKARLLQRAQWRVVNGEDPYLFRRRQ 233

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK-KHNIQNLVTSAV 290
           D      +   +S Q  Q+D  L     +++  A +E + DF++     HN+QNL+ +A 
Sbjct: 234 DWE----NTYWVSLQDPQADVFLRGSTLYIQGEAVAE-LEDFAERCPGSHNLQNLLLAAA 288

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARL----GHVIFINDSKATNLHSVIHAFLNE 346
                G+    I+ A+ S  G+ HRL+ +A++      + F+NDSKATN  +   A    
Sbjct: 289 AAHLAGIPNTAIQGAIRSFAGMPHRLERVAQIQVGSTPIRFVNDSKATNYEAGWVALNAL 348

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLF------FHHFGGKINSTLS 399
              I  IAGG +K  D S     I +K+A+   IG +A           +   +I  TL 
Sbjct: 349 SPPIILIAGGRAKQGDPSAWLRLIQAKVARVLLIGEAAPALAQALQEIRYTDLEILPTLD 408

Query: 400 KTLDQALK---SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
             +++A     S+ + ++N   P  VL SP CASFDQY++F  RG  F +
Sbjct: 409 VAVERAFVAACSLAQALDNPAQPITVLLSPACASFDQYSSFEHRGHHFRA 458


>gi|226313426|ref|YP_002773320.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brevibacillus
           brevis NBRC 100599]
 gi|226096374|dbj|BAH44816.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Brevibacillus
           brevis NBRC 100599]
          Length = 454

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 132/460 (28%), Positives = 216/460 (46%), Gaps = 34/460 (7%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP----CAVKQAKDMGIEVI---DFR 58
           F N  + V G+ +SG++ A  L   G HV+  D  P      V++ + +GI VI      
Sbjct: 4   FHNKHVVVIGMAKSGVAVAKLLHRFGAHVVVNDKKPREEAVGVEELESLGIPVICGYHPD 63

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           ++    +S +V +PGI          VK A    + ++ ++EL  +  +     +P I +
Sbjct: 64  DLIHEGVSLVVKNPGIPYEAAP----VKQAQALGIPVVTEVELASQIAK-----APIIGI 114

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIELTP 177
           TG+NGK++T  L+  + ++ G D ++GGNIG  +  L E   P+ + V E SS+Q+  T 
Sbjct: 115 TGSNGKTTTTTLVGLIFKEAGLDAKVGGNIGTVLCGLAEEAGPDEWLVAELSSFQLMGTR 174

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICIND----HQCEKIA 230
              P IGVLLN+ P HLD HHT+E Y+  K K+    T    AI+  +      +C+ + 
Sbjct: 175 KFRPHIGVLLNLYPAHLDYHHTMEEYLAAKLKMFANQTADDAAILPYDQPEIVEKCKDLP 234

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
             + +   S   +   +   D  +     F   +  +E I   +  T  H + N + + +
Sbjct: 235 ASIYYFSKS-QEVPKGAFVKDGLIL----FADGNGNTEPIVAIADITVPH-LDNALAAIL 288

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           V    G   + I + L +  G+ HR++ +  +  V + NDSKATN  +   A    K  +
Sbjct: 289 VAKLAGADKQSIIQVLTTFPGVEHRMEFVDSIRGVKYFNDSKATNPEAASRALQACKEPV 348

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFG-GKINSTLSKTLDQALKS 408
            WI GGL +  DF  L P I    KA   +G +A +         IN  +   +D   K+
Sbjct: 349 VWICGGLDRGVDFRELLPVIQGRVKAVIALGQTAPILLERAQEAGINERIH--VDTVEKA 406

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           V+   +  +   +VL SP CAS+D + +F  RG  F   V
Sbjct: 407 VLAASQLAESGDVVLLSPACASWDMFPSFETRGSMFKDGV 446


>gi|261867478|ref|YP_003255400.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261412810|gb|ACX82181.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 434

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 139/468 (29%), Positives = 233/468 (49%), Gaps = 60/468 (12%)

Query: 6   FRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQA-KDMGIEVIDFREIPW 62
           +++  + V GLG++GLS    L  K + V VI    HP   +Q  K + +      +  W
Sbjct: 3   YQDKKVTVIGLGKTGLSCVDFLRAKQADVRVIDTRQHPAGAEQLDKAIPLHTGGLNQ-QW 61

Query: 63  SIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            + S  +V+SPG+A+        ++ A Q  VE++GDIELF RE        P +A+TG+
Sbjct: 62  LLESDLIVISPGLAVKTPE----IQTALQAGVEVVGDIELFCREA-----DKPIVAITGS 112

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+   L++ + +  G  V +GGNIG+P L+L     +  YV+E SS+Q+E T ++  
Sbjct: 113 NGKSTVTTLVAEMAKAAGLRVGMGGNIGIPALSL-LNQQHDLYVLELSSFQLETTYSLKA 171

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--------HQCEKIAYDM 233
               +LN++ DH++R+  L++Y + K  I    + A+I   D           +++++  
Sbjct: 172 VAATVLNVTEDHMNRYVDLQDYRHAKLNIYNHCQTAVINAEDALTLPTTQRPQKQVSFGE 231

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
           N   + +   ++++      +  DE+ L C        D  + T +HN  N + +  +  
Sbjct: 232 NHADYWLKTENNKTYL----MAYDEAVLAC--------DEMKLTGRHNYMNALAAIALAQ 279

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIY 351
             G+ +  I+ AL + GGL HR Q       V +INDSKATN+ S + A   L    +++
Sbjct: 280 AAGINLTGIRTALCAFGGLEHRFQVAHIADGVRWINDSKATNVGSTVAALTGLQVAGKLH 339

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLSK------TLD 403
            + GG  K  DFS L   I          N   ++ + FG  GK  + LS       T++
Sbjct: 340 LLLGGDGKGADFSELARLI----------NQPHIYCYCFGRDGKQLAALSSQSQLFDTME 389

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVS 449
            A+ ++      +Q   +VL SP CAS DQ++ F  RG  F+ +S++S
Sbjct: 390 HAIAAI---RPQLQAGDMVLLSPACASLDQFSCFEARGDEFTRLSRLS 434


>gi|325132966|gb|EGC55643.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis M6190]
 gi|325138954|gb|EGC61504.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis ES14902]
          Length = 445

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 132/458 (28%), Positives = 220/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVI----DFR 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++      +
Sbjct: 2   TFQNQKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDVFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLF-PFISKIAKAYFIGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L    + K    + IG  A        G  +N T   TL++A+++
Sbjct: 346 FVILGGMGKGQDFTPLRDALVGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQT 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|145627896|ref|ZP_01783697.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 22.1-21]
 gi|145639344|ref|ZP_01794950.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittII]
 gi|144979671|gb|EDJ89330.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 22.1-21]
 gi|145271647|gb|EDK11558.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittII]
 gi|309751218|gb|ADO81202.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Haemophilus
           influenzae R2866]
          Length = 437

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 134/457 (29%), Positives = 237/457 (51%), Gaps = 43/457 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----TATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAVTVLNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q + +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLVHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISK--IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
           ++ + GG  K  DFS L   I++  I    F  + A L    F  +  S L +T++QA++
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGAQL--AKFSSQ--SYLFETMEQAIE 395

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
            +      +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 396 FL---RPTLQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|148828296|ref|YP_001293049.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittGG]
 gi|166224763|sp|A5UIR0|MURD_HAEIG RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|148719538|gb|ABR00666.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittGG]
          Length = 437

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 136/464 (29%), Positives = 242/464 (52%), Gaps = 45/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAVTVLNVTEDHMDRYMDLEDYRQAKLRIHHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q + +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLVHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISK--IAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
           ++ + GG  K  DFS L   I++  I    F  + A L    F  +  S L +T++QA++
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGAQL--AKFSSQ--SYLFETMEQAIE 395

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVS 449
            +      +Q   +VL SP CAS DQ+ +F +RG  F+ ++Q S
Sbjct: 396 FL---RPTLQSGDMVLLSPACASLDQFASFEKRGEEFTHLAQYS 436


>gi|260063714|ref|YP_003196794.1| putative UDP-N-acetylmuramoylalanine--D-glutamate ligase
           [Robiginitalea biformata HTCC2501]
 gi|88783159|gb|EAR14332.1| putative UDP-N-acetylmuramoylalanine--D-glutamate ligase
           [Robiginitalea biformata HTCC2501]
          Length = 464

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 218/458 (47%), Gaps = 32/458 (6%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFL-- 68
           +AV G G SG+ AA   K  G  V   D+ P A K    +    I + E   S    L  
Sbjct: 22  LAVLGAGESGVGAALLGKQKGFEVFVSDNGPIAEKYRDVLNQTGILWEEGGHSESRILDS 81

Query: 69  ---VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAVTGTNG 123
              V SPGI  T       V       V +I +IE       F+S   Q+  +A+TG+NG
Sbjct: 82  DLCVKSPGIPDTAPLVEQLVARG----VPVISEIE-------FASWYCQATLVAITGSNG 130

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           K++T  L  H+LR+ G D  L GNIG     +     +  YV+E SS+Q++      P I
Sbjct: 131 KTTTAMLTHHLLRQGGMDAALAGNIGDSFAAMVARESHPCYVLEVSSFQLDGILGFRPHI 190

Query: 184 GVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
            V+ NI+PDHLDR+ + ++ Y+  KK+I      +   + D     +A ++N    + + 
Sbjct: 191 AVITNITPDHLDRYEYRMDRYIASKKRIAENQGPSDFLVFDRDDPVLAREINPEAFA-AN 249

Query: 243 ISSQSLQSDSDL--YIDESFLKCSATSE-VIFDFSQET----KKHNIQNLVTSAVVCMQL 295
           +   +L+ D     ++  + +      E      S +T     +HN++N + +A V   L
Sbjct: 250 LLPLTLEEDPGAAGWLKGNDINIQLEKENTPLTMSNDTLALEGRHNMKNTMAAATVARLL 309

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G++ E I+ ++ +  G  HRL+ + ++ HV +INDSKATN+++  +A  +      WI G
Sbjct: 310 GIRKESIRESVANFQGAPHRLERVLKIHHVQYINDSKATNVNATFYALDSMTAPTVWIVG 369

Query: 356 GLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTL-SKTLDQALKSVVRDV 413
           G+ K +D+  L P + +  KA   +G         FG  ++  + +  + +A+K   +  
Sbjct: 370 GVDKGNDYKPLMPLVREKVKAIICLGADNSRIVEAFGNAVDLLVETYAMSEAVKVAYKIA 429

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           E       VL SP CASFD + N+ +RG  F   V  +
Sbjct: 430 ER---GDNVLLSPACASFDLFKNYEDRGDQFKDAVKAL 464


>gi|222528782|ref|YP_002572664.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Caldicellulosiruptor bescii DSM 6725]
 gi|254766034|sp|B9MQ99|MURD_ANATD RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|222455629|gb|ACM59891.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 457

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 145/472 (30%), Positives = 240/472 (50%), Gaps = 48/472 (10%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-VKQAKDMGIEVID---FREIP 61
            +  ++ V GLGRSGL++A  LK  G  VI +D+      K+ K+   +++D   + EIP
Sbjct: 3   LKGKNVLVVGLGRSGLASARFLKKHGAFVIGFDEKAEEQFKEEKNDAQKLLDEIYYCEIP 62

Query: 62  WSII---SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
              I     +++SPG+ L+       + LA++  +E+IG+IEL  R  +  ++    +A+
Sbjct: 63  DEFIDRVQLVIVSPGVPLS----KRPLVLAHKKGIEVIGEIELAYRFCKSKNI----VAI 114

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELTP 177
           TGTNGK++T  L+  +L+K   DV + GNIGLP ++ +E  S +  +V+E SS+Q+E   
Sbjct: 115 TGTNGKTTTTTLVGEILKKQYEDVVVCGNIGLPFIDTIETSSEDTIFVLEISSFQLETIK 174

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN--- 234
              P IG +LNI+PDHL+RH T+ENY   K +I          I++     + YD N   
Sbjct: 175 YFKPKIGCILNITPDHLNRHLTMENYTKAKMRIFE-------NIDEMGYTVLNYDNNITR 227

Query: 235 -FIGHSISRI---SSQSLQSDSDLYIDES---FLKCSATSEV-----IFDFSQETKKHNI 282
             IG +   +   S    Q ++ ++++     F     T EV     IF   Q    HN+
Sbjct: 228 DLIGLAKGNVIVFSKTKTQFENVVFVENDVIYFTFEGKTQEVMKKDEIFIPGQ----HNL 283

Query: 283 QNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA 342
           +N + +    +  G++ + I++ L +  G+ HR++ +A +  + F NDSK TN  +   A
Sbjct: 284 ENALAAISCTLPFGIEKDTIEQVLKTFRGVEHRIEFVAEINGIKFYNDSKGTNTDAAEKA 343

Query: 343 FLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFG--GKINSTLS 399
               +  I  IAGG  K + F      ++ K+ K + +G +           G  N    
Sbjct: 344 LNAFENPIILIAGGYDKGESFEKFASLVAKKVKKVFLLGQTKQKIASELERIGYKNFEFV 403

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            TL +A++   +  E  Q   IVL SP CAS+D + N+ +RG  F   V+E+
Sbjct: 404 STLKEAVR---KSFECAQNGDIVLLSPACASWDMFENYEQRGRMFKEYVNEL 452


>gi|291616270|ref|YP_003519012.1| MurD [Pantoea ananatis LMG 20103]
 gi|291151300|gb|ADD75884.1| MurD [Pantoea ananatis LMG 20103]
          Length = 438

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 138/464 (29%), Positives = 216/464 (46%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ +R   + + GLG +GLS        GV     D    P  + +  +     +     
Sbjct: 1   MADYRGRKVVIIGLGLTGLSCVDFFVAQGVTPRVMDTRMSPPGLDKLPEQVERYVGGINS 60

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + +  +V SPGIAL    AH  +  A    +EI+GDIELF RE      Q+  +A+T
Sbjct: 61  DWLLAADLIVASPGIAL----AHPALCEAADAGIEIVGDIELFCRE-----AQASIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G+ V +GGNIGLP L+L   +P + YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGWQVGVGGNIGLPALSL-LKAPAQLYVLELSSFQLETTHSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN++ DH+DR+   ++ Y   K +I   ++  ++  +D         M   G 
Sbjct: 171 KAAAATILNVTEDHMDRYPLGMQQYRAAKLRIYENAQVCVVNADD------GMTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +   A  E + +  + T   +HN  N + +  +   +G
Sbjct: 225 DARCVSFGIDIGDYHLNKQQGSIWLRAKGEKVLNTDEMTLVGQHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L       AL +  GL HR Q + +   V +INDSKATN+ S   A   L     ++ + 
Sbjct: 285 LPRSTSLSALAAYSGLPHRFQLVHQSRGVRWINDSKATNVGSTEAALKGLQVNGTLWLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL-------SKTLDQALK 407
           GG  KS DFS L          Y  G+   L+     G   + L       + TL QA++
Sbjct: 345 GGDGKSADFSPL--------ATYLQGDRIRLYCFGRDGDALAALRPDVAVRTDTLQQAME 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            + R    VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QIAR---QVQPDDMVLLSPACASLDQFRNFEQRGDVFAQLAREL 437


>gi|330813732|ref|YP_004357971.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327486827|gb|AEA81232.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 428

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 141/450 (31%), Positives = 219/450 (48%), Gaps = 49/450 (10%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDD---HPCAVKQAKDMGIEVIDFRE 59
           +SS +N  I VFG+G SG +    L+     +  WDD   H   +K+  ++ +    F++
Sbjct: 4   ISSLKNKKILVFGIGISGQATIRKLQKKVKDLSVWDDNVVHRNRLKKITNINLNSKYFKD 63

Query: 60  IPWSIISFLVLSPGIALTGE-NAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
                  F+V+SPGI +     + + +K    F+ +II D+++F+      + ++  IA+
Sbjct: 64  S----FDFIVMSPGIDIYQHLRSSFFIK---NFS-KIITDVDIFINS--IDTNKNKIIAI 113

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGKS+   L+ H ++    +  L GN G P L+    S    Y++E SSYQIE +  
Sbjct: 114 TGTNGKSTFCKLLYHAIKGKDKNTFLLGNYGKPALSYNSKSIKNIYILELSSYQIEYSKF 173

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG- 237
           +      +LNISPDHL+RH T  NY+NIK KI     H +        E  +Y+ N I  
Sbjct: 174 LKFHACAVLNISPDHLERHKTFSNYINIKLKIFD---HLLPGGKGFVNENFSYN-NRIQP 229

Query: 238 ----HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
                 +S I + ++Q  +   + E+FL   +    +  F                    
Sbjct: 230 KKNVRKVSNIKTSNIQ--NKFLLKENFLPSVSIVFAVLKF-------------------- 267

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
            L +  + I ++  S   L HR + I ++ ++ FINDSKATN  S   + L   + IYWI
Sbjct: 268 -LKISNKLIIKSFNSFVPLPHRQELIKKIKNISFINDSKATNFDSANFS-LKHYQNIYWI 325

Query: 354 AGGLSKSDDFSTL-FPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           AGGL+K +D + +      KI   Y IG +  LF      K N  + KTL  A+ S  +D
Sbjct: 326 AGGLAKKNDKAKIDIATKKKIVGTYLIGKNISLFKQGLNMKENYLVCKTLPVAIHSAFKD 385

Query: 413 VENVQLP-SIVLFSPGCASFDQYNNFRERG 441
            +      S +L SP  ASFDQ+ NF++RG
Sbjct: 386 AKRNNFKNSTILLSPAAASFDQFRNFKDRG 415


>gi|269101758|ref|ZP_06154455.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161656|gb|EEZ40152.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 447

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 140/467 (29%), Positives = 217/467 (46%), Gaps = 61/467 (13%)

Query: 9   HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP------- 61
           + + V GLG +GLS                +H   + Q+ D  I+VID R  P       
Sbjct: 8   NKVVVIGLGMTGLSVV--------------NHLLRLPQSLD--IKVIDTRNTPPGHDQLP 51

Query: 62  ---------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR 107
                    W++        +V SPGIAL        +  A Q  VEI+GDIELF RE  
Sbjct: 52  ADVELCCGQWNMEWLLAADLIVASPGIALATPE----LVTAAQAGVEIVGDIELFARE-- 105

Query: 108 FSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIE 167
              +  P +A+TG+NGKS+  +L+  + ++ G DV +GGNIG   L++     +  YV+E
Sbjct: 106 ---VTKPVVAITGSNGKSTVTSLVGEMAKEAGIDVGVGGNIGFAALDM-LAQNHELYVLE 161

Query: 168 CSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCE 227
            SS+Q+E T ++  +  V LN+S DH+DR+  LE+Y   K +I   +  A+   ND   +
Sbjct: 162 LSSFQLETTSSLHLAAAVYLNLSEDHMDRYQGLEDYSQAKMRIFHHANLAVYNRNDLATK 221

Query: 228 KIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
                 +F G +++            L  D  +L  +    +  D      +HN+ N + 
Sbjct: 222 PT----DFTG-AMTSFGFDDQDYGLVLIDDREWLAINQQPLMPADEIALVGRHNVANSLA 276

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LN 345
           +  +    G+  E   RAL    GL HR Q       V ++NDSKATN+ S   A   LN
Sbjct: 277 ALALADAAGIDREAACRALRRYTGLAHRCQLAVTKHGVRWVNDSKATNVASTEAALNGLN 336

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ 404
              +++ + GG  K  DFS L   ++ +  + Y  G     F        N+ L +T+ Q
Sbjct: 337 LAGKLHLLVGGDGKGADFSELKTVLADLNVQLYCFGRDGYQFAELVD---NAILVETMAQ 393

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           A++         Q   ++L SP CAS+DQ+ NF  RG +F+   +E+
Sbjct: 394 AMELA---ASTAQSGDMILLSPACASWDQFANFMARGDAFIELATEL 437


>gi|325128836|gb|EGC51695.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis N1568]
          Length = 445

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 222/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNSDDVFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A++ 
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQK 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|33861920|ref|NP_893481.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
 gi|60390532|sp|Q7V0A5|MURD_PROMP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|33640288|emb|CAE19823.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus subsp. pastoris str. CCMP1986]
          Length = 473

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 148/468 (31%), Positives = 225/468 (48%), Gaps = 33/468 (7%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID----------FREIPW 62
           V GLGRSG  AA  L+  G  VI W+         +   +E +D          F E   
Sbjct: 16  VIGLGRSGFWAAKYLRSIGKRVIVWESKENKELLERKKILEKLDISVCLNKQFLFDEFYK 75

Query: 63  SI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIAVT 119
            +  I  +V+SP I       H  +    +  + +IG+I +      + SL++  +I +T
Sbjct: 76  FLRQIESIVVSPAIPFD----HKTIIKLKERGIVVIGEINI-----AWESLKNINWIGIT 126

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQIEL- 175
           GTNGK++   L+SH+LR+N       GNIG P+  + Y + ++   + V E SS+QIE+ 
Sbjct: 127 GTNGKTTVTHLLSHILRENNLFAPFAGNIGTPLCEIAYSTKSKNIDWIVAELSSFQIEIA 186

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF 235
           T  I P IG+    +PDHLDRH TL+NY  IK  ++  S+  I   +D Q  K  +    
Sbjct: 187 THCIKPKIGIWTTFTPDHLDRHKTLDNYFKIKNSLLKQSEFRIYNYDD-QYLKENFKSLL 245

Query: 236 IGHSISRISSQSLQSDSDLYID-ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
            G  I+   + S     D +I+ E+F+       +     +    HN QNL+ +     +
Sbjct: 246 NGIWITTNPNVSDSDHCDYWINNENFIVERREKLLSLKNFKLKGNHNTQNLLLAVAAARK 305

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           +GL  E IK ALLS   L HR++TI +   +  INDSKATN  S +      K     I+
Sbjct: 306 IGLSTERIKNALLSYEQLPHRMETIFQRDELEIINDSKATNFDSSVAGINAIKGSPIIIS 365

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFI-GNSAMLFFHHF--GGKINSTLS-KTLDQALKSVV 410
           GG  K+ D       I+K AKA F+ G S+         GG  N  L+   L + +    
Sbjct: 366 GGRLKNGDSIEWVKIINKKAKAVFLFGESSQTLKKLILEGGFKNDILTFNDLSEVINYAY 425

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIEMLV 458
             ++N Q  ++ LFSP C+SFDQ+ ++ +RG  F   + E   I+ + 
Sbjct: 426 SYIKNNQSETL-LFSPSCSSFDQFRDYEQRGDIFKKLIYEKFNIKFIA 472


>gi|229846167|ref|ZP_04466279.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 7P49H1]
 gi|229811171|gb|EEP46888.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 7P49H1]
          Length = 437

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 137/466 (29%), Positives = 231/466 (49%), Gaps = 61/466 (13%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  V K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPSGVDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----TATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--------HQCEKIA 230
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++   D        +Q E+I 
Sbjct: 170 LKAAAATVLNVTEDHMDRYVDLEDYRQAKLRIYHNAKVGVLNNEDSLTFGEGENQAEQI- 228

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTS 288
                       +S     +D  L  +       A  EVI    + T   +HN  N++ +
Sbjct: 229 ------------VSFAENGADYWLKTENGKQYLMAKDEVILPCEEATLVGRHNYMNILAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +G+ ++ I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L  
Sbjct: 277 TALAQAVGINLDAIRTALRQFKGLDHRFQLAHQANGVRWINDSKATNVGSTVAALAGLYV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG------GKINST--L 398
           + +++ + GG  K  DFS L   I          N   +  + FG       K++S   L
Sbjct: 337 EGKLHLLLGGDGKGADFSELADLI----------NQPQIICYCFGRDGAQLAKLSSQSYL 386

Query: 399 SKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
            +T++QA++ +      +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 387 FETMEQAIEFL---RPTLQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|206889487|ref|YP_002249134.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase
           [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|206741425|gb|ACI20482.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase
           [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 482

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 140/484 (28%), Positives = 226/484 (46%), Gaps = 42/484 (8%)

Query: 2   KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM-----GIEVID 56
           +LS   N ++AV GLG+SG++A+  L   G  +I  +D     +  KD+      IE I 
Sbjct: 7   ELSELENKTVAVVGLGKSGIAASKLLCSLGAKLI-INDKKSKEEILKDLITVNGKIERII 65

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P   +     +V+SPG+ L+  +    V       + +IG+IEL  +         
Sbjct: 66  GEGHPPEALENADIVVVSPGVPLSTPSIVSAV----YKGIPVIGEIELSWQILSLIKENV 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR-----FYVIEC 168
             I +TG NGKS+T  L    L+++G  VQL GNIG P+  +     N+     + V+E 
Sbjct: 122 KIIGITGANGKSTTSTLTYEFLKRDGKKVQLAGNIGYPMAEVVLKLLNKEIDMEYLVLEL 181

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQ 225
           SS+Q+E   T  P    +LNI+PDH+DR+  ++ Y+  K KI        + I+ ++D  
Sbjct: 182 SSFQLEGIKTFKPDFAAILNITPDHMDRYSDMKEYIEAKAKIFQNQNGDDYLILNMDDEN 241

Query: 226 C-EKIAYDMNFI---GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK-- 279
               I Y  N     G          +Q+    Y+    +  +A  EV  D  +E +   
Sbjct: 242 TISAIEYLRNVYLKKGKLPHVFYFSRVQNVYGAYLKNDSIYFNAREEVSDDIKKEMENTV 301

Query: 280 -----------HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFI 328
                      HN++N++ ++++ +  G K + IK  +    GL HR++ +  +  VI+I
Sbjct: 302 LSVSTFKIKGIHNVENIMAASLLALCSGCKGQSIKDVVQQFPGLPHRMEPVREIDGVIYI 361

Query: 329 NDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFH 388
           NDSK TN+ +V  +  +    +  IAGG  K  DFS L   + +  KA  +   A    H
Sbjct: 362 NDSKGTNVDAVKKSLESFPGNVILIAGGRDKDGDFSALKSIVKEKVKALLLIGEAK---H 418

Query: 389 HFGGKINSTLSKTLDQALKS-VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQ 447
                +   +   L+  +KS V++  E  +   +VL SPGCASFD + NF  RG  F   
Sbjct: 419 KIADALGDLVPCYLESDMKSAVIKAKEIARAGDVVLLSPGCASFDMFKNFEHRGEVFKDI 478

Query: 448 VSEI 451
           V+ +
Sbjct: 479 VNSL 482


>gi|325136987|gb|EGC59584.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis M0579]
 gi|325202769|gb|ADY98223.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis M01-240149]
 gi|325208765|gb|ADZ04217.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis NZ-05/33]
          Length = 445

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 133/458 (29%), Positives = 220/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVI----DFR 58
           +  N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++      +
Sbjct: 2   TLENKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A+++
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEAVQT 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAEAC---DIVLLSPACASFDMFKGYAHRSEVFIE 440


>gi|329118771|ref|ZP_08247469.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327465118|gb|EGF11405.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 450

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 219/456 (48%), Gaps = 35/456 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDD-----HPCAVKQAKDMGIEVIDFR- 58
           +++N  I + G+G SGLS    L   G  + A+D+        A+KQ  D GIE    R 
Sbjct: 7   TWQNKKILIAGMGGSGLSMLAYLHAQGAALAAYDEKLSDERAEALKQQFD-GIECYAGRL 65

Query: 59  -EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPF 115
            +        L LSPGI+   E     ++   Q    ++GDIE+F  +  RR   +    
Sbjct: 66  KDALSQGFDILALSPGIS---ERRDDIIEF-KQNGGRVLGDIEIFAHIANRRGDKI---- 117

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQ 172
           IA+TG+NGK++  +L+ H+  K G D  + GNIG P+L  E     +    +V+E SS+Q
Sbjct: 118 IAITGSNGKTTVTSLVGHLCEKCGLDTVVAGNIGTPVLEAEMQRGGKKAGVWVLELSSFQ 177

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD 232
           +E T ++ PS   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      
Sbjct: 178 LENTESLRPSAAAVLNISEDHLDRYDDLLDYAHTKDKIFRGVGVQVLNADDALCRA---- 233

Query: 233 MNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLVTSAV 290
           M   G  +   S   L+  +D +++    +  A S+ + + +    +  HN  N++ +  
Sbjct: 234 MKRAGRGVKWFS---LEKQADYWLERETGRLKAVSDDLMNTTDIPLQGLHNAANVMAAVA 290

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  EE+ + + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 291 LCEAVGLPREELVKHIQTFKGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAISGLQSPL 350

Query: 351 YWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGK-INSTLSKTLDQALKS 408
           + I GGL K  DF+ L   +  K+     IG  A        G  +N     TL +A+++
Sbjct: 351 FAILGGLGKGQDFTPLAQVLRGKVKAVLLIGRDAPQIRRDLAGAGLNLIDCATLQEAVQT 410

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
                   Q   IVL SP CAS D + N+  R   F
Sbjct: 411 A---YAQAQSGDIVLLSPACASMDMFQNYAHRSQVF 443


>gi|319897397|ref|YP_004135594.1| udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase [Haemophilus
           influenzae F3031]
 gi|317432903|emb|CBY81269.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Haemophilus
           influenzae F3031]
          Length = 437

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 131/455 (28%), Positives = 233/455 (51%), Gaps = 39/455 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----TATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAATVLNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q       + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRTALRHFKGLDHRFQLAHHANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
           ++ + GG  K  DFS L   I++     +      +    F  +  S L +T++QA+ + 
Sbjct: 340 LHLLLGGDGKGADFSELAELINQPHIICYCFGRDGVQLAKFSSQ--SYLFETMEQAI-AF 396

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +R    +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 397 LRPT--LQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|148826251|ref|YP_001291004.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittEE]
 gi|166224762|sp|A5UCX0|MURD_HAEIE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|148716411|gb|ABQ98621.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittEE]
          Length = 437

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 134/455 (29%), Positives = 234/455 (51%), Gaps = 39/455 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI     P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKKPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   ++  ++   D    K+ +     G 
Sbjct: 170 LKAAAATVLNVTEDHMDRYMDLEDYRQAKLRIYHNAEVGVLNNED----KLTFGE---GE 222

Query: 239 SISRISSQSLQSDSDLYIDESFLK--CSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQ 294
           + +R +    ++ +D ++     K       EVI    + T   +HN  N++ +  +   
Sbjct: 223 NQARQTVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLVGRHNYMNILAATALAQA 282

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYW 352
           +G+ ++ I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L  + +++ 
Sbjct: 283 VGINLDAIRTALRHFKGLDHRFQLAHQANGVRWINDSKATNVGSTVAALSGLYVEGKLHL 342

Query: 353 IAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINST--LSKTLDQALKSV 409
           + GG  K  DFS L   I++     Y  G    L       K++S   L +T++QA+ + 
Sbjct: 343 LLGGDGKGADFSELAELINQPHIICYCFGRDGALL-----AKLSSQSYLFETMEQAI-AF 396

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +R    +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 397 LRPT--LQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|68249685|ref|YP_248797.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 86-028NP]
 gi|260581815|ref|ZP_05849611.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Haemophilus
           influenzae NT127]
 gi|81174949|sp|Q4QLG0|MURD_HAEI8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|68057884|gb|AAX88137.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Haemophilus
           influenzae 86-028NP]
 gi|260095008|gb|EEW78900.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Haemophilus
           influenzae NT127]
 gi|309973397|gb|ADO96598.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Haemophilus
           influenzae R2846]
          Length = 437

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 131/467 (28%), Positives = 237/467 (50%), Gaps = 51/467 (10%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI     P  + K  +++ +      +
Sbjct: 1   MNAYQNKNITIIGLGKTGLSCVDYLLSQQANIRVIDTRKKPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        ++ A +  VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPE----IQTALKAGVEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   ++  ++   D    K+ +     G 
Sbjct: 170 LKAAAATVLNVTEDHMDRYMDLEDYRQAKLRIYHNAEVGVLNNED----KLTFGE---GE 222

Query: 239 SISRISSQSLQSDSDLYI------------DESFLKCSATSEVIFDFSQETKKHNIQNLV 286
           + +R +    ++ +D ++            DE  L C   + V         +HN  N++
Sbjct: 223 NQARQTVSFAENSADYWLKTENGKQYLMVKDEVILPCEEVTLV--------GRHNYMNIL 274

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--L 344
            +  +   +G+ ++ I+ AL    GL HR Q + +   + +INDSKATN+ S + A   L
Sbjct: 275 AATALAQAVGINLDSIRTALRHFKGLDHRFQLVHQANGIRWINDSKATNVGSTVAALAGL 334

Query: 345 NEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ 404
             + +++ + GG  K  DFS L   I++     +      +    F  +  S L +T++Q
Sbjct: 335 YIEGKLHLLLGGDGKGADFSELAELINQPHIICYCFGRDGVQLAKFSSQ--SYLFETMEQ 392

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVS 449
           A++ +      +Q   +VL SP CAS DQ+ +F +RG  F+ ++Q S
Sbjct: 393 AIEFL---RPTLQSGDMVLLSPACASLDQFASFEKRGEEFTHLAQYS 436


>gi|256820163|ref|YP_003141442.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Capnocytophaga
           ochracea DSM 7271]
 gi|256581746|gb|ACU92881.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Capnocytophaga
           ochracea DSM 7271]
          Length = 444

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 135/459 (29%), Positives = 223/459 (48%), Gaps = 36/459 (7%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFRE---IPWSIISF 67
           + + G G SG+  A   K  G  V   D         + +  E I + E       I+S 
Sbjct: 4   LVILGGGESGVGTAILGKQKGWEVFLSDKGSLKPHYRETLNKEGIQWEEGTHTEEKILSA 63

Query: 68  LVL--SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAVTGTNG 123
            V+  SPGI     +    +K A++  + +I +IE       F+S    S  + +TG+NG
Sbjct: 64  DVIMKSPGIP----DKAPIIKKAHEKGIAVISEIE-------FASQYTDSLIVGITGSNG 112

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           K++T  L  H+ ++ G  V LGGNIG     L       +YV+E SS+Q++      P I
Sbjct: 113 KTTTTLLTYHIFKEAGLQVGLGGNIGYSFAELVATKNPPYYVLEISSFQLDGIEHFAPHI 172

Query: 184 GVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN-------F 235
            VLLNI+PDHLDR+ +  ENY++ K +I          I D   E I   ++        
Sbjct: 173 AVLLNITPDHLDRYDYKFENYIDSKFRIAMNQTENDYLIYDADDEVITQWLSTHTIKSKL 232

Query: 236 IGHSISR-ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
           I  SI + +   +   D+ +YI    +  + T+E+  +      KHNI+N + ++V    
Sbjct: 233 IPFSIEKELPQGAFLKDNKIYI----MLENQTTEIDVEEISLRGKHNIKNTMAASVAARL 288

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           + ++   ++ +L    G  HRL+ +  +  V ++NDSKATN++SV +A    K  I WI 
Sbjct: 289 VNIRNNSLRESLKGFKGAPHRLEEVKVVDGVTYVNDSKATNVNSVFYALDTIKTPIVWIV 348

Query: 355 GGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKINSTL-SKTLDQALKSVVRD 412
           GG  K +D+++L P++ +  +A   +G         F   I++ + ++++D+A+K     
Sbjct: 349 GGQDKGNDYNSLLPYVHEKVRAIVCLGVDNTPIIQSFYNTIDTLVETRSMDEAVKLAQS- 407

Query: 413 VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
               Q    VL SP CASFD + N+ ERG  F + V ++
Sbjct: 408 --FAQEGDTVLLSPACASFDLFKNYEERGDLFKAAVQKL 444


>gi|146328783|ref|YP_001209872.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Dichelobacter
           nodosus VCS1703A]
 gi|146232253|gb|ABQ13231.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Dichelobacter
           nodosus VCS1703A]
          Length = 436

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 136/460 (29%), Positives = 218/460 (47%), Gaps = 62/460 (13%)

Query: 8   NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISF 67
           N  IAV G+G SG +A   L+ +G  V A+D+    V+ A  + +  +D  +I ++  + 
Sbjct: 13  NQPIAVIGMGVSGKAAWQMLQKAGYDVTAFDEK---VQSAPIVTVN-LDDADI-FTSFAT 67

Query: 68  LVLSPGIALTGENAHWCVKLA-NQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
           L++SPGI         C + A    +  ++ D+ELF R      ++ P  AVTG+NGKS+
Sbjct: 68  LIVSPGID--------CRRTAFKNIHATLMNDVELFAR-----LIEKPVAAVTGSNGKST 114

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILN--LEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
            V +++   R  G   QL GNIG  +L   LE       YV+E SSYQ+E  P++   +G
Sbjct: 115 VVTMLADAARAVGLKTQLCGNIGKSVLTAWLEDEEEPDLYVLELSSYQLERCPSLMIDVG 174

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIA----YDMNFIGHSI 240
           V+LN++PDHLDR+ +  +YV  K  +   ++  I+  +D  C ++A      + F    +
Sbjct: 175 VVLNVTPDHLDRYDSFLDYVAAKSHLAQQTQLTILNGDDEYCRQMAPLSRQTVFFGAQCV 234

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
           +R+ + ++  +    +    LK                +HN  N + + ++   LG+ + 
Sbjct: 235 NRVENGAIIVNGQTVLTADELKIHG-------------QHNAYNALVALLMASGLGIDIS 281

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKS 360
               AL +  GL HR+  +A    V+++NDSKATN+ S   A +   R  + I GG+ K 
Sbjct: 282 YTLEALKNFRGLPHRMCEVACFNDVLWLNDSKATNIASTAAALVGCTRPTWLIVGGVGKG 341

Query: 361 DDFSTLFPFI--SKIAKAYFIG----------NSAMLFFHHFGGKINSTLSKTLDQALKS 408
            DF  L   +  + I     IG            A + FH  G     T+   +  A   
Sbjct: 342 QDFHQLAAVLLQAPIKHVLMIGVDNHTMIAAFKKANIAFHDCG-----TIKAAVSYAY-- 394

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
                +N      VL SP  ASFDQ+ N+ ERG  F  +V
Sbjct: 395 -----QNADAGDQVLLSPATASFDQFRNYEERGDVFADEV 429


>gi|124022231|ref|YP_001016538.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. MIT 9303]
 gi|123962517|gb|ABM77273.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9303]
          Length = 460

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 144/466 (30%), Positives = 221/466 (47%), Gaps = 45/466 (9%)

Query: 13  VFGLGRSGLSAACALKDSG--VHVIAWDDHPCAVKQAKDMGIEVIDFRE---------IP 61
           V GLGRSG+SAA  L+  G  V V+     P     A D+ ++ I             IP
Sbjct: 6   VVGLGRSGISAARLLQAEGHQVTVLESSIEPHLQSLAADLRLQGIAVELGKPLELTSFIP 65

Query: 62  W-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           W   +  +V+SPGIA      H  +    Q  ++I  D E+ V  R  S L  P+IA+TG
Sbjct: 66  WLDQLDSVVISPGIAWD----HPTLTALRQRGIDI--DGEMAVAWRSLSHL--PWIAITG 117

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPI--LNLEYFSPNR----FYVIECSSYQIE 174
           TNGK++   L++HVL  NG    +GGN+G     + L++  PN     + V+E SSYQIE
Sbjct: 118 TNGKTTVTHLLNHVLESNGLKAPMGGNVGHAAAEIALKWRQPNAQRPDWLVMELSSYQIE 177

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQ--CEKIAYD 232
             P I P IG+  N++PDHL+RH TL+ Y  IK+ ++  S+  I   +D     ++ ++D
Sbjct: 178 AAPEIAPRIGIWTNLTPDHLERHGTLDAYRKIKRGLLERSEIRIFNGDDPDLSSQRSSWD 237

Query: 233 MNFIGHSISRISSQSLQSDSDLYID-ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
               G  +S     +    +D +ID E  ++    +           +HN+QNL+     
Sbjct: 238 K---GLWVSSEGPGTANHRADFWIDAEGLVRDPQGALFAASALAMPGQHNLQNLLMVTAA 294

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
             Q GL  + I+ +L S  G+ HRL+ +  +  +   NDSKATN  +             
Sbjct: 295 ARQTGLPAKAIEASLRSFPGVPHRLEELGHIQQMSVYNDSKATNYDAACVGLKAVPAPAV 354

Query: 352 WIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSA-----MLFFHHFGGKIN--STLSKTLD 403
            +AGG +K  D S     +  K       G  A     ++    F G+++  S L+  + 
Sbjct: 355 VLAGGQTKQGDASGWLKQLDLKACAVILFGAGAAELNDLIETSGFRGELHCCSNLNAAVT 414

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
            A+   +      +  + +L SP CASFDQY +F  RG  F S ++
Sbjct: 415 LAIPLGLE-----RQAACLLLSPACASFDQYQDFEARGEHFRSLIA 455


>gi|152979588|ref|YP_001345217.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Actinobacillus succinogenes 130Z]
 gi|150841311|gb|ABR75282.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Actinobacillus
           succinogenes 130Z]
          Length = 437

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 227/463 (49%), Gaps = 53/463 (11%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQA-KDMGIEVIDFRE 59
           ++ ++N  I V GLG++GLS    L  K + V VI    +P    Q   ++ +   +  +
Sbjct: 1   MAEYKNKKITVIGLGKTGLSCVDFLLKKQADVRVIDTRTNPAGADQLHPNVPLHKGNLNQ 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
              +    +V+SPG+A+        ++ A    +E++GDIELF RE    +   P +A+T
Sbjct: 61  DWLNDSDMIVISPGLAVKTPE----IQTALSAGIEVVGDIELFCREANIQA--KPVVAIT 114

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFSPNRFYVIECSSYQIELT 176
           G+NGKS+   L++ + + +G    +GGNIG+P L+L   EY      YV+E SS+Q+E T
Sbjct: 115 GSNGKSTVTTLVAEMAKADGLRAGMGGNIGIPALSLLDAEY----DLYVLELSSFQLETT 170

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH--QCEKIAYDMN 234
             +      +LN++ DH++R+  LE+Y   K KI   ++ A+I   D   Q  K      
Sbjct: 171 FGLRARAATVLNVTEDHMNRYADLEDYRQAKLKIYANAETAVINAEDSLTQDNKQRAKRQ 230

Query: 235 F-IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIF--DFSQETKKHNIQNLVTSAVV 291
           F  G S          +D  L  +       A  EV+   D  + + +HN  N + S  +
Sbjct: 231 FSFGES---------HADYWLKTENGKQYLMAGREVVLPCDEVKISGRHNYMNALASIAL 281

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+K   I+ AL +  GL HR Q       V +INDSKATN+ S + A   L  +  
Sbjct: 282 AQAVGVKTHGIRTALRTFTGLDHRFQLAHLANGVRWINDSKATNVGSTVAALTGLYLEGN 341

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG------GKIN--STLSKT 401
           ++ + GG  K  DFS L   +          N   +F + FG       K++  S L +T
Sbjct: 342 LHLLLGGDGKGADFSELEKLV----------NKPEIFCYCFGQDGAALAKLSARSQLFET 391

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           ++QA+ ++   +++     +VL SP CAS DQ+ +F +RG  F
Sbjct: 392 MEQAVNALRPALKS---GDMVLLSPACASLDQFASFEKRGDEF 431


>gi|311280932|ref|YP_003943163.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Enterobacter
           cloacae SCF1]
 gi|308750127|gb|ADO49879.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Enterobacter
           cloacae SCF1]
          Length = 438

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 227/472 (48%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ ++  ++ + GLG +GLS        GV     D    P  + +  +     +     
Sbjct: 1   MADYQGKNVVIVGLGLTGLSCVNFFLAQGVTPRVMDTRATPPGLDKLPEQVERYVSGLND 60

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + +  +V SPGIAL+    H  +  A    VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  DWLLAADLIVASPGIALS----HPSLSAAADAGVEIVGDIELFCREA-----QAPVVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   S    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALMLLDVS-RELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATILNVTEDHMDRYPLGLQQYRAAKLRVYENAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           I++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 ISFGINMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +    GL      +AL + GGL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAAGLPRASSLKALTTFGGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLS 399
              ++ + GG  KS DF+ L        K Y  G++  L+ F   G ++       STL+
Sbjct: 337 DGTLWLLLGGDGKSADFAPL--------KRYLTGDNIRLYCFGRDGDELAALRPEVSTLT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T++QA++ +      V+   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEQAMRLI---APQVKPGDMVLLSPACASLDQFKNFEQRGDIFTRLAKEL 437


>gi|145633134|ref|ZP_01788866.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 3655]
 gi|145635587|ref|ZP_01791285.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittAA]
 gi|229844909|ref|ZP_04465047.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 6P18H1]
 gi|144986360|gb|EDJ92939.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 3655]
 gi|145267149|gb|EDK07155.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae PittAA]
 gi|229812290|gb|EEP47981.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Haemophilus
           influenzae 6P18H1]
          Length = 437

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 132/456 (28%), Positives = 232/456 (50%), Gaps = 41/456 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++N +I + GLG++GLS    L  + + + VI    +P  + K  +++ +      +
Sbjct: 1   MNAYQNKNIMIIGLGKTGLSCVDYLLSQQANIRVIDTRKNPTGIDKLPQNIPLHTGSLNQ 60

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
             W + S  +V+SPG+A+        +K      VE+IGDIELF R     +   P + +
Sbjct: 61  -EWLLESDMIVISPGLAVKTPEIQTVLKAG----VEVIGDIELFCR-----AATKPIVGI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVYEMAKAAGVKVGMGGNIGIPALSL-LNEDCELYVLELSSFQLETTYS 169

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K  ++  N+        + N   H
Sbjct: 170 LKAAAATILNVTEDHMDRYMDLEDYRQAKLRIYHNAKVGVL--NNEDRLTFGENENQAKH 227

Query: 239 SISRISSQS---LQSDSD----LYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           ++S   + +   L++++     +  DE  L C   + V         +HN  N++ +  +
Sbjct: 228 TVSFAENSADYWLKTENGKQYLMVKDEVILPCEEATLV--------GRHNYMNILAATAL 279

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              +G+ ++ I+ AL    GL HR Q   +   + +INDSKATN+ S + A   L  + +
Sbjct: 280 AQAIGINLDSIRAALRHFKGLDHRFQLAHQANGIRWINDSKATNVGSTVAALAGLYIEGK 339

Query: 350 IYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           ++ + GG  K  +FS L   I++     Y  G    L    F  +  S L +T++QA++ 
Sbjct: 340 LHLLLGGDGKGANFSELAELINQPHIICYCFGRDGAL-LAKFSSQ--SYLFETMEQAIEF 396

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +      +Q   +VL SP CAS DQ+ +F +RG  F
Sbjct: 397 L---RPTLQSGDMVLLSPACASLDQFASFEKRGEEF 429


>gi|312622927|ref|YP_004024540.1| UDP-N-acetylmuramoylalanine/d-glutamate ligase
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312203394|gb|ADQ46721.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 458

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 146/475 (30%), Positives = 241/475 (50%), Gaps = 53/475 (11%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMG-------IEVIDFR 58
            +  ++ V GLGRSGL++A  LK  G  VI +D+   A +Q K+         ++ I + 
Sbjct: 3   LKGKNVLVVGLGRSGLASARFLKKHGAFVIGFDEK--AEEQFKEEEKNDAQKLLDEIYYC 60

Query: 59  EIPWSII---SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPF 115
           EIP   I     +++SPG+ L+       + LA++  +E+IG+IEL  R  +  ++    
Sbjct: 61  EIPDEFIDRVQLVIVSPGVPLS----KRPLVLAHKKGIEVIGEIELAYRFCKSKNI---- 112

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIE 174
           +A+TGTNGK++T  L+  +L+K   DV + GNIGLP ++ +E  S +  +V+E SS+Q+E
Sbjct: 113 VAITGTNGKTTTTTLVGEILKKQYEDVVVCGNIGLPFIDTIETSSEDTIFVLEISSFQLE 172

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN 234
                 P +G +LNI+PDHL+RH T+ENY   K +I          I++     + YD N
Sbjct: 173 TIKYFKPKVGCILNITPDHLNRHLTMENYTKAKMRIFE-------NIDEMGYTVLNYDNN 225

Query: 235 ----FIGHSISRI---SSQSLQSDSDLYIDES---FLKCSATSEV-----IFDFSQETKK 279
                IG +   +   S    Q ++ ++++     F     T EV     IF   Q    
Sbjct: 226 ITRDLIGLAKGNVIVFSKTKTQFENVVFVENDVIYFTFEGKTQEVMKKDEIFIPGQ---- 281

Query: 280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV 339
           HN++N + +    +  G++ + I++ L +  G+ HR++ +A +  + F NDSK TN  + 
Sbjct: 282 HNLENALAAISCTLPFGIEKDTIEQVLKTFRGVEHRIEFVAEINGIKFYNDSKGTNTDAA 341

Query: 340 IHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFG--GKINS 396
             A    +  I  IAGG  K + F      ++ K+ K + +G +           G  N 
Sbjct: 342 EKALNAFENPIILIAGGYDKGESFEKFASLVAKKVKKVFLLGQTKQKIASELEKIGYKNF 401

Query: 397 TLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            L  TL +A++   +  E  Q   IVL SP CAS+D + N+ +RG  F   V+E+
Sbjct: 402 ELVSTLKEAVR---KSFECAQNGDIVLLSPACASWDMFENYEQRGRMFKEYVNEL 453


>gi|308185657|ref|YP_003929788.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pantoea vagans
           C9-1]
 gi|308056167|gb|ADO08339.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pantoea vagans
           C9-1]
          Length = 438

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 134/464 (28%), Positives = 219/464 (47%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ +R   + + GLG +GLS        GV     D    P  + +        +     
Sbjct: 1   MADYRGRKVVIIGLGLTGLSCVDFFLAQGVTPRVMDTRVSPPGLDKLPGQVERHLGGING 60

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + +  +V SPG+AL    AH  +  A +  +EI+GDIELF RE      Q+P +A+T
Sbjct: 61  DWLLAADLIVASPGVAL----AHPILSEAVEAGIEIVGDIELFCREA-----QAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G+ V +GGNIGLP L+L   SP + YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGWQVGVGGNIGLPALSL-LQSPAQLYVLELSSFQLETTHSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN++ DH+DR+   ++ Y   K ++   ++  I+  +D      A  M   G 
Sbjct: 171 KAAAATVLNVTEDHMDRYPLGMQQYRAAKLRVYENAQICIVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +      E + + ++     +HN  N + +  +   +G
Sbjct: 225 DKRCVSFGVDFGDYHLNKQQGSIWLRVKGEKVLNTAEMKMAGQHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L       AL    GL HR Q +     V +INDSKATN+ S   A   L  +  ++ + 
Sbjct: 285 LPRASSLAALTQFNGLAHRFQLVHEHQGVRWINDSKATNVGSTEAALNGLQVQGTLWLLM 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL-------SKTLDQALK 407
           GG  KS DF+ L P++         G++  L+     G   + L       ++T+ QA++
Sbjct: 345 GGDGKSADFTPLIPWLQ--------GDNVRLYCFGRDGDALAALRPDIAVRTETMRQAME 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      V+   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QI---APQVKAGDMVLLSPACASLDQFRNFEQRGEQFAQLAKEL 437


>gi|315225589|ref|ZP_07867398.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Capnocytophaga
           ochracea F0287]
 gi|314944406|gb|EFS96446.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Capnocytophaga
           ochracea F0287]
          Length = 444

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 132/462 (28%), Positives = 224/462 (48%), Gaps = 42/462 (9%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS-----II 65
           + + G G SG+  A   K  G  V   D         + +  E I + E   +     + 
Sbjct: 4   LVILGGGESGVGTAILGKQKGWEVFLSDKGSLKPHYRETLNKEGIQWEEGTHTEEKILLA 63

Query: 66  SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS--LQSPFIAVTGTNG 123
             ++ SPGI     +    +K  ++  + +I +IE       F+S    S  + +TG+NG
Sbjct: 64  DVIMKSPGIP----DKAPIIKKVHEKGIAVISEIE-------FASQYTDSLIVGITGSNG 112

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           K++T  L  H+ ++ G  V LGGNIG     L       +YV+E SS+Q++      P I
Sbjct: 113 KTTTTLLTYHIFKEAGLQVGLGGNIGYSFAELVATENPPYYVLEISSFQLDGIEHFAPHI 172

Query: 184 GVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN-------F 235
            VLLNI+PDHLDR+ +  ENY+N K +I          I D   E I   ++        
Sbjct: 173 AVLLNITPDHLDRYDYKFENYINSKFRIAMNQTENDYLIYDADDEVITQWLSTHTIKSKL 232

Query: 236 IGHSISR-ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
           I  SI + +   +   D+ +YI    +  + T+E+  +      KHNI+N + ++V    
Sbjct: 233 IPFSIEKELPQGAFLKDNKIYI----MLENQTTEIDVEEISLRGKHNIKNTMAASVAARL 288

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           + ++   ++ +L    G  HRL+ +  +  V ++NDSKATN++SV +A    K  I WI 
Sbjct: 289 VNIRNNSLRESLKGFKGAPHRLEEVKVVDGVTYVNDSKATNVNSVFYALDTIKTPIVWIV 348

Query: 355 GGLSKSDDFSTLFPFISKIAKAYF---IGNSAML--FFHHFGGKINSTLSKTLDQALKSV 409
           GG  K +D+++L P++ +  +A     + N+ ++  F++  G  +    ++++D+A+K  
Sbjct: 349 GGQDKGNDYNSLLPYVHEKVRAIVCLGVDNTPIIQSFYNTIGTLVE---TRSMDEAVKLA 405

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                  Q    VL SP CASFD + N+ ERG  F + V ++
Sbjct: 406 QG---FAQEGDTVLLSPACASFDLFKNYEERGDLFKAAVQKL 444


>gi|317050622|ref|YP_004111738.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Desulfurispirillum
           indicum S5]
 gi|316945706|gb|ADU65182.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Desulfurispirillum
           indicum S5]
          Length = 439

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 139/459 (30%), Positives = 212/459 (46%), Gaps = 38/459 (8%)

Query: 7   RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIIS 66
           +   + + G G+SG+SAA  L   G  V   DD   A    +  G   +     P SI  
Sbjct: 5   KGSPVLILGAGKSGVSAARFLVARGCPVTLADDGSSAHVPGELAG--AVTLVSGPGSIAK 62

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            L   PG+ +              F+  ++ DIELF +E      +   IAVTGTNGKS+
Sbjct: 63  CLAEHPGLVVASPGVDI-----RSFDRPMVNDIELFYQE-----YEGAIIAVTGTNGKST 112

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
             ALI+H+L+++G      GNIGLP L+       +  V+E SS+Q+E   T  P I VL
Sbjct: 113 VTALIAHILQQSGISAVAAGNIGLPALDTLALG-CQVTVLELSSFQLETIQTFRPDIAVL 171

Query: 187 LNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR---I 243
           LN++ DHL+R+ T E+YV+ K++I         C+ +H  + +   +    H  +R    
Sbjct: 172 LNVTEDHLNRYDTFEHYVDAKERIFLNQTAEDWCVLNHD-DPVIRTLTSDNHIPARRVFF 230

Query: 244 SSQSLQSDSDLYIDESFLKCSATS----------EVIFDFSQETKKHNIQNLVTSAVVCM 293
           SS+S Q      + ++FL C+             E   D       HN++N+  +     
Sbjct: 231 SSRSRQ------MVDNFLNCTVQGVRGKVNGQLLEAPADRLCLEGLHNMENVAAALAAVR 284

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
             GL  E+I   L     L HR+  +  +  V +I+DSKATN+ +V+ + L  ++ I  I
Sbjct: 285 LYGLSPEQIGTGLEGFAPLPHRMTLVREIVGVRYIDDSKATNIGAVLKS-LEGQKNIILI 343

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTL-DQALKSVVRD 412
           AGG +K  DF+ L   +    K       A    H   G +  ++S  L D    +V + 
Sbjct: 344 AGGRNKGGDFAQLAGAVKASCKLILAIGEAR---HQIAGALGKSVSVLLADDMADAVSQA 400

Query: 413 VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +       VL SPGCASFD + +F  RG  F   V ++
Sbjct: 401 WKQAVSGDTVLLSPGCASFDMFTSFEHRGAVFEQAVQQL 439


>gi|261338918|ref|ZP_05966776.1| hypothetical protein ENTCAN_05116 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318743|gb|EFC57681.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Enterobacter
           cancerogenus ATCC 35316]
          Length = 438

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 140/464 (30%), Positives = 221/464 (47%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ ++   + + GLG +GLS        GV     D    P  +    +     +     
Sbjct: 1   MADYQGKKVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVSPPGLDTLPEQVERHLGGLND 60

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + +  +V SPG+AL    AH  +  A    VEI+GDIELF RE      Q+P IA+T
Sbjct: 61  DWLLAADLIVASPGMAL----AHPSLSAAADAGVEIVGDIELFCREA-----QAPIIAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L        YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGMNVGVGGNIGLPALML-LDKGCELYVLELSSFQLETTTSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +D      A  M   G 
Sbjct: 171 HAAAATILNVTEDHMDRYPFGLQQYRAAKLRVYENAKVCVVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDL--YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG 296
               IS      D  L   + E++L+      +     + + +HN  N + +  +   +G
Sbjct: 225 DDRCISFGITMGDYHLNRQLGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      +AL +  GL HR Q       V +INDSKATN+ S   A   L+    ++ + 
Sbjct: 285 LPRSSSLQALTTYSGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHVDGTLHLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALK 407
           GG  KS DFS+L        K Y  G++  L+ F   GG++       +  ++T++QA++
Sbjct: 345 GGDGKSADFSSL--------KQYLAGDNIRLYCFGRDGGELAQLRPEIAEQTETMEQAMR 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 LI---APRVQPGDMVLLSPACASLDQFKNFEQRGDIFTRLAKEL 437


>gi|304396561|ref|ZP_07378442.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Pantoea sp. aB]
 gi|304356070|gb|EFM20436.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Pantoea sp. aB]
          Length = 438

 Score =  177 bits (448), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 135/464 (29%), Positives = 218/464 (46%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ +R   + + GLG +GLS        GV     D    P  + +        +     
Sbjct: 1   MADYRGRKVVIIGLGLTGLSCVDFFLAQGVTPRVMDTRVSPPGLDKLPGQVERHLGGING 60

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + +  +V SPG+AL    AH  +  A +  +EI+GDIELF RE      Q+P +A+T
Sbjct: 61  DWLLAADLIVASPGVAL----AHPILSEAVEAGIEIVGDIELFCREA-----QAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G+ V +GGNIGLP L+L   SP + YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGWQVGVGGNIGLPALSL-LQSPAQLYVLELSSFQLETTYSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN+S DH+DR+   ++ Y   K ++   ++  I+  +D      A  M   G 
Sbjct: 171 KAAAATVLNVSEDHMDRYPLGMQQYRAAKLRVYENAQICIVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +      E + + ++     +HN  N + +  +   +G
Sbjct: 225 DTRCVSFGVDFGDYHLNKQQGSIWLRVKGEKVLNTAEMKMVGQHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L       AL    GL HR Q +     V +INDSKATN+ S   A   L  +  ++ + 
Sbjct: 285 LPRASSLAALTHFNGLAHRFQLVHEHQGVRWINDSKATNVGSTEAALNGLQVQGTLWLLM 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL-------SKTLDQALK 407
           GG  KS DF+ L P++         G++  L+     G   + L       ++T+ QA++
Sbjct: 345 GGDGKSADFTPLIPWLQ--------GDNVRLYCFGRDGDALAALRPDIAVRTETMRQAME 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      V    +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QI---APQVNAGDMVLLSPACASLDQFRNFEQRGEQFAQLAKEL 437


>gi|293391356|ref|ZP_06635690.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290951890|gb|EFE02009.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 434

 Score =  176 bits (447), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 140/471 (29%), Positives = 233/471 (49%), Gaps = 66/471 (14%)

Query: 6   FRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAVKQA-KDMGIEVIDFREIPW 62
           +++  + V GLG++GLS    L  K + V VI    HP   +Q  K + +      +  W
Sbjct: 3   YQDKKVTVIGLGKTGLSCVDFLRAKQADVRVIDTRQHPAGAEQLDKAIPLHTGGLNQ-QW 61

Query: 63  SIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            + S  +V+SPG+A+        ++ A Q  VE++GDIELF RE        P +A+TG+
Sbjct: 62  LLESDLIVISPGLAVKTPE----IQTALQAGVEVLGDIELFCREA-----DKPIVAITGS 112

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLP---ILNLEYFSPNRFYVIECSSYQIELTPT 178
           NGKS+   L++ + +  G  V +GGNIG+P   +LN +Y      YV+E SS+Q+E T +
Sbjct: 113 NGKSTVTTLVAEMAKAAGLRVGMGGNIGIPALSLLNQQY----DLYVLELSSFQLETTYS 168

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--------HQCEKIA 230
           +      +LN++ DH++R+  L++Y + K  I    + A+I   D           ++++
Sbjct: 169 LKAVAATVLNVTEDHMNRYMDLQDYRHAKLNIYNHCQTAVINAEDALTLPATQRPQKQVS 228

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
           +  N   + +   ++++      +  DE+ L C        D  + T +HN  N + +  
Sbjct: 229 FGENHADYWLKTENNKTYL----MAYDEAVLAC--------DEMKLTGRHNYMNALAAIA 276

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKR 348
           +    G+ +  I+ AL + GGL HR Q       V +INDSKATN+ S + A   L    
Sbjct: 277 LAQAAGINLTGIRTALCAFGGLEHRFQVAHIADGVRWINDSKATNVGSTVAALTGLQVAG 336

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLSK------ 400
           +++ + GG  K  DFS L   I          N   +  + FG  GK  + LS       
Sbjct: 337 KLHLLLGGDGKGADFSELARLI----------NQPHINCYCFGRDGKQLAALSSQSQLFD 386

Query: 401 TLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERG--FSFMSQVS 449
           T++ A+ ++      +Q   +VL SP CAS DQ++ F  RG  F+ +S++S
Sbjct: 387 TMEHAIAAI---RPQLQAGDMVLLSPACASLDQFSCFEARGDEFTRLSRLS 434


>gi|332288554|ref|YP_004419406.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Gallibacterium anatis UMN179]
 gi|330431450|gb|AEC16509.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Gallibacterium anatis UMN179]
          Length = 440

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 139/458 (30%), Positives = 222/458 (48%), Gaps = 49/458 (10%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEV-IDFREIP 61
           ++   ++ V GLG++GLS      D  V   VI   + P  + Q    GI V        
Sbjct: 6   NYTGKTVTVVGLGKTGLSCVSYFADKQVNLQVIDTREKPAGLDQLP-AGIAVHTGGLNQE 64

Query: 62  WSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           W + S  +VLSPGI+L        ++ A++  VEI+GDIELF RE       +P +A+TG
Sbjct: 65  WLLQSDLIVLSPGISLKTPE----IRKASEKCVEIVGDIELFCREA-----DAPIVAITG 115

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           +NGKS+   L+  + +    +V +GGNIG+P L+L      + YV+E SS+Q+E T +++
Sbjct: 116 SNGKSTVTTLVYEMAKAADLNVGIGGNIGIPALSL-LGKGCQLYVLELSSFQLETTYSLN 174

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
            +   +LNIS DH++R+  +E Y   K +I    +HA   + +++      D     H +
Sbjct: 175 AAAATILNISEDHMNRYDDMEEYRQAKLRIY---RHAETIVVNNEDRATYPDYREPQHRL 231

Query: 241 SRISSQSLQSDSDLYIDESF--LKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLG 296
              +    +  +D Y+ E +     +  S ++ D  +     +HN  N + +  +   + 
Sbjct: 232 LSFA----EKHADYYLQEMWGHTYLATDSRLLLDVEKMKLIGRHNYMNALAAIALAQAVK 287

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           +  + I  AL S  GL HR QT+     V ++NDSKATN+ S   A   L     +Y + 
Sbjct: 288 IPQQGIIDALQSFAGLDHRFQTVHYENGVRWVNDSKATNVGSTEAALNGLQVAGNLYLLL 347

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKI--------NSTLSKTLDQAL 406
           GG  K  DFS L P I          N + +F + FG            S +  T++QA+
Sbjct: 348 GGDGKKADFSDLKPLI----------NKSNIFCYCFGQDKLPLAELSSQSVVVDTMEQAI 397

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           + +      ++   +VL SP CAS DQ+ NF  RG  F
Sbjct: 398 EQI---RPKLKAGDMVLLSPACASLDQFPNFEVRGQEF 432


>gi|21672497|ref|NP_660564.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera
           aphidicola str. Sg (Schizaphis graminum)]
 gi|25090714|sp|Q8K9T2|MURD_BUCAP RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|21623116|gb|AAM67775.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera
           aphidicola str. Sg (Schizaphis graminum)]
          Length = 440

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 148/458 (32%), Positives = 232/458 (50%), Gaps = 45/458 (9%)

Query: 11  IAVFGLGRSGLSAACALKDSGVH--VIAWDDHPCAV-KQAKDMGIEVIDFREIPWSIIS- 66
           I + GLG +G+S        G+   VI   + P  + K  K++  ++ + +E  W + S 
Sbjct: 10  ILILGLGLTGISCINFFLKKGIQPRVIDESNKPIFLNKIPKNIEYKLGNLKE-NWILESD 68

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            +++SPGI+    +    +  A    ++II DIELF RE +      P I++TGTNGKS+
Sbjct: 69  LIIISPGIS----SFKPILMKARSLGIDIISDIELFSRETK-----CPIISITGTNGKST 119

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
              ++  +  K+GY V LGGNIG P+L +        YV+E SS+Q+E T  +   I V+
Sbjct: 120 VATMVKKIAEKSGYKVLLGGNIGFPVLEM-LNKKASLYVLELSSFQLETTFNLKSKIAVV 178

Query: 187 LNISPDHLDRHHTLENYVNIKKKIVTMSKHAIIC-INDHQCEKIAYDMNFIGHSISRISS 245
           LNI+ DHLDR+   E +   KK  +++   A IC I   + EK  ++      S   IS 
Sbjct: 179 LNITEDHLDRYP--EGFEQYKKTKLSIYNKAKICLIKLKKGEKKPFNT----KSKKYISF 232

Query: 246 QSLQSDSDLYI----DESFL-----KCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG 296
            +  +++D YI    +++ L     K   TS ++ +       HN +N++TS  +  Q+ 
Sbjct: 233 GTC-NNNDYYINYEKEKAILFHKNKKIVDTSNILLN-----GHHNYENILTSLAISDQMK 286

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR--IYWIA 354
              +     L    GL HR QT+    ++ +INDSK+TN+ S   A  N K +  I+ + 
Sbjct: 287 FDQKVSINVLKKFLGLPHRFQTVHINNNISWINDSKSTNVDSTKAALKNLKIKGTIWLLL 346

Query: 355 GGLSKSDDFSTLFPFISKIA-KAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           GG  KS +F+ L  +  KI  K Y  G   +        K  S  +KTL QA   ++   
Sbjct: 347 GGDGKSSNFNILKKYFEKIKIKIYCFGKDGLNLSKLCKKK--SIYTKTLKQA---IILIS 401

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           + +Q   +VL SPGC+S DQ++NF ERG  F+    EI
Sbjct: 402 KKIQPGDVVLLSPGCSSKDQFSNFEERGNLFIKLSKEI 439


>gi|218768812|ref|YP_002343324.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neisseria
           meningitidis Z2491]
 gi|30316128|sp|Q9JSZ5|MURD_NEIMA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|121052820|emb|CAM09167.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis Z2491]
          Length = 445

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 133/458 (29%), Positives = 221/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   +    ++GDIEL   +  RR   +    I
Sbjct: 62  DALSNGFDILALSPGISERQPD----IEAFKRNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E     +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGAPVLEAELQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEYEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A++ 
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCDLNMTDCATLEEAVQK 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|312134659|ref|YP_004001997.1| udp-n-acetylmuramoylalanine/d-glutamate ligase
           [Caldicellulosiruptor owensensis OL]
 gi|311774710|gb|ADQ04197.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase
           [Caldicellulosiruptor owensensis OL]
          Length = 455

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 143/482 (29%), Positives = 238/482 (49%), Gaps = 67/482 (13%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD----------DHPCAVKQAKDMGIEVI 55
            +  S+ V GLG+SGL++A  LK  G  VI +D          D  CA +   +     I
Sbjct: 3   LKGKSVLVVGLGKSGLASANFLKKQGAFVIGFDEKAEDQFKKEDRNCAEESCDE-----I 57

Query: 56  DFREIPWSII---SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQ 112
            + EIP  +I     +V+SPG+ L+       V LA++  VE+IG+IEL  R  +  ++ 
Sbjct: 58  YYCEIPDEVIDKVQLVVVSPGVPLS----KRIVVLAHKKGVEVIGEIELAYRFCKSKNI- 112

Query: 113 SPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSY 171
              +A+TGTNGK++T  L+  +L+K   DV + GNIGLP ++ +E  S N  +V+E SS+
Sbjct: 113 ---VAITGTNGKTTTTTLVGEILKKQHKDVVVCGNIGLPFIDTVETSSENTIFVLEISSF 169

Query: 172 QIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAY 231
           Q+E      P +G +LNI+PDHL+RH T+ENY+  K +I          I++     + Y
Sbjct: 170 QLETIKYFKPMVGCILNITPDHLNRHMTMENYIKAKMRIFEN-------IDETGYTVLNY 222

Query: 232 D----MNFIGHSISRI---SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK------ 278
           D     + IG +   +   S    Q  + ++I+E        +++ F F  +T+      
Sbjct: 223 DNSVTRDLIGLAKGNVIVFSKNKNQFKNVVFIEE--------NKIYFTFEGKTQEVMRKD 274

Query: 279 ------KHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSK 332
                 +HN++N + +    +  G+  + I+  L +  G+ HR++ +  +  + F NDSK
Sbjct: 275 EIFIPGEHNLENALAAIACTLPFGVTKDTIEYVLKNFKGVEHRIEFVTEINGIKFYNDSK 334

Query: 333 ATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFG 391
            TN  +   A    +  I  IAGG  K + F      I+ K+ K + +G +         
Sbjct: 335 GTNTDAAEKAISAFESPIILIAGGYDKGESFERFAGLIAKKVKKVFLLGQTKQKIASELE 394

Query: 392 --GKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
             G  N  L   L +A++   +  E  +   +VL SP CAS+D + N+ +RG  F   V+
Sbjct: 395 KIGYRNFELVSNLKEAVE---KSFEYAKSGDVVLLSPACASWDMFENYEQRGKMFKEYVN 451

Query: 450 EI 451
           ++
Sbjct: 452 KL 453


>gi|32490957|ref|NP_871211.1| hypothetical protein WGLp208 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|30316007|sp|Q8D2Z4|MURD_WIGBR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|25166163|dbj|BAC24354.1| murD [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 438

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 146/462 (31%), Positives = 223/462 (48%), Gaps = 38/462 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAK-DMGIEVIDFRE 59
           + S+    I + GLG +GLS        G+     DD   P  +K    D+   +     
Sbjct: 1   MKSYLGKKIVIIGLGITGLSCVNFFYKRGIKTYIMDDSYSPEYLKYVPYDIPCHLGSL-N 59

Query: 60  IPWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           + W I    +++SPG++L     H  + +A + N+EIIGDIELF RE        P IA+
Sbjct: 60  VKWLINAKLIIISPGVSL----YHPSLIIAKKLNIEIIGDIELFAREA-----SRPIIAI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+  ++I  +   +G  V +GGN+G P L+L      + Y+IE SS+Q+E T  
Sbjct: 111 TGSNGKSTVTSMIGAIALNSGLSVGIGGNLGTPALDLLNEKSYQLYIIELSSFQLETTFN 170

Query: 179 IDPSIGVLLNISPDHLDRHHT-LENYVNIKKKIVTMSKHAIICINDHQCEKIAYD----M 233
           +      +LN++ DH+DR+   +  Y  IK KI   +K  II ++D+    +  +    +
Sbjct: 171 LKTIASSILNVTHDHMDRYPLGINQYRLIKLKIYKNAKVKIINLDDYMTWPVHKNKSVCI 230

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESF-LKCSATSEVIFDFSQETKKHNIQNLVTSAVVC 292
            F  H   +   +  + ++ + ++  F LKCS      F        HN  N + S +  
Sbjct: 231 GFSSHK-GKYCIKKHKKNNWMVVNNKFLLKCSEMKISGF--------HNYLNALVSLIFS 281

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRI 350
             L +  E     L +  GL HR Q I +  ++ +INDSK+TN+ S I A   +  K  I
Sbjct: 282 DILKIPREISLNTLKNFSGLPHRFQIIHKKNNISWINDSKSTNVSSTIAALSSIKIKGNI 341

Query: 351 YWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
           + + GG SK  +   L   I +K  K Y  G  A L       KI ST S   D    S+
Sbjct: 342 HLLLGGDSKKANLLPLMKIIRNKKIKLYCFGKDAYLL-----SKI-STDSFINDTLYHSM 395

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           ++  EN+    IVL SP C+S DQ+ NF+ERG  F     +I
Sbjct: 396 IKIKENLNHGDIVLLSPACSSLDQFKNFKERGEKFTKLAQKI 437


>gi|269137993|ref|YP_003294693.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Edwardsiella tarda
           EIB202]
 gi|267983653|gb|ACY83482.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Edwardsiella tarda
           EIB202]
 gi|304558040|gb|ADM40704.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Edwardsiella tarda
           FL6-60]
          Length = 438

 Score =  176 bits (447), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 139/460 (30%), Positives = 215/460 (46%), Gaps = 36/460 (7%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           ++ ++   + + GLG +GLS      D GV   VI     P  + +        +   E 
Sbjct: 1   MADYQGKRVVIIGLGLTGLSCVDFFMDRGVVPRVIDTRATPPGLDKLPASVERHLGSIEQ 60

Query: 61  PWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W +    +V SPGI L+       +  A Q  VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  SWLMDADLIVASPGIPLSSP----ALDRAAQAGVEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + R  G+ V +GGNIG+P L+L      R YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMARAAGWQVGVGGNIGVPALSLLKHE-CRLYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN+S DH++R+   L+ Y   K +I   ++  ++  +D      A  M   G 
Sbjct: 171 RAAAATILNVSEDHMNRYPLGLQQYRAAKLRIYENARTCVVNADD------ALTMPIHGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +      E I +    Q T  HN  N + +  +   +G
Sbjct: 225 DTRCVSFGVDVGDYHLNRQQGEIWLRVRGEKILNTKEMQLTGMHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      RAL +  GL HR Q +     V +INDSKATN+ S   A   L+    ++ + 
Sbjct: 285 LPRASSLRALTTFRGLAHRFQLVLEHSGVRWINDSKATNVGSTEAALKGLHLDGTLHLLL 344

Query: 355 GGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSK---TLDQALKSVV 410
           GG  K  DF+ L P++     + Y  G  A         ++   +S+   TL+QA++++ 
Sbjct: 345 GGDGKDADFTPLLPYLQGDRIRLYCFGRDAEPLM-----RLRPEVSRRFDTLEQAIRALA 399

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
                  +   VL SP CAS DQ+ NF +RG  F     E
Sbjct: 400 PLTRGGDM---VLLSPACASLDQFKNFEQRGDEFARLARE 436


>gi|304383924|ref|ZP_07366381.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Prevotella
           marshii DSM 16973]
 gi|304335002|gb|EFM01275.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Prevotella
           marshii DSM 16973]
          Length = 443

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 138/464 (29%), Positives = 227/464 (48%), Gaps = 57/464 (12%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWD-------------DHPCAVKQAKDMGIEVIDF 57
           I V G G SG  +A   K  G  V   D             DH  A ++ K    ++++ 
Sbjct: 4   IVVLGAGESGAGSAVLAKKEGFDVFVSDMSAIKDKYKKLLNDHGIAWEEGKHTEEKILNG 63

Query: 58  REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
            E+        + SPGI    + A    K+ ++ ++ II +IE   R        +  + 
Sbjct: 64  AEV--------IKSPGIP---KEAPMVRKIIDK-SIPIISEIEFAGR-----YTHAKMVC 106

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTP 177
           +TG+NGK++T +LI H+ R+ GYDV L GNIG  +       P+ FY+IE SS+Q++   
Sbjct: 107 ITGSNGKTTTTSLIYHIFREAGYDVGLAGNIGNSLALQVAEDPHAFYIIELSSFQLDDMF 166

Query: 178 TIDPSIGVLLNISPDHLDRH-HTLENYVNIKKKIV--TMSKHAIICINDH---QCEKIAY 231
               +I +LLNI+PDHLDR+ H ++NYVN K +I+     + + I  ND    + E   Y
Sbjct: 167 DFRANIAILLNITPDHLDRYDHCMQNYVNAKMRILQNQTEEDSFIFWNDDPIIKRELQKY 226

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE----TKKHNIQNLVT 287
           D+  + +  S +     ++ S  YI+E   + +      F+  QE    T +HNI N + 
Sbjct: 227 DIKAMQYPFSELK----ENGSIGYIEEG--RYTLEEPTPFNMEQEELSLTGRHNIYNSLA 280

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           + +     G+K + I+++L    G+ HRL+ + ++G V +INDSKATN+ +  +A  + +
Sbjct: 281 AGIAGSIAGIKKDVIRKSLSDFPGVEHRLEKVVKVGGVQYINDSKATNVDACWYALDSMR 340

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISK--IAKAYFIGNSAMLF--FHHFGGKINSTLS-KTL 402
                I GG  K +D+  +   + +  +   Y   +++ L   F H G  +  T S K  
Sbjct: 341 TPTILIIGGKDKGNDYEPIKALVKEKCVGLVYLGADNSKLHDNFDHLGIPVRDTHSMKEC 400

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
            +A  ++ R  +       VL SP CASFD + N  +RG  F +
Sbjct: 401 MEACYAMARPGDT------VLLSPCCASFDLFKNMEDRGNQFKA 438


>gi|72382768|ref|YP_292123.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. NATL2A]
 gi|122063254|sp|Q46JA8|MURD_PROMT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|72002618|gb|AAZ58420.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. NATL2A]
          Length = 469

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 145/472 (30%), Positives = 231/472 (48%), Gaps = 54/472 (11%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCA-----VKQAKDMGIEVIDFRE-------I 60
           V GLG SG+SAA  LK  G +V+  +++          + K  GI VI   E        
Sbjct: 13  VLGLGCSGISAAKLLKTEGKNVLVLENNSNKNLLNISNKLKSEGINVILLDEALHINNFT 72

Query: 61  PW--SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           PW  S+ S  V SPGI       H  +K     N+ + G++ L     R + +  P + +
Sbjct: 73  PWIESVCSITV-SPGIDW----EHIALKELRGKNINVQGEVALAWE--RLTHI--PSVGI 123

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIG--LPILNLEYFSPNR----FYVIECSSYQ 172
           TGTNGK++   +++H+L+ N  +  +GGN+G  L  + LE    N     + V+E SS+Q
Sbjct: 124 TGTNGKTTVTNMLNHILKLNNLNTDMGGNVGKALSKIALENMKNNDQELDWLVLELSSFQ 183

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD 232
           IE +P + P+IG+    +PDHL+RH+ +E+Y  IK+ ++  S   I   +D        +
Sbjct: 184 IEGSPKVAPTIGIWTTFTPDHLERHNDMESYFKIKRSLLEKSSIRIYNSDDQYLSSKRKE 243

Query: 233 MN---FIGHSISRISSQ--SLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
           +    ++G +   + SQ      D   YI E   +   +S  I +      KHN+QNL+ 
Sbjct: 244 LPKGIWVGTNQQSLYSQYQKFWIDQKGYIFEDKKQLFHSS--ILNIP---GKHNLQNLLL 298

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +     ++GL    I +++ S   + HRL+ +  + ++ F NDSKATN  S I A  +  
Sbjct: 299 AIAAAREIGLDDSSIAKSIKSFKSIPHRLEYLGNVNNLSFYNDSKATNFDSSITALKSVP 358

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKA----YFIGNSA-----MLFFHHFGGKINSTL 398
             I  +AGG+ K  DF    P++ +I ++       G SA      L    + G+I   +
Sbjct: 359 HPIILLAGGIQKKGDF---MPWVKQIKQSTNGIVLFGLSANNLKEELLISSYIGEI--IV 413

Query: 399 SKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            K L++A  + +         SI+L SP CASFDQY N+ ERG  F + V +
Sbjct: 414 KKNLEEATIASINIARETNSRSILL-SPACASFDQYKNYEERGDHFKNLVKK 464


>gi|33863701|ref|NP_895261.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. MIT 9313]
 gi|60390535|sp|Q7V5V5|MURD_PROMM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|33635284|emb|CAE21609.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9313]
          Length = 460

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 145/466 (31%), Positives = 224/466 (48%), Gaps = 45/466 (9%)

Query: 13  VFGLGRSGLSAACALKDSG--VHVIAWDDHPCAVKQAKDMGIEVIDFR-EIPWSIISFL- 68
           V GLGRSG+ AA  L+  G  V V+     P     A D+ ++ I      P  + SF+ 
Sbjct: 6   VVGLGRSGIGAARLLQAEGHQVTVLERSIEPHLQSLAADLRLQGIAVELGKPLELNSFIP 65

Query: 69  --------VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
                   V+SPGIA      H  +    Q  ++I  D E+ V  R  S L  P+IA+TG
Sbjct: 66  LLDQLDAVVISPGIAWD----HPTLTALRQRGIDI--DGEMAVAWRSLSHL--PWIAITG 117

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPI--LNLEYFSPNR----FYVIECSSYQIE 174
           TNGK++   L++HVL  NG    +GGN+G     + L++  PN     + V+E SSYQIE
Sbjct: 118 TNGKTTVTHLLNHVLESNGLRAPMGGNVGHAAAEVALKWRQPNAQRPDWLVMELSSYQIE 177

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH--QCEKIAYD 232
             P I P +G+  N++PDHL+RH TL+ Y  IK+ ++  S+  I   +D   + ++ ++D
Sbjct: 178 AAPEIAPRMGIWTNLTPDHLERHGTLDAYRTIKRGLLERSEIRIFNGDDPDLRSQRSSWD 237

Query: 233 MNFIGHSISRISSQSLQSDSDLYID-ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
               G  +S     +    +D +ID E  ++    +           +HN+QNL+     
Sbjct: 238 K---GLWVSSEGPGTANHRADFWIDAEGLVREPQGALFAASALAMPGQHNLQNLLLVTAA 294

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
             Q GL  + I+ +L S  G+ HRL+ +  +  +   NDSKATN  +             
Sbjct: 295 ARQTGLPAKAIEASLRSFPGVPHRLEQLGHIQQMSVYNDSKATNYDAACVGLKAVPPPAV 354

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFI-GNSA-----MLFFHHFGGKIN--STLSKTLD 403
            +AGG +K  D S     + + A A  + G  A     ++    F G+++  S L+  + 
Sbjct: 355 VLAGGQTKQGDASGWLKQLDQNACAVILFGAGASELQELIKTSGFSGELHCCSNLNAAVT 414

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
            A+   V      +  + +L SP CASFDQY +F  RG  F S +S
Sbjct: 415 LAIPLGVE-----RQAACLLLSPACASFDQYQDFEARGEHFRSLIS 455


>gi|254509149|ref|ZP_05121249.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio
           parahaemolyticus 16]
 gi|219547946|gb|EED24971.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio
           parahaemolyticus 16]
          Length = 441

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 142/455 (31%), Positives = 220/455 (48%), Gaps = 33/455 (7%)

Query: 1   MKLSSFRN-HSIAVFGLGRSGLSAACALK----DSGVHVIAWDDHPCAVKQAKDMGIEVI 55
           M +  ++N  S+ V GLG +GLS    L        + VI   D+P   +++   G+E+ 
Sbjct: 1   MTMDRWQNIESVVVVGLGITGLSVVKYLDKLPHSLTIKVIDTRDNPPG-QESLPSGVELH 59

Query: 56  DFR-EIPWSIISFLVLS-PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
                  W + + LV++ PGIAL        ++LA    V ++GDIELF  +     +  
Sbjct: 60  SGSWNTDWLVDADLVVANPGIALATPE----IQLALVAGVPVVGDIELFAWQ-----VDK 110

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQI 173
           P IA+TG+NGKS+   L   V +  G  V +GGNIG+P L+L        YV+E SS+Q+
Sbjct: 111 PVIAITGSNGKSTVTDLTGVVAKAAGLKVGVGGNIGVPALDL-LAQDADLYVLELSSFQL 169

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++       LN+S DH+DR+  +E Y   K +I   +   I+  +D        D 
Sbjct: 170 ETTSSLSLKAAAFLNLSEDHMDRYEGMEGYRQAKLRIFDHADACIVNADDKATYPDVGDK 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
             I  S++  +   L   ++L   E   + SA      D +    +HNI N +    +  
Sbjct: 230 KLIEFSLNGSADYHL---AELQGQEFLFQGSAPIMPSSDLTL-VGRHNIANALVVLALLS 285

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIY 351
           Q+ + +     AL S  GLTHR Q +A    + ++NDSKATN+ S + A   L+ + ++Y
Sbjct: 286 QVDVDLSLGLDALKSYSGLTHRCQVVADNQGIKWVNDSKATNVASTLAALSGLSLQGKLY 345

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINS--TLSKTLDQALKSV 409
            + GG+ K  DFS L P ++ +       N  +  F   G +  S    +K  D     V
Sbjct: 346 LLVGGVGKGADFSELAPVLASL-------NVQLCCFGEDGSQFMSLHPSAKYFDNMEAIV 398

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
                 +Q   +VL SP CASFDQ++NF  RG +F
Sbjct: 399 AWINPQLQAGDMVLLSPACASFDQFSNFMARGDAF 433


>gi|325578823|ref|ZP_08148870.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325159647|gb|EGC71779.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 437

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 141/463 (30%), Positives = 228/463 (49%), Gaps = 61/463 (13%)

Query: 6   FRNHSIAVFGLGRSGLSAACALK--DSGVHVIAWDDHPC-AVKQAKDMGIEVIDFREIPW 62
           ++N +I + GLG++GLS    L+   + + VI    HP  A K  K++ +      +  W
Sbjct: 5   YQNKTITIIGLGKTGLSCVEYLQSQQANIRVIDTRQHPAGADKLPKNVPLHTGSLNQ-QW 63

Query: 63  SIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
            + S  +V+SPG+A+        ++ A    VE+IGDIELF R     +   P + +TG+
Sbjct: 64  LLESDIIVISPGLAVKIPE----IQTALSAGVEVIGDIELFCR-----AATKPIVGITGS 114

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDP 181
           NGKS+   L+  + +  G  V +GGNIG+P L+L        YV+E SS+Q+E T ++  
Sbjct: 115 NGKSTVTTLVYEMAKAAGIKVGMGGNIGIPALSL-LNEDCDLYVLELSSFQLETTNSLKA 173

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--------HQCEKIAYDM 233
           +   +LN++ DH+DR+  LE+Y   K +I   ++ A++ + D        +Q +K+    
Sbjct: 174 AAATVLNVTEDHMDRYVDLEDYRQAKLRIYYNAETAVVNLEDKLTFGEGENQAKKV---- 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIF--DFSQETKKHNIQNLVTSAVV 291
                    +S    Q+D  L  +       A  EVI   D +    +HN  N++ +  +
Sbjct: 230 ---------VSFAENQADYWLKTENGKQYLMAKEEVILPCDEAILVGRHNYMNILAATAL 280

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRR 349
              + + +E I+ AL    GL HR Q   +   V +INDSKATN+ S + A   L  +  
Sbjct: 281 AQAVDINLEAIRIALRQFKGLDHRFQLAYQTNGVRWINDSKATNVGSTVAALAGLYVEGT 340

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLS------KT 401
           ++ + GG  K  DFS L   I          N   +  + FG  GK  + LS      +T
Sbjct: 341 LHLLLGGDGKGADFSELADLI----------NQPHISTYCFGRDGKQLAALSSQSHLFET 390

Query: 402 LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           + QA+ S +R    ++   +VL SP CAS DQ+ +F +RG  F
Sbjct: 391 MQQAI-SFLR--PRLKSGDMVLLSPACASLDQFTSFEKRGEEF 430


>gi|329770442|ref|ZP_08261824.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Gemella sanguinis
           M325]
 gi|328836565|gb|EGF86225.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Gemella sanguinis
           M325]
          Length = 446

 Score =  176 bits (446), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 138/456 (30%), Positives = 232/456 (50%), Gaps = 25/456 (5%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVI--AWDDHPCAV--KQAKDMGIEVIDFREI 60
             +N  I V G  RSG S A  LK    +VI  A+DD    V   + +D+GI +ID    
Sbjct: 3   DLKNKKILVLGFARSGYSTAKILKQLNYNVIVNAYDDLSKDVHANELRDLGIPIIDGGHP 62

Query: 61  PWSI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
            + +  I  ++ +PGI    +     ++ A +  ++II +IEL       +      +A+
Sbjct: 63  LYLLDEIDLIIKNPGIKYQID----FLQKAIEKKIDIITEIEL-----ANTLFNVDMVAI 113

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TGTNGK++T  +   +L+++  DV L GNIG P + + Y  PN   + E SS+Q+E T  
Sbjct: 114 TGTNGKTTTTQMTYDILKQSNKDVYLAGNIGYPSIEVAYNHPNSLIITEVSSFQLEGTKY 173

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             PSI  + N+   HLD H ++ENY N K+KI          I + + EK  Y+++ I  
Sbjct: 174 FRPSIAAITNLGEGHLDYHKSIENYRNAKRKIYKNQVDTDFLILNIK-EKDKYNISEINS 232

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLVTSAVVCMQLG 296
           +I    ++   +D+D+YI ++ +        +FD ++ T    HN++N + +AV+  + G
Sbjct: 233 NIIFYDTK-FNTDADVYIKDNMVIYGDVE--LFDSTKLTLPGLHNVENGINAAVIAYKKG 289

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGG 356
             +E I++ L +  G+ HRLQ +     + + NDSKATN  + I+A    ++ +  I GG
Sbjct: 290 ADIESIRKVLYNFSGVKHRLQYVGENKGIKYYNDSKATNPVATINALSGFEKNVVLICGG 349

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSA-MLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
             +  DF  L P+++++     +G SA +L        +N   +  +D A +   +    
Sbjct: 350 QDRGIDFHELSPYLNRVKTMVVVGESADILKSLADKNNVNCIKAIKIDDATEKASK---L 406

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                I+L SP CAS+DQY +F  RG  F++   +I
Sbjct: 407 AVTGDIILLSPACASWDQYKSFEVRGDEFINTFKKI 442


>gi|282891539|ref|ZP_06300030.1| hypothetical protein pah_c180o013 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498507|gb|EFB40835.1| hypothetical protein pah_c180o013 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 449

 Score =  176 bits (445), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 141/467 (30%), Positives = 239/467 (51%), Gaps = 39/467 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM------GIEVIDFR 58
           ++ N  I + GLG SGL+AA  L      V A D +   +++  D+      G++ +  +
Sbjct: 4   TYFNKPILIVGLGISGLAAARFLLTQKALVWAIDQNKDKLRKRSDIQILESQGLQFVAEK 63

Query: 59  EIPWSIISFL--VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
           ++P  + +FL  V SPG+ LT    H  ++LA   N++I+G+IEL      F SL++  I
Sbjct: 64  DLP-PLETFLLVVTSPGVPLT----HPVLQLAQAKNIKILGEIEL-----AFRSLRNKLI 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
            +TGTNGK++   L++H+L   G   +  GN+G P+      S     V+E SS+Q++  
Sbjct: 114 GITGTNGKTTVTLLLTHLLNYAGIPAKAVGNVGEPLSAEITCSSETVLVVELSSFQLDTL 173

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKH-AIICINDHQCEKIAY-DMN 234
            +    +GV+LNI+PDHLDR+ ++E+Y   K KI +  K  A + + +   +   +   N
Sbjct: 174 QSRQLDMGVILNITPDHLDRYASMEDYALSKMKIKSCIKEGAPLYMEEKAFQNYGFLQAN 233

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
           F  H      +  L SD        FL  +  S +  ++ +ETK H ++NL+ +  +C +
Sbjct: 234 FPCHLYGYSHNCHLMSDQ----QHLFLNKNIDSILPIEY-RETKSHRLENLMAAYGLCRE 288

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
           +G+        + +     HR++ +A   +V + NDSK TN+ +V+ A    +  I  IA
Sbjct: 289 MGIDATLFWEGVSTFNTPPHRIEKVAIFKNVSYYNDSKGTNIDAVMRAIETIEGPIILIA 348

Query: 355 GGLSKSDDFST-LFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD----QALKSV 409
           GG+ K  DFS  +  F +K+     IG +          K++ TLSK+ +    Q +   
Sbjct: 349 GGVDKGTDFSPWISAFANKVKHICAIGQATE--------KLDRTLSKSFNVVRCQNMHDA 400

Query: 410 VRDVENVQLPSI-VLFSPGCASFDQYNNFRERGFSFMSQVSEIPGIE 455
           V+   ++  P   VL SPGCAS+D + N+  RG +F   V+ +  I+
Sbjct: 401 VKHASSLAYPGDNVLLSPGCASYDMFENYAHRGKTFREAVNALASIQ 447


>gi|290476455|ref|YP_003469360.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Xenorhabdus
           bovienii SS-2004]
 gi|289175793|emb|CBJ82596.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Xenorhabdus
           bovienii SS-2004]
          Length = 436

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 221/467 (47%), Gaps = 50/467 (10%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +    + + GLG +GLS        GV     D     P + K   D+         
Sbjct: 1   MAEYLGKKVVIVGLGLTGLSCVDFFMARGVTPRVMDTRLVPPGSDKLPDDVACHTGSLNT 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL        ++ A    +EI+GDIELF RE       +P +A+T
Sbjct: 61  QWLMDADLIVASPGIALATPE----LQAAADAGIEIVGDIELFCREA-----TTPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + ++ G+ V +GGNIG+P L L    P + YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKEAGWQVGVGGNIGIPALEL-LKQPCQLYVLELSSFQLETTYSL 170

Query: 180 DPSIGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQ----CEKIAYDMN 234
             +   +LN++ DH+ R+   L  Y   K +I   +K   +C+ + Q      +   D  
Sbjct: 171 KAAAATVLNVTEDHMVRYPDGLSQYRAAKLRIYDQAK---VCVVNEQDALTLPEAGKDSR 227

Query: 235 FIGHSISRISSQSLQSDSDLYID-ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
            I   +   + Q       L ++ +S L+   T ++       T +HN  N + +  +  
Sbjct: 228 CISFGVDSGAYQLESGRQQLVVNHQSLLE---TRQIRL-----TGQHNYTNGLAALALAD 279

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIY 351
            +G+  E   +AL +  GL HR Q +     V ++NDSKATN+ S   A   L  +  +Y
Sbjct: 280 AVGIPREASIQALQTYPGLEHRFQVVHMRNGVRWVNDSKATNVGSTQAALSGLTLEGTLY 339

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQ 404
            + GG  K+ DF+ L P++S        GN+  L+ F   G ++       S L++T++Q
Sbjct: 340 LLLGGDGKAADFTPLQPYVS--------GNNIRLYCFGCDGNQLAQLRPEISVLTETMEQ 391

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           A++ +      +    +VL SP CASFDQ+N F  RG  F     E+
Sbjct: 392 AMRKI---APKLMTGDMVLLSPACASFDQFNGFEHRGHEFARLAEEL 435


>gi|2149895|gb|AAC45626.1| D-glutamic acid adding enzyme [Staphylococcus aureus]
          Length = 450

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 227/460 (49%), Gaps = 32/460 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +++ +   +S  L   ++G    ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVSREWLYSDSRKLSLLNYG----NSQGKSVIEANNVED 402

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 403 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 442


>gi|124026491|ref|YP_001015606.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. NATL1A]
 gi|123961559|gb|ABM76342.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. NATL1A]
          Length = 469

 Score =  176 bits (445), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 148/479 (30%), Positives = 234/479 (48%), Gaps = 58/479 (12%)

Query: 8   NHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAV-----KQAKDMGIEVIDFRE--- 59
           N    V GLG SG+SAA  LK  G +V+  +++          + K  GI+VI   E   
Sbjct: 8   NQIYIVLGLGCSGVSAAKLLKSEGKNVLVLENNSNENLLNISNELKSEGIKVILLDEPLH 67

Query: 60  ----IPW--SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
                PW  S+ S  V SPGI    +  H  +K     N+ + G++EL     R + +  
Sbjct: 68  INNFTPWIESVCSITV-SPGI----DWEHIALKELRGKNINVQGEVELAWE--RLTHI-- 118

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIG--LPILNLEYFSPNR----FYVIE 167
           P I +TGTNGK++   +++H+L+ N  +  +GGNIG  L  + LE    N     + V+E
Sbjct: 119 PSIGITGTNGKTTVTNMLNHILKLNNLNTDMGGNIGKALSKIALENMKNNNQELNWLVLE 178

Query: 168 CSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCE 227
            SS+QIE +P + P+IG+    +PDHL+RH+ +E+Y  IK+ ++  S   I   +D    
Sbjct: 179 LSSFQIEGSPKVAPTIGIWTTFTPDHLERHNDIESYFKIKRSLLEKSSIRIYNSDDQFLS 238

Query: 228 KIAYDMN---FIGHSISRISS--QSLQSDSDLYI--DESFLKCSATSEVIFDFSQETKKH 280
               ++    ++G +     S  Q    D   YI  D+  L  S+  ++         KH
Sbjct: 239 SKRKELPKGIWVGTNQQSFYSEYQKFWIDQKGYIFEDKKQLFHSSILKI-------PGKH 291

Query: 281 NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVI 340
           N+QNL+       ++GL    I +++ S   + HRL+ + ++ ++ F NDSKATN  S I
Sbjct: 292 NLQNLLLVIAAAREIGLDDSSIAKSIKSFRSIPHRLEYLGKINNLSFYNDSKATNFDSSI 351

Query: 341 HAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKA----YFIGNSA-----MLFFHHFG 391
               +    I  +AGG+ K  DF    P++ +I ++       G SA      L    + 
Sbjct: 352 TGLKSVPHPIILLAGGIQKKGDF---MPWVKQIKQSTNGIVLFGLSANNLKEELLMSSYT 408

Query: 392 GKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           G+I   + K L++A  + +         SI+L SP CASFDQY N+ ERG  F + V +
Sbjct: 409 GEI--IIKKNLEEATIASINIARETNSRSILL-SPACASFDQYKNYEERGDHFKNLVKK 464


>gi|308388622|gb|ADO30942.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis alpha710]
          Length = 445

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 223/461 (48%), Gaps = 41/461 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++ ++D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNVDDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNL------VT 287
              G  +   S   L+ ++D +++    +    +E +      TK   +Q L      + 
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI----ATKDIPLQGLHNAANVMA 282

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +  +C  +GL  E +   + +  GL HR++ I +   V+FI+DSK TN+ +   A    +
Sbjct: 283 AVALCEAVGLPREALLEHVKTFQGLPHRVEKIGKKNGVVFIDDSKGTNVGATAAAIAGLQ 342

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQA 405
             ++ I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A
Sbjct: 343 NPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEA 402

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
           +++     E      IVL SP CASFD +  +  R   F+ 
Sbjct: 403 VQTAYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|260913001|ref|ZP_05919486.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Pasteurella
           dagmatis ATCC 43325]
 gi|260632991|gb|EEX51157.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Pasteurella
           dagmatis ATCC 43325]
          Length = 434

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 225/454 (49%), Gaps = 42/454 (9%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACAL--KDSGVHVIAWDDHPCAV-KQAKDMGIEVIDFREI 60
           +S++N  I V GLG++GLS    L  K + V VI    +P    K   ++ +      + 
Sbjct: 3   TSYQNKRITVIGLGKTGLSCVDFLLAKQANVRVIDTRKNPTGTDKLPTNVPLHKGSLNQ- 61

Query: 61  PWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W + S  +V+SPGIA+        ++ A    V++IGDIELF RE        P IA+T
Sbjct: 62  DWLLDSDLIVVSPGIAIKTPE----IQTALSAGVKVIGDIELFCREA-----SKPIIAIT 112

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIECSSYQIELTPT 178
           G+NGKS+   L+  + + +G  V +GGNIG+P L+L     N   YV+E SS+Q+E T +
Sbjct: 113 GSNGKSTVTTLVYEMAKASGLKVGMGGNIGIPALSL--LEQNYDLYVLELSSFQLETTYS 170

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +  +   +LN++ DH+DR+  LE+Y   K +I   +K AI+   D         +  I  
Sbjct: 171 LKATSATVLNVTEDHMDRYIDLEDYRQAKLRIYHNAKTAIVNTED--------PLTTIDS 222

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIF--DFSQETKKHNIQNLVTSAVVCMQLG 296
             S +S     SD  L  +       A +E+I   D  +   +HN  N++ +  +     
Sbjct: 223 LKSAVSFGEENSDYWLKTENGKQYFMAKNEMILPCDEIKLVGRHNYMNVLAAIALAQAAN 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           + +E I+ AL    GL HR Q       V +INDSKATN+ S + A   L     ++ + 
Sbjct: 283 VSLEGIRTALREFSGLDHRFQLAHFANGVYWINDSKATNVGSTVAALTGLQVAGHLHLLL 342

Query: 355 GGLSKSDDFSTLFPFISK--IAKAYFIGNSAMLFFHHFGGKIN--STLSKTLDQALKSVV 410
           GG  K  DFS L   I +  I    F  + A L       K++  S L  T++QA+ ++ 
Sbjct: 343 GGDGKEADFSELSTLIQQPHIYCYCFGKDGAQL------AKLSQQSQLFDTMEQAINAL- 395

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
               N++   +VL SP CAS DQ+ +F +RG  F
Sbjct: 396 --RPNLKEGDMVLLSPACASLDQFTSFEQRGDEF 427


>gi|304386674|ref|ZP_07368956.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Neisseria
           meningitidis ATCC 13091]
 gi|304339259|gb|EFM05337.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Neisseria
           meningitidis ATCC 13091]
          Length = 445

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 133/458 (29%), Positives = 220/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVI----DFR 58
           +  N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++      +
Sbjct: 2   TLENKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNSDDVFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +    +E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI-ATQDIPLQGLHNATNVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A+++
Sbjct: 346 FVILGGMGKGQDFTPLCDALAGKAKGVFLIGIDAPKIRRDLDGCGLNMTDCATLEEAVQT 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIG 440


>gi|75907016|ref|YP_321312.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Anabaena
           variabilis ATCC 29413]
 gi|122063235|sp|Q3MF19|MURD_ANAVT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|75700741|gb|ABA20417.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Anabaena
           variabilis ATCC 29413]
          Length = 455

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 221/461 (47%), Gaps = 32/461 (6%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEVIDFR-----EIPWSII 65
           V GLG+SG++AA  LK  G  V+  D +     +KQ +++  E I        +   ++ 
Sbjct: 6   VVGLGKSGVAAARLLKREGWEVVLSDRNTSDTLLKQQQELAKEQITVELGYSLDFAGALP 65

Query: 66  SFLVLSPGIALTGENAHWCVKL---ANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
             +V+SPG+        W +     A +  +E IG++EL    R   SL  P++ +TGTN
Sbjct: 66  DLIVVSPGVP-------WDIPALVKARELGIETIGEMEL--AWRHLKSL--PWVGITGTN 114

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYF-SPNRFYVIECSSYQIELTPTIDP 181
           GK++T ALI+ + +  G+D    GNIG     +    +P  + + E SSYQIE + T+ P
Sbjct: 115 GKTTTTALIAAIFQAAGFDAPACGNIGYAACEVALAATPPDWIIGEMSSYQIESSLTLAP 174

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
            I +    +PDHL RH TLENY +IK K++  S   +   +D    KI        +  S
Sbjct: 175 HISIWTTFTPDHLARHKTLENYYDIKAKLLRQSHLQVFNGDDAYLSKIGASHWPDAYWTS 234

Query: 242 RISSQSLQSDSDLYIDESFL------KCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQL 295
                 L  D   YI++ ++        S    V  +  +    HN+QNL+ +       
Sbjct: 235 VKGKDYLIGDKGFYIEDGWVVEQLQPNSSPQRIVAAEALRMVGAHNLQNLLMAVAAARLA 294

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
            +    I +A+    G+ HRL+ I     + FINDSKATN  +      + K  +  IAG
Sbjct: 295 DIPPNAIDKAVREFPGVAHRLEHICTWQGIDFINDSKATNYDAAEVGLASVKSPVILIAG 354

Query: 356 GLSK-SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFG--GKINSTLSKTLDQALKSVVRD 412
           G +K  DD + L     + +    IGN+A  F       G  N  + +T++QA++  +  
Sbjct: 355 GEAKPGDDAAWLAKIQGQTSAVLLIGNAAPAFAQRLQEIGYSNYEIVETMEQAVRRSLDL 414

Query: 413 VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
            ++ Q P +VL SP CASFDQY NF  RG  F     E+ G
Sbjct: 415 AKHHQAP-VVLLSPACASFDQYPNFEARGDHFRQLCLELVG 454


>gi|301063235|ref|ZP_07203784.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [delta
           proteobacterium NaphS2]
 gi|300442663|gb|EFK06879.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [delta
           proteobacterium NaphS2]
          Length = 467

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 136/455 (29%), Positives = 217/455 (47%), Gaps = 33/455 (7%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCA------VKQAKDMGI--EVIDFREIPWSI 64
           V GLG SG  AA  L + G  V   D    +        +   +G+  E    RE  +  
Sbjct: 20  VVGLGTSGYWAAKWLVEKGAEVTVSDAREASRLNDEYQNELNSLGVSLETGKHREKTFLE 79

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
              +VLSPG+ L        +K A +  + IIG++EL  R      +  P IA TGTNGK
Sbjct: 80  TDAIVLSPGVPLDTP----FMKAALKRQIPIIGEMELAARH-----VDVPIIAATGTNGK 130

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           ++  + +  +L   G  V +GGNIG P+   L       + V+E SS+Q++      P I
Sbjct: 131 TTVTSFLGRMLEDQGLAVFVGGNIGTPLTAYLMGEMKADYLVVEISSFQLDTIERFTPEI 190

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIV-TMSKHAIICINDHQCEKIAYDMNFIGHSISR 242
            ++LNISPDHLDR+     Y++ K +I         + +ND     +       G S+ R
Sbjct: 191 SIILNISPDHLDRYADYSAYIHSKLRIFENQGAGQTVILNDDDI-VLKKTTPPEGTSVLR 249

Query: 243 ISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLGLKVE 300
              +   +  D +I+   +  + T +  F+ S  +    HN++NL+   +    LGL  E
Sbjct: 250 YGLKK-GAGIDAFIENEGILSAVTEKGRFNLSAFSLPGAHNLENLLAVVLAGQALGLAPE 308

Query: 301 EIKRALLSCGGLTHRLQTIARLGH------VIFINDSKATNLHSVIHAFLNEKRRIYWIA 354
            I++ + +  GL++RL+ +   GH      V F NDSKATN+ + + A  +  + +  IA
Sbjct: 309 PIQKTINAFKGLSNRLERVCANGHGFLQKKVQFYNDSKATNVDAAVRAVQSFDKPLILIA 368

Query: 355 GGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           GG  K  ++  L       +  A F+G SA L    F G+   +L++T+  A+K      
Sbjct: 369 GGRHKGSNYQPLVNACKGHVKGAVFMGESASLLAEAFTGETPFSLAETMPDAVKKAAHMA 428

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           E+     +VL +P C+SFD + N+ +RG +F S V
Sbjct: 429 ES---GDVVLLAPACSSFDMFENYDQRGRAFKSAV 460


>gi|294635007|ref|ZP_06713524.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Edwardsiella
           tarda ATCC 23685]
 gi|291091606|gb|EFE24167.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Edwardsiella
           tarda ATCC 23685]
          Length = 438

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 137/460 (29%), Positives = 218/460 (47%), Gaps = 36/460 (7%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           ++ ++   + + GLG +GLS      + GV   VI     P  + +        +   E 
Sbjct: 1   MADYQGKKVVIIGLGLTGLSCVDFFIERGVVPRVIDTRPTPPGLDKLPASVERHLGGIEQ 60

Query: 61  PWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W +    +V SPGIAL+       +  A Q  +EI+GDIELF RE      Q+P +A+T
Sbjct: 61  SWLMEADLIVASPGIALSSP----ALDQAAQAGIEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  +    G+ V +GGNIG+P L L      R YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAHAAGWPVGVGGNIGVPALTL-LKQECRLYVLELSSFQLETTHSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN+S DH++R+   L+ Y   K +I   ++  ++  +D      A  M   G 
Sbjct: 171 KAAAATILNVSEDHMNRYPLGLQQYRAAKLRIYEQARACVVNADD------ALTMPIHGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +      E I + S  Q T  HN  N + +  +   +G
Sbjct: 225 DARCVSFGVDVGDYHLNRQQGEIWLRVRGEKILNTSEMQLTGMHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      RAL +  GL HR Q +     V +INDSKATN+ S   A   L+    ++ + 
Sbjct: 285 LPRASSLRALTTFRGLAHRFQLVLDHNGVRWINDSKATNVGSTEAALKGLHLNGTLHLLL 344

Query: 355 GGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLS---KTLDQALKSVV 410
           GG  K+ DF+ L P++  +  + Y  G  A         ++   +S    T++QA++++ 
Sbjct: 345 GGDGKAADFTPLLPYLQGERIRLYCFGRDADPLM-----QLRPEVSLRFTTMEQAMRAIT 399

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
             + +     +VL SP CAS DQ+ NF +RG  F     E
Sbjct: 400 PQLRS---GDMVLLSPACASLDQFKNFEQRGDEFARLARE 436


>gi|295399713|ref|ZP_06809694.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|294978116|gb|EFG53713.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacillus
           thermoglucosidasius C56-YS93]
          Length = 451

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 236/485 (48%), Gaps = 69/485 (14%)

Query: 1   MKLSSF-RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVI 55
           MK ++F + H + V GL +SG +AA  L + G  V   D  P       ++ + +GI V+
Sbjct: 1   MKQTAFYQQHRVLVIGLAKSGFAAAKLLHELGAIVTVNDRKPFEENEEAQRLEQLGIRVV 60

Query: 56  ------DFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                 +  + P+ +I   V +PGI  T       VK A + ++ +I ++EL      + 
Sbjct: 61  CGGHPLELLDEPFDLI---VKNPGIPYTNP----IVKKAIEKHLPVITEVEL-----AYH 108

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIEC 168
             ++PFI +TG+NGK++T  LI  +LR+      L GNIG+    + +    N + V E 
Sbjct: 109 ISEAPFIGITGSNGKTTTTTLIYEMLREGEKRPLLAGNIGVAACEVAQKAEANNWLVTEL 168

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQ 225
           SS+Q+       P I VLLNI   HLD H T E Y   K  I    T   +A++  +D  
Sbjct: 169 SSFQLAGIRDFRPHISVLLNIFDAHLDYHGTKEAYAQAKANIFKNQTNEDYAVVNADDEL 228

Query: 226 CEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCS-----ATSEVIFDFSQETKKH 280
             ++A   N     +  I S + + DS  YI + ++  +     A S+++        KH
Sbjct: 229 VMRLA--ENSCAQKV--IFSATKKLDSGAYIKDGWIYWNDEAVIAVSDIVL-----PGKH 279

Query: 281 NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL---H 337
           N++N++ +  V    G+  + I + L +  G+ HRLQ IA +    F NDSKATN+    
Sbjct: 280 NLENILAAVAVAKLTGVDNKAIAKVLTTFTGVKHRLQYIATIDGRKFFNDSKATNILATQ 339

Query: 338 SVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST 397
             + AF  EK  +  +AGGL + ++F  L P++  +         A++ F    G+  + 
Sbjct: 340 RALSAF--EKDSVILLAGGLDRGNEFDALLPYLHNV--------KAIILF----GQTAAK 385

Query: 398 LSKTLDQALKSVVRDVENVQ--LP---------SIVLFSPGCASFDQYNNFRERGFSFMS 446
           +++   QA    +  V+NV+  +P          ++L SP CAS+DQY  F +RG  F++
Sbjct: 386 IARVAKQAGIETIEYVDNVEKAVPVAYQLSEPGDVILLSPACASWDQYKTFEQRGDIFIN 445

Query: 447 QVSEI 451
            V ++
Sbjct: 446 AVHKL 450


>gi|312111768|ref|YP_003990084.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacillus sp.
           Y4.1MC1]
 gi|311216869|gb|ADP75473.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Geobacillus sp.
           Y4.1MC1]
          Length = 451

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 236/485 (48%), Gaps = 69/485 (14%)

Query: 1   MKLSSF-RNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVI 55
           MK ++F + H + V GL +SG +AA  L + G  V   D  P       ++ + +GI V+
Sbjct: 1   MKQTAFYQQHRVLVIGLAKSGFAAAKLLHELGAIVTVNDRKPFEENEEAQRLEQLGIRVV 60

Query: 56  ------DFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                 +  + P+ +I   V +PGI  T       VK A + ++ +I ++EL      + 
Sbjct: 61  CGGHPLELLDEPFDLI---VKNPGIPYTNP----IVKKAIEKHLPVITEVEL-----AYH 108

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIEC 168
             ++PFI +TG+NGK++T  LI  +LR+      L GNIG+    + +    N + V E 
Sbjct: 109 ISEAPFIGITGSNGKTTTTTLIYEMLREGEKRPLLAGNIGVAACEVAQKAEANNWLVTEL 168

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQ 225
           SS+Q+       P I VLLNI   HLD H T E Y   K  I    T   +A++  +D  
Sbjct: 169 SSFQLAGIRDFRPHISVLLNIFDAHLDYHGTKEAYAQAKANIFKNQTNEDYAVVNADDEL 228

Query: 226 CEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCS-----ATSEVIFDFSQETKKH 280
             ++A   N     +  I S + + DS  YI + ++  +     A S+++        KH
Sbjct: 229 VMRLA--ENSCAQKV--IFSATKKLDSGAYIKDGWIYWNDEAVIAVSDIVL-----PGKH 279

Query: 281 NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL---H 337
           N++N++ +  V    G+  + I + L +  G+ HRLQ IA +    F NDSKATN+    
Sbjct: 280 NLENILAAVAVAKLTGVDNKAIAKVLTTFTGVKHRLQYIATIDGRKFFNDSKATNILATQ 339

Query: 338 SVIHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINST 397
             + AF  EK  +  +AGGL + ++F  L P++  +         A++ F    G+  + 
Sbjct: 340 RALSAF--EKDSVILLAGGLDRGNEFDALLPYLHNV--------KAIILF----GQTAAK 385

Query: 398 LSKTLDQALKSVVRDVENVQ--LP---------SIVLFSPGCASFDQYNNFRERGFSFMS 446
           +++   QA    +  V+NV+  +P          ++L SP CAS+DQY  F +RG  F++
Sbjct: 386 IARVAKQAGIETIEYVDNVEKAVPVAYRLSEPGDVILLSPACASWDQYKTFEQRGDIFIN 445

Query: 447 QVSEI 451
            V ++
Sbjct: 446 AVHKL 450


>gi|269118797|ref|YP_003306974.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sebaldella
           termitidis ATCC 33386]
 gi|268612675|gb|ACZ07043.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Sebaldella
           termitidis ATCC 33386]
          Length = 445

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 139/466 (29%), Positives = 218/466 (46%), Gaps = 53/466 (11%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSP 72
           VFG G SG  A   L+  G +V   DD    +K  +  GI++ID ++I      F+V SP
Sbjct: 6   VFGAGLSGHGAKELLEKKGYNVFLIDD-KTGIKSEE--GIKIIDEQKI-----EFIVKSP 57

Query: 73  GIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALIS 132
           GI    E     ++ A+   + +I +I+L  R   +   ++  I++TGTNGK++T   I 
Sbjct: 58  GIPWDAE----LLEKADSLRISVISEIDLAYR---YMDKKTKIISITGTNGKTTTATKIY 110

Query: 133 HVLRKNGYDVQLGGNIGLPILNL--EYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNIS 190
            +L++ G+D +L GN G     L  +   P+ + V+E SSYQ+E  P +   I  ++N++
Sbjct: 111 ELLKEAGFDAELAGNAGFSFAKLVSDGKEPD-YVVLELSSYQLENDPEVHSHIAGIINLT 169

Query: 191 PDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQS 250
           PDHL R+++L++Y   K             I DHQ E     +N     I RI S++   
Sbjct: 170 PDHLTRYNSLDDYYKTK-----------FNIFDHQNENDYALINLDDKEILRIISENKDI 218

Query: 251 DSDLYIDESFLKCSATSEV--------IFDFSQE------------TKKHNIQNLVTSAV 290
           D  +     FL     ++V        + D + +              KHN++N++    
Sbjct: 219 DDKIKAKRIFLSGEKKADVFQKDGMINVTDHNSQLIPLMKTSELSLKGKHNLENILFIIS 278

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           V M L + +E +K  L S   L HRL+     G  +FINDSK TN  S I A     +  
Sbjct: 279 VGMILNVDIEVMKSFLSSTKPLEHRLENFFEKGKTVFINDSKGTNSESTIKAIEAFGKST 338

Query: 351 YWIAGGLSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLS--KTLDQALK 407
             I GG  K      L   I+ K+   Y IG ++ +       +  +     KTL+  L 
Sbjct: 339 VLICGGYDKQASNKELIDKIAEKVEFVYLIGQTSDILEKELKDQKYTQYKNLKTLENVLN 398

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
             ++D  +     +VLFSP  +SFDQ+ NF +RG  F    ++I G
Sbjct: 399 D-IKDNLDFSKEQVVLFSPATSSFDQFKNFEDRGRIFKELTNQIIG 443


>gi|54310305|ref|YP_131325.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Photobacterium profundum SS9]
 gi|60390455|sp|Q6LMF4|MURD_PHOPR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|46914746|emb|CAG21523.1| putative UDP-N-acetylmuramoylalanine-D-glutamate ligase
           [Photobacterium profundum SS9]
          Length = 447

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 140/474 (29%), Positives = 219/474 (46%), Gaps = 79/474 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS           V  W      ++Q  D  I+VID R  P         
Sbjct: 10  VVVIGLGMTGLSV----------VNFW------LRQTGDRDIKVIDTRATPPGQDKLPSS 53

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V SPGIAL        +  A    +EI+GDIELF R     
Sbjct: 54  VELCAGQWNMNWLLEADLIVASPGIALATPE----LVAAKAAGIEIVGDIELFAR----- 104

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECS 169
            +  P +A+TG+NGKS+  +LI  + ++ G +V +GGNIG   L++   + +  YV+E S
Sbjct: 105 VVTKPVVAITGSNGKSTVTSLIGEMAKEAGINVGVGGNIGFAALDM-LVNEHDLYVLELS 163

Query: 170 SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND------ 223
           S+Q+E T ++     V LN+S DH+DR++ LE+Y   K +I   ++ A+   +D      
Sbjct: 164 SFQLETTSSLQLKAAVYLNLSEDHMDRYNGLEDYSLAKMRIFEHAELAVYNRDDLATFPV 223

Query: 224 ---HQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKH 280
              HQ     +D    G         +L  +  L +DE  +    TS++         +H
Sbjct: 224 SFSHQITSFGFDNQDYGLV-------TLHGEEFLALDEQPIM--KTSDIAL-----VGRH 269

Query: 281 NIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVI 340
           N+ N + +  +   + +  + + RAL    GL HR Q +     V ++NDSKATNL S +
Sbjct: 270 NVANSLAALALADAVNIDRQAVCRALQRYNGLAHRCQLVVNQHDVKWVNDSKATNLASTL 329

Query: 341 HAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINST 397
            A   LN   +++ + GG  K  DFS L   ++ +  + Y  G     F       I   
Sbjct: 330 AALKGLNLPGKLHLLVGGDGKGADFSELKLVLADLNVQLYCFGRDGNQFMPLVDAPI--- 386

Query: 398 LSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             +T+ QA+       +  Q   ++L SP CASFDQ+ NF  RG +F+ Q   +
Sbjct: 387 CIETMAQAMAIA---ADTAQKGDMILLSPACASFDQFPNFMARGDAFIEQAKAL 437


>gi|84394436|ref|ZP_00993152.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           splendidus 12B01]
 gi|84374935|gb|EAP91866.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           splendidus 12B01]
          Length = 438

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 132/468 (28%), Positives = 218/468 (46%), Gaps = 65/468 (13%)

Query: 9   HSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP------- 61
            ++ V GLG +GLS          H++ +  H           ++VID RE+P       
Sbjct: 8   QNVVVVGLGITGLSVVK-------HLVKYQPH---------THVKVIDTRELPPGKESLP 51

Query: 62  -------------WSIISFLVLS-PGIALTGENAHWCVKLANQFNVEIIGDIELFVRERR 107
                        W   + LV++ PGIAL        +    Q    ++GDIELF     
Sbjct: 52  ESVELHSGSWNSQWLAEADLVIANPGIALATPEIQDVI----QAGTPVVGDIELFGW--- 104

Query: 108 FSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIE 167
             ++  P +A+TG+NGKS+   L   + +  G +V +GGNIG+P L+L        YV+E
Sbjct: 105 --AVDKPVVAITGSNGKSTVTDLTGVLAKAAGLNVGVGGNIGIPALDLLELD-ADLYVLE 161

Query: 168 CSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCE 227
            SS+Q+E T +++ +    LN+S DH+DR+  + +Y + K +I   +++AI+   D +  
Sbjct: 162 LSSFQLETTSSLNLAAAAFLNLSEDHMDRYQGMADYRDAKLRIFNNAQYAIVNREDKETY 221

Query: 228 KIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
              Y M  +   +          D   ++ ++      T ++         +HN+ N + 
Sbjct: 222 P-DYSMPLVTFGLDDQEFGVATIDGTEWLVDNSKPVLPTQDLTL-----VGRHNVANALV 275

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LN 345
           S  +  Q+G+   +   AL +  GLTHR Q +A    + ++NDSKATN+ S + A   L 
Sbjct: 276 SLALLKQVGIDYSKSLEALKAYNGLTHRCQVVADKRSIKWVNDSKATNVASTLAALSGLE 335

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKAY---FIGNSAMLFFHHFGGKINSTLSKTL 402
            +  +Y + GG+ K  DFS L P +S++ +     F  ++A     H   K   T+   +
Sbjct: 336 YQGTLYLLVGGVGKGADFSELEPVLSQLERVQLCCFGEDAAQFMPLHPSAKTFDTMRDII 395

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           +   K +V          +V+ SP CASFDQ+NNF  RG +F     E
Sbjct: 396 ESVSKQLVAG-------DMVMLSPACASFDQFNNFMARGDAFTDLAHE 436


>gi|331006871|ref|ZP_08330124.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [gamma
           proteobacterium IMCC1989]
 gi|330419322|gb|EGG93735.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [gamma
           proteobacterium IMCC1989]
          Length = 454

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 133/462 (28%), Positives = 219/462 (47%), Gaps = 44/462 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISF----- 67
           V GLG +GLS A  L+ +    I  D      +   ++ +   +F EI   + S      
Sbjct: 12  VIGLGMTGLSVARYLQKTNQRFIVLDSR----ETPPNLEVFQQEFPEITLHLGSLDKQLL 67

Query: 68  -----LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
                +V+SPG++L        +       V I+GDIELF R     ++  P IA+TG+N
Sbjct: 68  CSASEIVISPGVSLKTPELQAAIAEG----VSIVGDIELFAR-----AVTKPVIAITGSN 118

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
            KS+   L+  +    G    +GGN+G+P+L L   +    +V+E SS+Q+E T ++ P 
Sbjct: 119 AKSTVTTLVGEMAAACGLLPAVGGNLGVPVLELLNNTLADVFVLELSSFQLETTYSLKPV 178

Query: 183 IGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICIND--------HQCEKIAYDMN 234
              +LN+S DH+DR+ +L  Y  +K++I   ++  II   D         +   I++ ++
Sbjct: 179 AATVLNVSHDHMDRYASLAEYHQVKQRIYRHAESIIINRQDVLTQPPLSKEANVISFGVD 238

Query: 235 FIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
             G+S    S   L     L++   F    +T ++     Q   +HN  N + +  +   
Sbjct: 239 SAGNSPDMRSFGLLAQGDKLFLSHKFAPLLSTEDI-----QIKGRHNYANALAALALGSA 293

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF----LNEKRRI 350
            G  +E +  AL +  GL HR + IA +  V +INDSK TN+ + + A     +  ++ I
Sbjct: 294 AGFGMEGMLDALKTFKGLQHRCEYIATVNDVTYINDSKGTNVGATLAAIEGFSVKNEKNI 353

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAY-FIGNSAMLFFHHFGGKINSTLSKTLDQALKSV 409
             IAGG  K  DFS L   +++  K    IG+ A   ++     ++   +++L  A+K  
Sbjct: 354 VLIAGGDGKGADFSPLVDAVNRSVKTLILIGHDAEKLYNMLHQVVSCVKAESLIDAVKQA 413

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                N     +VL SP CASFD ++ F ERG  F   V E+
Sbjct: 414 SI---NAGKGDVVLLSPACASFDMFSGFEERGRQFGVAVQEL 452


>gi|87301212|ref|ZP_01084053.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. WH 5701]
 gi|87284180|gb|EAQ76133.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. WH 5701]
          Length = 463

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 146/475 (30%), Positives = 224/475 (47%), Gaps = 47/475 (9%)

Query: 8   NHSIAV-FGLGRSGLSAACALKDSGVHVIAWDD--HPCAVKQAKDM---GIEVIDFREIP 61
           +H +AV  GLGRSG  AA  LK SG  V+  +   +P   +QA+D+   G+EV    E+ 
Sbjct: 5   SHPLAVVIGLGRSGSGAARLLKASGQRVLVLESRRNPELEQQAEDLRAGGVEV----ELG 60

Query: 62  WSIIS-----------FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSS 110
            S+ S            +V+SPGI       H  +K   +  V + G++ +       +S
Sbjct: 61  QSLASESFAQLQPGTDRVVVSPGIRWD----HPVLKALRERGVRVCGEMSVAWE----AS 112

Query: 111 LQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL------EYFSPNRFY 164
            + P+I +TGTNGK++   L+SH+L   G D  + GN+G+    L         +P  + 
Sbjct: 113 NEIPWIGITGTNGKTTVTHLLSHILNHAGLDAPMVGNVGISAAELLIERREAGATPPDWL 172

Query: 165 VIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH 224
           V+E SSYQIE +  + P +G+   ++PDHL+RH TLE Y  IK+ ++      ++  +D 
Sbjct: 173 VVELSSYQIESSAELAPRLGLWTTLTPDHLERHGTLEAYRAIKRSLLQNCGEQLLNADDA 232

Query: 225 QCEKIA--YD-MNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KK 279
                A  +D   ++     R+    LQ    L+ID   +   A S  +F  +       
Sbjct: 233 DLRAHAGSWDRATWVTAGTRRLLGAGLQ--PFLWIDGGMVM--AASGPLFSAAALALPGA 288

Query: 280 HNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV 339
           HN QN+V +A   ++LGL+   I+ AL S  G+ HRL+ I  L  V + NDSKATN  + 
Sbjct: 289 HNRQNMVLAAATALKLGLEPAVIEAALRSFPGVPHRLEQIRLLDGVRWFNDSKATNYDAA 348

Query: 340 IHAFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHF--GGKINST 397
                     +  +AGG  K  D       + + A A  +  +A   F     G     T
Sbjct: 349 EVGITAVDGPMVVLAGGEIKQGDPEAWLEALGRQAAAVVLFGAAREAFAALLSGSGYAGT 408

Query: 398 LSKTLDQALK-SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +     QA    + R++        VL SP CASFDQY +F  RG  F + V+ +
Sbjct: 409 VELVEGQAEAVPLARELARRLGCPTVLLSPACASFDQYKDFEARGEHFRTLVAAL 463


>gi|242373469|ref|ZP_04819043.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus epidermidis M23864:W1]
 gi|242348832|gb|EES40434.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus epidermidis M23864:W1]
          Length = 449

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 135/459 (29%), Positives = 226/459 (49%), Gaps = 31/459 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +VI  D    +     K  + MGIEV+ 
Sbjct: 2   LNYTELENKNVLVVGLAKSGYEAAKILAKLGANVIVNDGKDLSQDAHAKDLESMGIEVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P S++     +V +PGI  T       +  A +  ++I+ ++EL      +   ++
Sbjct: 62  GGH-PLSLLDNNPIIVKNPGIPYTVS----IIDEAVRRGLKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P+ + + E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSVLTGRLSGNIGYVASKVAQEARPDEYLITELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV-TMSKHAIICINDHQCEKIAY 231
           +       P I ++ NI   HLD H TLENY N KK+I    +K   +  N HQ   I  
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHETLENYQNAKKQIYKNQTKDDYLICNYHQRHLIES 231

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVV 291
           + N    ++   + Q +     +YI + F+  +    +         +HN++N++ + + 
Sbjct: 232 E-NLKAKTMYFSTQQEVDG---IYIKDGFIVYNGIRIINVKDLVLPGEHNLENILAAVLA 287

Query: 292 CMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIY 351
            +  G+ V+ I  +L +  G+ HRLQ I       + NDSKATN  +   A  + K+ I 
Sbjct: 288 AILAGVPVKAIVDSLTTFSGIDHRLQYIGTNRTNKYYNDSKATNTLATQFALNSFKQPII 347

Query: 352 WIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKSV 409
           W+ GGL + +DF  L P+++ +      G +   F      K+ ++  K + +A  ++  
Sbjct: 348 WLCGGLDRGNDFDELIPYMNNVRIMVVFGETQEKF-----AKLGNSQGKYVIKATDVEDA 402

Query: 410 VRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
           V  ++ V  P+ +VL SP CAS+DQYN F ERG  F+ +
Sbjct: 403 VDKIQEVIEPNDVVLLSPACASWDQYNTFEERGEKFIER 441


>gi|78184101|ref|YP_376536.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. CC9902]
 gi|118595699|sp|Q3AZI5|MURD_SYNS9 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|78168395|gb|ABB25492.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           CC9902]
          Length = 462

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 145/460 (31%), Positives = 209/460 (45%), Gaps = 42/460 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVI------AWDDHPCAVK-QAKDMGIEVIDFREI----P 61
           V GLGRSGL AA  L   G  V+        D   CA   QA+ + +E+    EI    P
Sbjct: 6   VVGLGRSGLGAARLLHHQGQKVVVLERGTGPDQTSCAATLQAEGIQVELGIPLEINSFEP 65

Query: 62  W-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIAVT 119
           W S +  +V+ PGI       H  +    Q  V+I G+IEL      + +L   P++ +T
Sbjct: 66  WRSDLDAVVVGPGIPWD----HPTLNGLRQEGVQIRGEIELA-----WEALNDIPWVGIT 116

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIG-------LPILNLEYFSPNRFYVIECSSYQ 172
           GTNGK++   L+SHVL   G    +GGN+G       L I   E   P+ + V+E SSYQ
Sbjct: 117 GTNGKTTVTHLLSHVLGHAGIVAPMGGNMGVSAADMALKIRRGETPKPD-WLVMELSSYQ 175

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD 232
           IE  P + PSIG+   ++PDHL+RH TLE Y  IK  ++  S  AI   +D         
Sbjct: 176 IEAGPNLAPSIGIWTTLTPDHLERHGTLEAYRAIKHSLLQRSSLAIFNGDDADLSAHRPS 235

Query: 233 MNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAV 290
           +   G  +           +D +ID++    +     +F          HN QNL+    
Sbjct: 236 LKR-GMWVKAAPPCHDDPPADFWIDDAGTVQAREGGAMFPAKVLAMPGAHNRQNLLLVTA 294

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
              Q+GL  E+I + L S  G+ HRL+ +         NDSKATN  +           +
Sbjct: 295 AAAQIGLNAEQIAQGLESFPGVPHRLENLGSTSSADVFNDSKATNYDAAAVGLQAMAGPV 354

Query: 351 YWIAGGLSKSDDFST-LFPFISKIAKAYFIGNS-----AMLFFHHFGGKINSTLSKTLDQ 404
             +AGG +K  + +  L    SK       G       A++   ++ G+++      L  
Sbjct: 355 VVLAGGQTKRGNATGWLAELKSKACAVVLFGAGAEELDALIRQSNYQGQVHRCTD--LSA 412

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           A+   VR    +Q  S+ L SP CASFDQY +F  RG  F
Sbjct: 413 AVAIAVRATSELQASSL-LLSPACASFDQYQDFEARGDHF 451


>gi|325130846|gb|EGC53579.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis OX99.30304]
          Length = 445

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 222/461 (48%), Gaps = 41/461 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++ ++D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNVDDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNL------VT 287
              G  +   S   L+ ++D +++    +    +E +      TK   +Q L      + 
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI----ATKDIPLQGLHNAANVMA 282

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +  +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +
Sbjct: 283 AVALCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQ 342

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQA 405
             ++ I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A
Sbjct: 343 NPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEA 402

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
           +++     E      IVL SP CASFD +  +  R   F+ 
Sbjct: 403 VQTAYAQAEAC---DIVLLSPACASFDMFKGYAHRSEVFIE 440


>gi|332362875|gb|EGJ40668.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Streptococcus
           sanguinis SK49]
          Length = 459

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 139/481 (28%), Positives = 229/481 (47%), Gaps = 62/481 (12%)

Query: 2   KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP----CAVKQAKDMGIEVIDF 57
           K+++F N  + V GL +SG SAA  L   G  V   D  P     A +   + GI+V+  
Sbjct: 12  KIANFANKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFEENPAAQSLLEEGIKVVTG 71

Query: 58  REIPWSII----SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
              P  ++      +V +PGI    +NA   V  A + N+ +I ++EL      +   ++
Sbjct: 72  GH-PLELLDEDFELMVKNPGIPY--DNA--MVVRALEKNIPVITEVEL-----AYLISEA 121

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P + +TG+NGK++T  +I+ VL   G +  L GNIG P   + +  S     V+E SS+Q
Sbjct: 122 PIVGITGSNGKTTTTTMIAQVLTAGGQNGLLSGNIGFPASQVAQTASSKDTLVMELSSFQ 181

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIK---KKIVTMSKHAIICINDHQCEKI 229
           +     + P I V+ N+ P HLD H +LE+Y   K   +K +T   + ++  N    +++
Sbjct: 182 LMGIEALHPQIAVITNLMPTHLDYHGSLEDYAAAKWNIQKNMTADDYLVLNFNQDWAKEM 241

Query: 230 AYD-----MNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQN 284
           A       M F   +  ++    L+ D   +  E+ ++ +   E+    S     HN++N
Sbjct: 242 ASQTQATVMPF--STTEKVDGAYLEGDVLTFRGEAIMQAA---EIGVPGS-----HNVEN 291

Query: 285 LVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFL 344
            + +  V    G+  + IK  L + GG+ HRLQ + R+  V F NDSK+TN+ +   A  
Sbjct: 292 ALATIAVAKLRGIDNQTIKEVLSAFGGVKHRLQYVGRVNEVAFYNDSKSTNILATQKALS 351

Query: 345 N-EKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD 403
             +  ++  IAGGL + ++F  L P +  + K   +G SA              + +  D
Sbjct: 352 GFDNSKVILIAGGLDRGNEFDELVPDLKGLKKMVILGQSA------------PRVKRAAD 399

Query: 404 QALKSVVRDVENVQLPS-----------IVLFSPGCASFDQYNNFRERGFSFMSQVSEIP 452
           QA  S + D  +VQ  +           IVL SP  AS+D Y+NF  RG  F++   E+ 
Sbjct: 400 QAGVSYL-DATDVQDAAHKAFAQAEPGDIVLLSPANASWDMYSNFEVRGDEFLAAFEELK 458

Query: 453 G 453
           G
Sbjct: 459 G 459


>gi|258593038|emb|CBE69349.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [NC10 bacterium
           'Dutch sediment']
          Length = 460

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 131/456 (28%), Positives = 222/456 (48%), Gaps = 36/456 (7%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHP--------CAVKQ---AKDMGIEVIDFRE 59
           + V GL RSG +A   L   G  V+  D           C+++Q   + ++G + +  R 
Sbjct: 9   VVVIGLARSGEAACRLLLKQGAAVVGTDRRGEREVGADLCSLEQDGVSLELGKQYL--RS 66

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
           +P +    +V+SPGI L         +   +  + +IG++EL  R   +S   + FI +T
Sbjct: 67  LPSA--DLVVVSPGIDLR----EPRFRRVREAGIPLIGEVELAYR---YSD--ATFIGIT 115

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIELTPT 178
           GTNGKS+T  LI  +L++ G    + GNIG P+  +    +     V E SS+Q+E    
Sbjct: 116 GTNGKSTTTTLIGAMLKQAGLPSYVAGNIGTPLCRVAPSLAAGECVVAELSSFQLETIDE 175

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMNF 235
             P + +LLN++PDHLDR+  +E+Y   K +I      S  A+I  +D    +++     
Sbjct: 176 FRPRVALLLNLAPDHLDRYDQVEDYYRAKARIFENQRPSDFAVINADDPLVLQVSAQAR- 234

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLVTSAVVCM 293
            G  I+   ++ L + + +  D+  L      EVI   S+   +  HN++N + + +   
Sbjct: 235 -GRRIAFSRTRPLDTGAYVEDDQLMLALDGVREVICRKSELKIQGVHNLENALAAGLAAA 293

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
             G     I+ AL S  GL HRL+ +A +  V +INDSK TN+ +V+ +  +    +  I
Sbjct: 294 VAGTPTTAIRIALTSFEGLEHRLEFVAEIAGVRYINDSKGTNVGAVVRSLESFTNPVVLI 353

Query: 354 AGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           AGG  K  DF+ L P +  ++ +   IG +A            + +  +L++A++     
Sbjct: 354 AGGRDKHGDFAPLIPLVRERVKRLILIGEAAETLRRMLASVCPTEVVSSLEEAVRRAAAA 413

Query: 413 VENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
               +   +VL SP CASFD + +F +RG  F + V
Sbjct: 414 ASPGE---VVLLSPACASFDMFTDFEDRGRVFKAAV 446


>gi|163751822|ref|ZP_02159038.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
           benthica KT99]
 gi|161328307|gb|EDP99468.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Shewanella
           benthica KT99]
          Length = 449

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 141/458 (30%), Positives = 210/458 (45%), Gaps = 49/458 (10%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFREIPWSIISF--- 67
           V GLG +GLS    L   G+  +  D  + P   KQ        ++F E+      F   
Sbjct: 9   VLGLGTTGLSVVRYLCRQGITPLVMDSREQPPGAKQL------ALEFPEVNLITGGFDCR 62

Query: 68  -------LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
                  +V+SPGIAL        ++ A   ++E+IGD+ELF R  + SS  S  I +TG
Sbjct: 63  YLVQASQIVISPGIALDTPE----IRAAIDMDIEVIGDVELFARAVKNSS--SCVIGITG 116

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           +NGKS+   L+  + +  G +  +GGNIG+P+L+L   SP   Y++E SS+Q+E T +++
Sbjct: 117 SNGKSTVTTLVGEMAKAAGLNYAVGGNIGIPVLDL-LQSPIDLYILELSSFQLETTHSLN 175

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCE-KIAYDMNFIGHS 239
                 LNIS DH+DR+  LE Y   K  +   SK A+    D   +     D N  G +
Sbjct: 176 CIAATCLNISEDHMDRYRDLEAYRQAKLSLYDQSKRALFNREDSLTQPNDPMDQNSFGLT 235

Query: 240 ISRISSQSLQSDSDLYIDESFLKCSATSEVI-FDFSQETKKHNIQNLVTSAVVCMQLGLK 298
            S ++ +    D  +            SE++  D       HN  NL+ +  +    G++
Sbjct: 236 -SPVNDEWGVKDGKI--------VHGASEIVSLDDVAIVGSHNHANLIAAMALAYHAGIE 286

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEK-RRIYWIAG 355
            E +        GL HR + +A +  V ++NDSKATN+ + + A   L+E    I  IAG
Sbjct: 287 KESMIEVAKHFTGLAHRCELVANIDAVSYVNDSKATNVGATVAALEGLSEHLGDIILIAG 346

Query: 356 GLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL--SKTLDQALKSVVRDV 413
           G  K  DF  L   + K+     +G          G KI +    SK +D    +V +  
Sbjct: 347 GDGKGADFGPLEAVLDKVTHLITLGKD--------GDKIAALKDNSKRVDSMADAVKQAA 398

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
                  IVL SP CAS D Y NF  RG  F   V  +
Sbjct: 399 GLATAGDIVLLSPACASLDMYKNFMARGDDFRQLVQAL 436


>gi|21282795|ref|NP_645883.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus MW2]
 gi|300912253|ref|ZP_07129696.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus TCH70]
 gi|30316062|sp|Q8NX35|MURD_STAAW RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|21204233|dbj|BAB94931.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MW2]
 gi|300886499|gb|EFK81701.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus TCH70]
          Length = 449

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 132/460 (28%), Positives = 224/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +    VK  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHVKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIIYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|110833457|ref|YP_692316.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alcanivorax
           borkumensis SK2]
 gi|118595639|sp|Q0VS04|MURD_ALCBS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|110646568|emb|CAL16044.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Alcanivorax
           borkumensis SK2]
          Length = 441

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 225/467 (48%), Gaps = 65/467 (13%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVI--DFREIPWSIISF--- 67
           V GLG +G S    L D G+ V A D       +A+ +G++ +  DF ++      F   
Sbjct: 9   VIGLGVTGRSVIRYLTDQGMPVRAID------TRAEPVGLDALCADFPDLKVHTGGFKKG 62

Query: 68  -------LVLSPGIALTGENAHWCVKLANQF--NVEIIGDIELFVRERRFSSLQSPFIAV 118
                  L++SPG+A++         +A Q     E+IGDIELF R     +   P +A+
Sbjct: 63  WMGKARRLIVSPGVAVS------TPAIAEQVVDGKEVIGDIELFAR-----AASEPLVAI 111

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+N KS+   L+  V    G +  +GGN+G+P L L      R YV+E SS+Q+E T +
Sbjct: 112 TGSNAKSTVTTLLGQVADACGMNPGIGGNLGVPALEL-LDDQARLYVLELSSFQLETTYS 170

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
           +   +  +LN+S DHLDR+ +  +Y+  K+++    + A+   +D      A        
Sbjct: 171 LSAEVATVLNVSQDHLDRYASFADYLAAKQRVYDGCQVAVWNRDDLATRPPA-------- 222

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTSAVVCMQLG 296
           +++R  S     ++D  +D    +     E +   S+   T  HN  N+++   +   L 
Sbjct: 223 TVARQISFGAHPEADYRLDSENGQLLCRGEPLLSLSELALTGHHNAMNILSVLAISDALS 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE--KRRIYW 352
           L  ++    + +  GL HR Q +A  G V + NDSKATN+ + + A   + E  + ++  
Sbjct: 283 LNRDKALATVKTFTGLPHRCQLVAESGGVRWFNDSKATNVGATLAALTGIGESIEGKVIL 342

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRD 412
           +AGGL K  DFS L    ++ A+ Y    +A+L      G+  +T+++ +  A   +V D
Sbjct: 343 VAGGLGKGQDFSPL----AEPARQYL--RAALLM-----GEDRTTVAQGMSAAPCELVAD 391

Query: 413 VEN--------VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +           Q    VL SP CASFDQY+ F  RG  F ++  E+
Sbjct: 392 MAVAVRRAHALAQPGDAVLLSPACASFDQYSGFAARGDDFTTRAQEL 438


>gi|89074172|ref|ZP_01160671.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Photobacterium sp. SKA34]
 gi|89050108|gb|EAR55634.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Photobacterium sp. SKA34]
          Length = 446

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 133/454 (29%), Positives = 222/454 (48%), Gaps = 34/454 (7%)

Query: 9   HSIAVFGLGRSGLSAACAL----KDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR-EIPWS 63
           + I V GLG +GLS    L    +   + VI   D+P    Q  D  +E+   +    W 
Sbjct: 8   NKIVVIGLGMTGLSVVNHLMRLPQSLTIKVIDTRDNPPGQDQLPD-SVELYSGQWNTEWL 66

Query: 64  I-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
           +    +V SPGIAL        + +A +  +EI+GDIELF RE     +  P +A+TG+N
Sbjct: 67  LSADLIVASPGIALATPE----LVVAAEAGIEIVGDIELFARE-----VDKPVVAITGSN 117

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+  +L+  + ++ G +V +GGNIG   L++     +  YV+E SS+Q+E T +++ +
Sbjct: 118 GKSTVTSLVGEMAKEAGVNVGVGGNIGFAALDM-LAQQHALYVLELSSFQLETTTSLELT 176

Query: 183 IGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
             V LN+S DH+DR+   L  Y   K +I   +K A+   +D   +   +          
Sbjct: 177 AAVYLNLSEDHMDRYPGGLAQYSQAKMRIFDHAKLAVFNRDDLATKPTQFSGAMTSFGFD 236

Query: 242 RISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEE 301
                 +  D   ++  +     A +++         +HN+ N + +  +    G+  + 
Sbjct: 237 DQDYGIVLVDGKEWLAVNGEAVMAVTDIAL-----VGRHNVANCLAALALADAAGIPRDA 291

Query: 302 IKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSK 359
             RA+    GL HR Q       V ++NDSKATNL S + A   L  + +++ + GG SK
Sbjct: 292 AYRAMQRYTGLAHRCQLAVNRHGVRWVNDSKATNLASTLAALNGLQLEGKLHLLMGGDSK 351

Query: 360 SDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLS-KTLDQALKSVVRDVENVQ 417
             +FS L P ++ +  + Y  G       H F   +++ +S +T+  A+  + R    VQ
Sbjct: 352 GAEFSELKPILADLNVQLYSFGRDR----HLFNDVVDNAISVETMKDAMVCISR---TVQ 404

Query: 418 LPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              +VL SP CAS+DQ+ NF  RG +F+ Q  ++
Sbjct: 405 SGDMVLLSPACASWDQFANFMARGDAFVEQAIQL 438


>gi|282918881|ref|ZP_06326616.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus C427]
 gi|282316691|gb|EFB47065.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus C427]
          Length = 449

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 224/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L + G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSELGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDKNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|284045224|ref|YP_003395564.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Conexibacter woesei
           DSM 14684]
 gi|283949445|gb|ADB52189.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Conexibacter woesei
           DSM 14684]
          Length = 442

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 148/464 (31%), Positives = 218/464 (46%), Gaps = 63/464 (13%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPW----SIISFL 68
           V GL RSG++AA AL   G   I  D     V + +  G+EV    + P     S    L
Sbjct: 15  VVGLARSGIAAALALHARGEQAIGVDAGVPDVTRLRAAGVEV--HLDAPGTDLVSRARTL 72

Query: 69  VLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTV 128
           V SPG+          V+ A    + +IG++EL  R      L + FIAVTGTNGK++T 
Sbjct: 73  VKSPGVPQDAP----VVRAARDAGLAVIGEVELAWR-----LLPNDFIAVTGTNGKTTTT 123

Query: 129 ALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIELTPTIDPSIGVLL 187
            L+ HV R  G  V + GN+G  +  L     P    V E SSYQ+E T    P   +LL
Sbjct: 124 ELLGHVHRTAGLPVTVAGNVGTAVTTLIGALDPAATIVCETSSYQLEDTLAFAPEAAILL 183

Query: 188 NISPDHLDRHHTLENYVNIKKKI--------VTMSKHAIICINDHQCEKIAYDMNFIGHS 239
           N++PDHLDRH TLE Y   K +         V ++  A+         ++ +     G +
Sbjct: 184 NVTPDHLDRHGTLEAYREAKLEAFRRQTAAGVAVTSTALAAALPGDARRVTFGAAADGAT 243

Query: 240 ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKV 299
           +      +L  D  +  + + L  +A   +          HN +N + +A V +  G+  
Sbjct: 244 V------ALHDDGTISWEGAPLMAAAEIGI-------PGPHNRENAMAAAAVALARGVDA 290

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN-EKRRIYWIAGGLS 358
             ++ AL S GG+ HRL+ IA    V ++NDSKATN+ +   A  +     ++ IAGG+ 
Sbjct: 291 AAVREALRSFGGVAHRLEPIAERDGVAYVNDSKATNVDATQVALRSYAPGTVHLIAGGVP 350

Query: 359 KSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQ 417
           K+ DF+ L P ++ + A  Y IG  A        G+I + L+ +      + + DV +++
Sbjct: 351 KAQDFAPLAPLVAERCAAVYLIGEGA--------GEIGAALASS-----GTPLHDVGDME 397

Query: 418 ----------LPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
                      P  +VL SP CASFDQY NF  RG  F   V E
Sbjct: 398 RAVAAASAAARPGEVVLLSPACASFDQYPNFEARGDHFRRLVEE 441


>gi|302332788|gb|ADL22981.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 449

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 224/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T    +  VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIYEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|161612470|ref|YP_001586435.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|161361834|gb|ABX65602.1| hypothetical protein SPAB_00160 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 438

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 135/472 (28%), Positives = 223/472 (47%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +++ ++ + GLG +GLS        GV     D     P   K  +D+   V    +
Sbjct: 1   MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQDVERHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  EWLLAADLIVASPGIAL----AHPSLSAAASAGVEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDADRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           +++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 VSFGVNMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +GL      +AL +  GL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLS 399
              ++ + GG  KS DFS L          Y  G+   L+ F   G ++       +  +
Sbjct: 337 DGTLHLLLGGDGKSADFSPL--------ARYLTGDRIRLYCFGRDGAQLAALRPEIAQQT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T+++A++ +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEEAMRLL---APRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKEL 437


>gi|90580226|ref|ZP_01236033.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           angustum S14]
 gi|90438528|gb|EAS63712.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           angustum S14]
          Length = 446

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 138/458 (30%), Positives = 222/458 (48%), Gaps = 42/458 (9%)

Query: 9   HSIAVFGLGRSGLSAACAL----KDSGVHVIAWDDHPCAVKQAKDMGIEVIDFR-EIPWS 63
           + I V GLG +GLS    L    +   + VI   D+P    Q  D  +E+   +    W 
Sbjct: 8   NKIVVIGLGMTGLSVVNHLMRLPQSLSIKVIDTRDNPPGQDQLPD-SVELCSGQWNTEWL 66

Query: 64  I-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
           +    +V SPGIAL        + LA +  VEIIGDIELF RE     +  P +A+TG+N
Sbjct: 67  LSADLIVASPGIALATPE----LVLAAEAGVEIIGDIELFARE-----VDKPVVAITGSN 117

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+  +L+  + ++ G +V +GGNIG   L++     +  YV+E SS+Q+E T +++ +
Sbjct: 118 GKSTVTSLVGEMAKEAGINVGVGGNIGFAALDM-LAQQHSLYVLELSSFQLETTTSLELT 176

Query: 183 IGVLLNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
             V LN+S DH+DR+   L  Y   K +I   +K A+   +D   +   +          
Sbjct: 177 AAVYLNLSEDHMDRYPGGLAQYSQAKMRIFDHAKLAVFNRDDLATKPTQFSGAMTSFGF- 235

Query: 242 RISSQSLQSDSDLYI----DESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGL 297
                    D D  I     + +L  +  + +         +HN+ N + +  +    G+
Sbjct: 236 --------DDQDYGIVLVNGKEWLAVNGEAVMAVADIALVGRHNVANCLAALALADAAGI 287

Query: 298 KVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAG 355
             +   RA+    GL HR Q       V ++NDSKATNL S + A   L  + +++ + G
Sbjct: 288 PRDAACRAMQRYTGLAHRCQLAVNRHGVRWVNDSKATNLASTLAALNGLQLEGKLHLLMG 347

Query: 356 GLSKSDDFSTLFPFISKI-AKAYFIGNSAMLFFHHFGGKINSTLS-KTLDQALKSVVRDV 413
           G SK  +FS L P ++ +  + Y  G       H F   +++ +S +T+  A+  + R  
Sbjct: 348 GDSKGAEFSELKPVLADLNVQLYSFGRDR----HLFNDVVDNAISVETMSDAMVCISR-- 401

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             VQ   +VL SP CAS+DQ+ NF  RG +F+ Q  ++
Sbjct: 402 -TVQSGDMVLLSPACASWDQFANFMARGDAFVEQAIQL 438


>gi|227431980|ref|ZP_03914000.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
 gi|227352265|gb|EEJ42471.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           mesenteroides subsp. cremoris ATCC 19254]
          Length = 449

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 135/472 (28%), Positives = 224/472 (47%), Gaps = 49/472 (10%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIA-----WDDHPCAVKQ--AKDMGIE 53
           M+ + F+N  + VFG  RSG +AA  LK  G  V       +D      +   A D+ + 
Sbjct: 1   MQATDFKNKKVMVFGWARSGKAAAQLLKKLGSKVTVVNGGEFDAQDATYRSLLAADVTLI 60

Query: 54  VIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
            +D  E   S   +L+ +PGI       H  V+ A + N+ I+ ++E+       S+   
Sbjct: 61  GMDNAETLDSTYDYLIKNPGINYD----HPLVQKAEKLNIPILTEVEI-----ALSTFNG 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEY-FSPNRFYVIECSSYQ 172
             IAVTG+NGK++T +LI  +L+ +G +V   GNIG+P+  + +  +     ++E SS+Q
Sbjct: 112 RLIAVTGSNGKTTTTSLIRDMLKADGQNVITAGNIGVPVSEVVFDLTREDTLLLELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKI 229
           +   P I P I ++ NI  +HLD H T  NYV  K  I      +++ ++  +    EK 
Sbjct: 172 LLGLPDIQPDIALVTNIFSNHLDYHKTRANYVAAKFHITRHQNANQYLVLNADGQDTEKF 231

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLV 286
             +        SR             +  S    + T E++   +++ K    HN +N++
Sbjct: 232 KNETEAQVLEFSRTKQH-------FPVAFSNGNLTLTDEIVMP-TKDIKLVGPHNQENIL 283

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
            +  V    G+    I+  L +  G+ HRLQ +  +G V + NDSKAT++ +   A  + 
Sbjct: 284 AAVTVANLAGVSKPAIREVLKTFSGVAHRLQYLFTVGDVKYYNDSKATDIEATQTALDSF 343

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
                WI GGL + DD   L P +  +     +G +              TL++   + +
Sbjct: 344 DCPTIWIGGGLERGDDLERLLPNLKNVKAVIAVGETQQKIV---------TLARKAGKPV 394

Query: 407 KSVVRDVEN-----VQLPS---IVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            +V  DVE+     VQL S   +VL SP  AS+DQY++F ERG +F++ + E
Sbjct: 395 IAVT-DVEHAASVAVQLASPGDVVLLSPAQASWDQYSSFEERGDNFVASLKE 445


>gi|254525588|ref|ZP_05137640.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9202]
 gi|221537012|gb|EEE39465.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9202]
          Length = 478

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 140/470 (29%), Positives = 223/470 (47%), Gaps = 36/470 (7%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID------- 56
           SS R +   V GLG+SG  AA  L+     VI W+         +   +E ++       
Sbjct: 7   SSKRKNINLVIGLGKSGFWAAKYLRSINKRVIVWESKDGIELLERKTELEKLNILVSLNK 66

Query: 57  ---FREIPWSI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL 111
              F EI   +  I  +V+SP I       H  +    +  ++++G+I +     +    
Sbjct: 67  EFVFEEIQPLVKEIESVVVSPSIPYD----HTTIIELKKKGIKVVGEINVAWEILK---- 118

Query: 112 QSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFSPNRFYVIEC 168
            + +I +TGTNGK++   L+SH+L  NG      GNIG P+      +      + V E 
Sbjct: 119 DTNWIGITGTNGKTTVTHLLSHILCDNGLYAPFAGNIGTPLCKYACSKKLEKIDWVVAEL 178

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEK 228
           SSYQIE++P + P+IG+    + DHL+RH TLENY NIKK ++  S   I   +D     
Sbjct: 179 SSYQIEISPEVKPNIGIWTTFTEDHLERHKTLENYFNIKKSLLEKSDFRIYNYDDKNLRN 238

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYI-DESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
             Y     G  I+    +S     D +I D++++          ++      HN+QNL+ 
Sbjct: 239 -HYSSLSRGVWITTSLDKSNFIQCDYWIDDQAYIVERGKRLFKLEYFSLRGMHNLQNLLL 297

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
                 ++GL  +EIK +L +   L HR++TI +  ++  INDSKATN  S I    + +
Sbjct: 298 VIAAVRKVGLSGKEIKDSLSNYKQLPHRMETIYKNNYLEIINDSKATNFDSSIAGISSIE 357

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFI-GNSAMLFFHHFGGKINSTLSKT----- 401
            ++  IAGG  K +++S     + K  K  F+ G S+ +        IN    K+     
Sbjct: 358 GQMIIIAGGRLKGNEYSEWIKVLKKKVKCIFLFGESSKVLKMAL---INEGFKKSIFEFS 414

Query: 402 -LDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            L   L  V   ++N ++ ++ LFSP C+SFDQ+ N+ ERG  F   + E
Sbjct: 415 ELKDLLNFVFHYLQNNRVRTL-LFSPSCSSFDQFKNYEERGDYFKKLIRE 463


>gi|329298857|ref|ZP_08256193.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Plautia stali
           symbiont]
          Length = 439

 Score =  174 bits (440), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 136/464 (29%), Positives = 213/464 (45%), Gaps = 41/464 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDFREI 60
           ++ +R   + + GLG +GLS        GV     D    P  + +  +     +     
Sbjct: 1   MADYRGRKVVIIGLGITGLSCVDFFLAQGVTPRVMDTRVSPPGLDKLPEQVERHVGGINS 60

Query: 61  PWSIISFLVL-SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W +   L++ SPGIAL    AH  +  A    +EI+GDIELF RE      Q+P +A+T
Sbjct: 61  DWLLACDLIIASPGIAL----AHPALSEAADAGIEIVGDIELFCREA-----QAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVI-ECSSYQIELTPT 178
           G+NGKS+   L+  + R  G+ V +GGNIGLP L L   SP + YV+ E SS+Q+E T +
Sbjct: 112 GSNGKSTVTTLVGEMARAAGWQVGVGGNIGLPALTL-LKSPAQLYVVLELSSFQLETTYS 170

Query: 179 IDPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKI-AYDMNFI 236
           +  +   +LN++ DH+DR+   ++ Y   K +I   +   ++  +D     +   D   +
Sbjct: 171 LKAAAATILNVTEDHMDRYPLGMQQYRAAKLRIYENADICVVNADDGMTMPVRGADRRCV 230

Query: 237 GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG 296
              I        Q     ++     K   T E+         +HN  N + +  +   + 
Sbjct: 231 SFGIDVGDYHLNQQQGSTWLRVKGEKVLNTDEMKL-----VGQHNYTNALAALALADAVN 285

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           + +    +AL +  GL HR Q +     V +INDSKATN+ S   A   L  K  ++ + 
Sbjct: 286 IPLASSLKALTTYSGLPHRFQLVHEAHGVRWINDSKATNVGSTEAALNGLQVKGTLWLLL 345

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALK 407
           GG  K  DF+ L          Y  G++  LF F   G  +       +T + TL+Q + 
Sbjct: 346 GGDGKGADFTPL--------ARYLQGDNVRLFCFGRHGDALAALRPAVATCTDTLEQGMT 397

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 398 QI---AAQVQAGDMVLLSPACASLDQFRNFEQRGDRFAQLAKEL 438


>gi|300715306|ref|YP_003740109.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erwinia billingiae
           Eb661]
 gi|299061142|emb|CAX58249.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erwinia billingiae
           Eb661]
          Length = 438

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 220/467 (47%), Gaps = 48/467 (10%)

Query: 3   LSSFRNHSIAVFGLGRSGLS---------AACALKDSGVHVIAWDDHPCAVKQ----AKD 49
           ++ ++   + + GLG +GLS             + D+ V     D  P +V++      D
Sbjct: 1   MADYQGKKVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVAPPGLDKLPASVERWLGSLND 60

Query: 50  MGIEVIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
             ++  D           +V SPG+AL    AH  +  A Q  VEI+GDIELF RE    
Sbjct: 61  SWLQAADL----------IVASPGMAL----AHPSLMDAAQAGVEIVGDIELFCREA--- 103

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECS 169
             Q+P +A+TG+NGKS+   L+  + +  G+ V +GGNIGLP L L    P + YV+E S
Sbjct: 104 --QAPIVAITGSNGKSTVTTLVGDMAKAAGWQVGVGGNIGLPALML-LEQPAQLYVLELS 160

Query: 170 SYQIELTPTIDPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEK 228
           S+Q+E T ++  +   +LN++ DH+DR+   ++ Y   K ++   +   ++  +D     
Sbjct: 161 SFQLETTASLKAAAATILNVTEDHMDRYPLGMQQYRAAKLRVYENAAVCVVNADDAMTFP 220

Query: 229 I-AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVT 287
           +   D   +   I+      L ++S     ES+L     + +         +HN  N + 
Sbjct: 221 VRGLDARCVSFGIN-AGDYHLATES----GESWLNVKGDNLMKTSDMTLVGQHNQTNALA 275

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LN 345
           +  +   +GL +    +AL +  GL HR Q       V +INDSKATN+ S   A   L 
Sbjct: 276 ALALAEAVGLPLASSLKALTTFSGLAHRFQIALDRNGVRWINDSKATNVGSTEAALNGLQ 335

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ 404
            +  ++ + GG  KS DFS L  ++     + Y  G  A         +I +  ++TL  
Sbjct: 336 VQGTLWLLLGGDGKSADFSPLTRYLQGDNVRTYCFGRDAQA-LAELRPEI-AVRTETLAD 393

Query: 405 ALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           A+K +      V+   +VL SP CAS DQ+ NF  RG +F     E+
Sbjct: 394 AMKQI---ATQVKPGDMVLLSPACASLDQFKNFERRGDAFTQLAKEL 437


>gi|327399667|ref|YP_004340536.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hippea maritima
           DSM 10411]
 gi|327182296|gb|AEA34477.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Hippea maritima
           DSM 10411]
          Length = 435

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 137/443 (30%), Positives = 216/443 (48%), Gaps = 26/443 (5%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID-FREIPWSIISFLV 69
           + V G GRSG +A   LKD G  V A+DD    +K A   G   I+ F EI +  +   V
Sbjct: 3   VGVVGFGRSGQAAYRLLKDKGFDVYAFDDR-AELKGANLFGKGKINKFFEISFDEV---V 58

Query: 70  LSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVA 129
           LSPG+    + +H  VK      +++I ++EL  R       +   IA+TGTNGKS+TVA
Sbjct: 59  LSPGV----KPSHPFVKHCRSNRIKLISELELGYR-----YAKGKIIAITGTNGKSTTVA 109

Query: 130 LISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNI 189
           L+  +L+     V   GN GLP L+   +    +YV+E SSYQ+E      P+I  +LNI
Sbjct: 110 LVERILKGASKRVIACGNYGLP-LSEAIYENAEYYVVEASSYQLEFIDKFKPNIAAILNI 168

Query: 190 SPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQ 249
           + DHL  H +++NY+  KKKI          I +     I     F G +   + S+   
Sbjct: 169 AFDHLSWHGSMDNYIEAKKKIFKNQLEDDFFIKNDSDSYI-----FDGKANLFLVSKR-D 222

Query: 250 SDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSC 309
            ++D + +++ +  +    +  D +        +N+  +A++ +  G++ + IK  + + 
Sbjct: 223 RNADCFFEKNGVIVNRPEYLRIDKTGLFGSKVFENIAFAALIGLLCGIEKKTIKEVVGTM 282

Query: 310 GGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLF 367
             L HR++ +  +  V F NDSKATNL +V  A    +E  +I  I GG  K + +S L 
Sbjct: 283 SNLEHRIEFVDEIDGVKFYNDSKATNLDAVEAAINSFDEGIKIVIILGGKHKGESYSRLL 342

Query: 368 PFISKIAKAYFI-GNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSP 426
           P + K A+A  + G    +  +   G +   L         +V    E      +VLFSP
Sbjct: 343 PLLEKRARAVVVYGEDRKVILNELDGFLPVPLPAV--NIWGAVRAAFEVASKDDVVLFSP 400

Query: 427 GCASFDQYNNFRERGFSFMSQVS 449
           G +S + Y NF ERG +F  +V 
Sbjct: 401 GGSSCEPYKNFEERGEAFKKEVE 423


>gi|78213668|ref|YP_382447.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Synechococcus
           sp. CC9605]
 gi|118595700|sp|Q3AHP0|MURD_SYNSC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|78198127|gb|ABB35892.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           CC9605]
          Length = 461

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 139/466 (29%), Positives = 217/466 (46%), Gaps = 41/466 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAV-----KQAKDMGIEVIDFREIPWSIISF 67
           V GLGRSGL AA  LK     V+ ++           K   + GI+V+  +  P ++ SF
Sbjct: 6   VVGLGRSGLGAARLLKQQNHDVVVFERGNNEALQHTSKTLAEEGIQVVLGQ--PLTLQSF 63

Query: 68  ---------LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS-PFIA 117
                    +V+ PGI          V+L ++  V++ G+++       + +LQ  P+I 
Sbjct: 64  DAWRDNLDAVVIGPGIPWDHPT---LVQLRSE-GVQVRGEMDTA-----WDALQQIPWIG 114

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLE-------YFSPNRFYVIECSS 170
           +TGTNGK++   L+SHVL   G    +GGNIGL    L           P+ + V+E SS
Sbjct: 115 ITGTNGKTTVTHLLSHVLEAAGLTAPMGGNIGLSAAELACQIGSGAKPRPD-WLVMELSS 173

Query: 171 YQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIA 230
           YQIE  P + P IG+   ++PDHL+RH +LE Y  IK+ ++  S+ A+   +D    +  
Sbjct: 174 YQIEAAPAVAPKIGIWTTLTPDHLERHGSLEAYRAIKRGLLERSECALFNADDPDLRQQR 233

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYI-DESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
              N  G  +S   +      +DL+I DE  ++ + T     D      +HN QNL+   
Sbjct: 234 SSWNR-GTWVSSEGAHPDNQPADLWIDDEGMVRNNTTRLFAADVLAMPGRHNRQNLLLVT 292

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
              ++ GL  ++I  AL +  G+ HRL+ +  L      NDSKATN  +        +  
Sbjct: 293 AAALEAGLSPQQIADALRTFPGVPHRLEQLGTLAGASVFNDSKATNYDAAEVGLRAVQGP 352

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFI---GNSAMLFFHHFGGKINSTLS-KTLDQA 405
           +  +AGG +K  D S     +   A +  +   G   +       G     L    L+ A
Sbjct: 353 VVVLAGGQTKQGDASGWLKQLQSKACSLILFGAGADELASLAKAAGYPGELLQCPELESA 412

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +      V+  Q  S+ L SP CASFDQY +F  RG  F + ++ +
Sbjct: 413 VNLAEGAVQRHQASSL-LLSPACASFDQYRDFEARGEHFRTLINPL 457


>gi|257066693|ref|YP_003152949.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Anaerococcus
           prevotii DSM 20548]
 gi|256798573|gb|ACV29228.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Anaerococcus
           prevotii DSM 20548]
          Length = 439

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 141/452 (31%), Positives = 214/452 (47%), Gaps = 25/452 (5%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVL 70
           I V+GLG +G+SAA  L   G  V  +D +   VK+ K      I   EI      F+V 
Sbjct: 4   ILVYGLGLTGISAAKTLDKMGYDVYTFDKNKKEVKELKGYKYSPISDSEICDYDFEFVVK 63

Query: 71  SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVAL 130
           SPGI    E      KL  ++  EII DIEL  R   F   ++  IA TGTNGK+ST ++
Sbjct: 64  SPGIPPRDEVVK---KLREKY--EIISDIELSFR--LFP--EAKIIATTGTNGKTSTTSM 114

Query: 131 ISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNIS 190
           ISH+L ++G      GNIG  IL   Y +P+  +  E SS+Q+    T  P I  + NI+
Sbjct: 115 ISHILNESGRKAISVGNIGEGILWQMYENPSAIFSCELSSFQLHDVSTYKPHIACITNIT 174

Query: 191 PDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQS 250
            DH+D H + ++Y+N K  I          + +H+   +          +   SS+  + 
Sbjct: 175 EDHIDWHGSFDDYINSKLNICRKQDSGDFLVINHEDPILVDHKADFRAKVYEFSSKE-EV 233

Query: 251 DSDLYIDES--FLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQLGLKVEEIKRAL 306
           D   Y+  S  F K    +  + D    +   +HN +NL+ + + C   G+ +E+I R  
Sbjct: 234 DRGAYLKGSSIFFKDQGKNIKLMDVDDLSIIGRHNYENLMAAILACFIYGVSIEDIIRGS 293

Query: 307 LSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAGGLSKSDDFSTL 366
            S   + HRL+ +  +  +   NDSK TN+ S + A  +  + I  IAGG  K+ D+S  
Sbjct: 294 KSFKSIEHRLEFVTDIRGIRVYNDSKGTNVDSSVKAIQSFDKPIVIIAGGYDKNIDYS-- 351

Query: 367 FPFISKIAK----AYFIGNSA-MLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSI 421
            P+I +  K       IG +   L       K+N   +K ++ A+K      +N++   I
Sbjct: 352 -PYIKEFKKHGKLMVIIGQTTDKLASLCEAYKVNYKKAKDMEDAVKI---SFDNLEEGDI 407

Query: 422 VLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
            L SP  AS+  Y NF ERG  F   + +  G
Sbjct: 408 FLLSPASASWGMYRNFEERGKDFKEMIEKYKG 439


>gi|295698678|ref|YP_003603333.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus Riesia
           pediculicola USDA]
 gi|291157135|gb|ADD79580.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus Riesia
           pediculicola USDA]
          Length = 439

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 137/455 (30%), Positives = 232/455 (50%), Gaps = 37/455 (8%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWD-DHPCAVKQAKDMGIEVIDFREI--PWSIIS- 66
           + + GLG++GLS         +     D  +P   K +   G+ +  F      W + S 
Sbjct: 9   VVIIGLGKTGLSCINFFLSKKIFPKVIDTQYPSYTKHSIPEGV-IYHFGSWNRGWIVSSD 67

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            +VLSPG++      H  +++A +  +EIIGDIELF RE          I++TG+NGKS+
Sbjct: 68  LIVLSPGVS----RLHEEIQIAYRKGIEIIGDIELFCRE---VDRDKKIISITGSNGKST 120

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
           T ++++ + +K    V LGGNIG+P+L L  +  +  Y++E SS+Q+E+T T+     V+
Sbjct: 121 TASVLTEIAKKANLKVGLGGNIGVPVLELLNYDYD-IYILELSSFQLEITSTLKSIGAVI 179

Query: 187 LNISPDHLDRH-HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD-MNFIGHSISRIS 244
           LNIS +H+DR+   +  Y++ K KI   +K+ +I I D++      D  NF+   I+   
Sbjct: 180 LNISENHMDRYPFGMYQYLSAKLKIYDFAKNCVINIMDNRIWPKEIDKRNFLSFGIN--- 236

Query: 245 SQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKR 304
                 D  L   ++ ++      +   F +   +HN  N + +  +   +G+ +     
Sbjct: 237 ----SGDYRLNTKKNTIQRFEKDLIHIKFIKIIGQHNHMNFLATLCLSEIIGIPINISLF 292

Query: 305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSKSDD 362
            +    GL HRLQ + +   VI+INDSK+TN+ S I A   +    +I+ + GG  +   
Sbjct: 293 VISRYSGLPHRLQVVHKKNGVIWINDSKSTNIESTIAALKSIKANNKIHLLLGGDKRKSK 352

Query: 363 FSTLFPFIS--KIAKAYFIGNSAMLFFHHFGGKI--NSTLSKTLDQALKSVVRDVENVQL 418
            S L  F+S  K  + Y  G   + F     GK+  +S +  TL+Q +  V ++ E+   
Sbjct: 353 ISRLKEFVSYKKKIRIYCFGKDKLKF-----GKLRNDSIVLNTLEQCMLKVSKNTES--- 404

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
             I+L SP C+S DQ++NF  RG S  S++++  G
Sbjct: 405 GDIILLSPACSSLDQFSNFEHRG-SVFSEIAKKLG 438


>gi|157413927|ref|YP_001484793.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. MIT 9215]
 gi|157388502|gb|ABV51207.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. MIT 9215]
          Length = 478

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 146/468 (31%), Positives = 223/468 (47%), Gaps = 32/468 (6%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID------- 56
           SS R +   V GLG+SG  AA  LK     VI W+         +   +E ++       
Sbjct: 7   SSKRKNINLVIGLGKSGFWAAKYLKSINKRVIVWESKDGIELLERKTELEKLNILVSLNK 66

Query: 57  ---FREIPWSI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL 111
              F EI   +  I  +V+SP I       H  +    +  +++IG+I +     +    
Sbjct: 67  EFVFEEIQPLVKEIESVVVSPSIPYD----HTTIMELKKKGLKVIGEINVAWEILK---- 118

Query: 112 QSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIEC 168
            + +I +TGTNGK++   L+SH+L   G      GNIG P+    Y        + V E 
Sbjct: 119 DTNWIGITGTNGKTTVTHLLSHILCDTGLYAPFAGNIGTPLCKYAYSKKTEKIDWVVAEL 178

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEK 228
           SSYQIE++P + P+IG+    + DHL+RH TLENY NIKK ++  S   I   +D     
Sbjct: 179 SSYQIEISPEVKPNIGIWTTFTEDHLERHKTLENYFNIKKSLLEKSDFRIYNYDDKNLRN 238

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLV 286
             Y     G  I+    +S     D +ID+         + +F     + K  HN+QNL+
Sbjct: 239 -HYSSLSRGVWITTSFDKSNFIQCDYWIDDQAF-IVERGKKLFKLEHFSLKGMHNLQNLL 296

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
                  ++GL  +EIK +L +   L HR++TI +   +  INDSKATN  S I    + 
Sbjct: 297 LVIAAARKVGLSGKEIKDSLSNYKQLPHRMETIYKNDDLEIINDSKATNFDSSIAGISSI 356

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFI-GNSAMLF---FHHFGGKINSTLSKTL 402
           + +I  IAGG  K +++S     + K  K  F+ G S+ +      + G K N      L
Sbjct: 357 EGQIIIIAGGRLKGNEYSEWIKVLKKKVKCVFLFGESSKVLKMALINEGFKKNIFEFSEL 416

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            + L  V   ++N ++ ++ LFSP C+SFDQ+ N+ ERG  F   +SE
Sbjct: 417 KELLNFVFHYLQNNKVGTL-LFSPSCSSFDQFKNYEERGDYFKKLISE 463


>gi|116328899|ref|YP_798619.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116330494|ref|YP_800212.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|122281748|sp|Q04UG6|MURD_LEPBJ RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|122283318|sp|Q04Z09|MURD_LEPBL RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|116121643|gb|ABJ79686.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116124183|gb|ABJ75454.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 462

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 149/472 (31%), Positives = 228/472 (48%), Gaps = 49/472 (10%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP--CAVKQAKDMGIEVIDFREIPW 62
           S +   I V G G SG SA   L       I+ +  P  C   Q + + +        P 
Sbjct: 6   SLKGLKILVLGGGISGNSALDFL-------ISEEAQPILCDRNQPETISVPFFHDNIDPR 58

Query: 63  SI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           S   IS ++ SPGI  T    H  +  A +  + +  +I+L     RF   +   I +TG
Sbjct: 59  SFFEISLIIKSPGILPT----HPILSYAVEKKIPVFSEIDL----GRFF-FKGKIIGITG 109

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           T+GKS+T +L++H+L+K+  D++ GGN+G+P  +     P    V+E SSYQ+E +  +D
Sbjct: 110 TDGKSTTTSLVAHLLKKDFSDLKEGGNLGIPFTSFCK-EPISLAVLELSSYQLEDSSPLD 168

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMS--KHAIICINDHQCEKIAYDMNFIGH 238
            ++ V LN++PDHL+RH T+ENY   K KI  +    H++I       EKI   +     
Sbjct: 169 LNVSVFLNLAPDHLERHETMENYFRAKLKIADLQNPNHSLIV-----SEKIREKILNSTS 223

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTSAVVCMQLG 296
              ++ S    + S+  +DES  +   TS+ I+D S+      HN +NL  + +    +G
Sbjct: 224 VQCKLLSFGRATTSEAILDESSSEIR-TSKFIYDISRFYLPGTHNRENLAAAILASEAIG 282

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKR--RIYWIA 354
            K E I+  +    GL HR Q       + FINDSK+TNLHS++      K   R   I 
Sbjct: 283 GKPESIQAQIPFFMGLPHRFQIAGEKRGISFINDSKSTNLHSMLAGMSAWKNLDRTCLIL 342

Query: 355 GGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINSTL--SKTLDQALK---- 407
           GG  K +D   L+ F+ + I     IG +  ++       I   L   + LD+A K    
Sbjct: 343 GGRPKQEDPKPLYDFLMRGIGCVVLIGEARSVWEKGIRNVIGEKLFSVENLDEAFKIFKK 402

Query: 408 ----SVVRDVENVQLPSIV-----LFSPGCASFDQYNNFRERGFSFMSQVSE 450
               S   ++  ++L S +     +FSP C SFDQY NF ERG  F+S V +
Sbjct: 403 WNVISESPEIRKIRLSSEITISYFVFSPACVSFDQYKNFEERGNHFLSLVED 454


>gi|167614204|gb|ABZ89707.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera
           aphidicola]
          Length = 439

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 136/375 (36%), Positives = 198/375 (52%), Gaps = 33/375 (8%)

Query: 88  ANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGN 147
           A    +EII DIELFVRE     + +P IA+TGTNGKS+   +I+ + + +GY+  LGGN
Sbjct: 86  ARLLGIEIISDIELFVRE-----ISTPIIAITGTNGKSTVATMITKIAQNSGYNALLGGN 140

Query: 148 IGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRH-HTLENYVNI 206
           IG P+LNL +      Y+IE SS+Q+E T  +   I V+LNI  DH++R+    E Y   
Sbjct: 141 IGCPVLNLLH-QKRDLYIIELSSFQLENTFNLKSKISVILNIHEDHINRYPQGFEQY--- 196

Query: 207 KKKIVTMSKHAIICI-NDH-QCEKIAYDMNFIGHSISRISSQSLQSDSDLYI---DESFL 261
           KK  +++   A ICI N H Q   I  D N   H IS       + +SD YI   D SF+
Sbjct: 197 KKTKLSIYHGAEICIMNSHDQLNDIFDDKN--KHYISF-----GKKNSDYYIYKNDTSFI 249

Query: 262 KCSATSEVIFDFSQ--ETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTI 319
            C   +E I + S+   +  HN  N++ S  +   +    +     L +   L HR QTI
Sbjct: 250 LC-CKNEKILNSSELLLSGYHNYNNVLVSIAIADAMKFSRQYTIYTLKNFSSLPHRFQTI 308

Query: 320 ARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKI-AKA 376
               ++ +INDSK+TN++S   A   L +K  I+ + GG SKS +F+ L  + +K   K 
Sbjct: 309 QNKNNIDWINDSKSTNVNSTQVALNSLTKKGTIHLLLGGDSKSGNFNILKKYFNKKNIKI 368

Query: 377 YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNN 436
           Y  G   +  F     K  S   + L QA+  + + V++      VL SPGC+S DQ++N
Sbjct: 369 YCFGKDGVKIFKICKKK--SIYVENLKQAMLLISKTVKS---GDTVLLSPGCSSLDQFSN 423

Query: 437 FRERGFSFMSQVSEI 451
           F ERG  F+    E+
Sbjct: 424 FEERGNLFIKLTKEM 438


>gi|253731802|ref|ZP_04865967.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
 gi|253724452|gb|EES93181.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus USA300_TCH959]
          Length = 449

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 224/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK     +++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIDEAVKR----DLKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIIYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|332531947|ref|ZP_08407831.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038574|gb|EGI75017.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 444

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 218/463 (47%), Gaps = 44/463 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV----KQAKDMGIEVID 56
           L+  +N  I V GLG +GL     L   G+   V+     P  +    + A ++     +
Sbjct: 4   LNEIKNKQITVLGLGVTGLGIVRFLLSHGLAPKVVDSRATPPGIDWLKEHAPNLDTHFGN 63

Query: 57  FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFN--VEIIGDIELFVRERRFSSLQSP 114
             +      + +++SPG++L          +AN  N  VE+IGD+ELF R         P
Sbjct: 64  LDDAELCSSNMIIISPGLSLK------IPAVANAINAGVEVIGDVELFARINT-----KP 112

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL--EYFSPNRFYVIECSSYQ 172
            +AVTG+NGKS+ V L   VL++ GY V LGGNIG  +L+L  + F     YV+E SS+Q
Sbjct: 113 VVAVTGSNGKSTVVTLAYEVLKEAGYKVALGGNIGTAVLDLLNDDFD---VYVLELSSFQ 169

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD 232
           ++ T ++ P    +LN+S DHLDR+ + + Y++ K  I   ++  ++  +D Q   +   
Sbjct: 170 LDTTTSLKPVSATVLNVSEDHLDRYDSYQAYIDSKLSIYDGAELIVVNADDIQTHPVERG 229

Query: 233 MNFIGHSISRISSQSLQSDSDL--YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
                 +   IS  + Q D  L  +  E+       + +  D      KHN  N +    
Sbjct: 230 ------TTPLISFGAQQGDYHLAQHNGETHFMLKGDAFLPVDTLAVVGKHNYLNTLAVMA 283

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA---FLNEK 347
           +     +   + K AL    GL HR Q +A L  V + NDSKATN+ + I A     ++ 
Sbjct: 284 LLSPFEVSKAQYKNALGQFNGLAHRCQFVAELNGVKYFNDSKATNVGATIAAIDSLASDG 343

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQ--A 405
             +  IAGG +K  D + L P+I +  KA                K  S L+  +++  A
Sbjct: 344 ENLIVIAGGDAKGADLNALKPYIEQHVKALICFGKDASDLAAITNK--SYLTNNMEEAVA 401

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQV 448
           L +V+    N     IVL +P CAS D YNN+ +RG  F+  V
Sbjct: 402 LANVLSSTGN-----IVLLAPACASIDMYNNYMQRGDDFIQCV 439


>gi|229496695|ref|ZP_04390409.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Porphyromonas
           endodontalis ATCC 35406]
 gi|229316592|gb|EEN82511.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Porphyromonas
           endodontalis ATCC 35406]
          Length = 452

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 137/461 (29%), Positives = 227/461 (49%), Gaps = 39/461 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDD---HPCAVKQAKDMGIEVIDFREIP-WSIISFL 68
           V G G SG+ AA   +  G+     D    +P   ++ +  GI   + +  P W + +  
Sbjct: 6   VLGGGESGVGAAILAQKVGLPCRVSDKGKLNPQYREELEKRGIPYEEGKHSPDWLLDANE 65

Query: 69  VL-SPGIALTGENAHWCVKLANQF---NVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
           V+ SPGI  +       + L   F    + +I +IE      R+    +   A+TG+NGK
Sbjct: 66  VIKSPGIPDS-------LPLIQDFIKRGISVISEIEF---ASRYLPEDTKVAAITGSNGK 115

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           ++TV  ++H+L+  GYD  + GN+G  +  L    P+++YV+E SS+Q++ T    P++ 
Sbjct: 116 TTTVNWVTHILKTAGYDAAMCGNVGFSMARLVAEDPHKYYVVEMSSFQLDGTYKFHPNVS 175

Query: 185 VLLNISPDHLDRH-HTLENYVNIKKKI----------VTMSKHAIICINDHQCEKIAYDM 233
           VLLNI+PDHLDR+ H  E Y   K +I          V   + A I       E+ + + 
Sbjct: 176 VLLNITPDHLDRYKHKFELYALSKMRITQQLGKGDSFVYWEEDAFI---KKYLEQHSMEC 232

Query: 234 NFIGHSISRISSQSL-QSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVC 292
             +  S+    +++L +SD +    E+    SA S    D +    KHN+ N + SA+V 
Sbjct: 233 TLLPFSLQTSGAKALYESDKETLHIEAQHNLSAFSIPKRDLAL-VGKHNLLNAMASALVA 291

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYW 352
            + G+  E + +AL     + HR++ +A +  V +INDSKATN+ S  +A   +   +  
Sbjct: 292 REFGVSNEYLGKALRDFKNVPHRIEYVAEIDGVRYINDSKATNIQSTFYALEAQTTPVVL 351

Query: 353 IAGGLSKSDDFSTLFPFI-SKIAKAYFIGNSAMLFFHHFGGKINSTL-SKTLDQALKSVV 410
           I GG  K +++S +   + SK     F+G         F GKI+    ++++D+ L    
Sbjct: 352 ILGGTDKGNNYSEIEDVVLSKCRALIFMGIDNDKLHRAFDGKIDQIRDARSMDECLTHA- 410

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              E  Q   +VL SP CASFD + N+ +RG  F ++V  I
Sbjct: 411 --QELAQSGDVVLLSPACASFDLFKNYEDRGEQFKNKVLAI 449


>gi|49483346|ref|YP_040570.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus MRSA252]
 gi|257425237|ref|ZP_05601662.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 55/2053]
 gi|257427897|ref|ZP_05604295.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257430530|ref|ZP_05606912.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257433291|ref|ZP_05609649.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257436133|ref|ZP_05612180.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M876]
 gi|282903735|ref|ZP_06311623.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus C160]
 gi|282905499|ref|ZP_06313354.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282908474|ref|ZP_06316304.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282910756|ref|ZP_06318559.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282913959|ref|ZP_06321746.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M899]
 gi|282924004|ref|ZP_06331680.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus C101]
 gi|283957926|ref|ZP_06375377.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|293500992|ref|ZP_06666843.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|293509950|ref|ZP_06668659.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M809]
 gi|293526539|ref|ZP_06671224.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M1015]
 gi|295427669|ref|ZP_06820301.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297591373|ref|ZP_06950011.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|60390436|sp|Q6GHQ2|MURD_STAAR RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|49241475|emb|CAG40161.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MRSA252]
 gi|257271694|gb|EEV03832.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 55/2053]
 gi|257274738|gb|EEV06225.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 65-1322]
 gi|257278658|gb|EEV09277.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 68-397]
 gi|257281384|gb|EEV11521.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus E1410]
 gi|257284415|gb|EEV14535.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M876]
 gi|282313976|gb|EFB44368.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus C101]
 gi|282322027|gb|EFB52351.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M899]
 gi|282325361|gb|EFB55670.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus WBG10049]
 gi|282327536|gb|EFB57819.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus WW2703/97]
 gi|282330791|gb|EFB60305.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus Btn1260]
 gi|282595353|gb|EFC00317.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus C160]
 gi|283790075|gb|EFC28892.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus A017934/97]
 gi|290920611|gb|EFD97674.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M1015]
 gi|291095997|gb|EFE26258.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 58-424]
 gi|291467400|gb|EFF09917.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus M809]
 gi|295128027|gb|EFG57661.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus EMRSA16]
 gi|297576259|gb|EFH94975.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MN8]
 gi|312438440|gb|ADQ77511.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus TCH60]
 gi|315194069|gb|EFU24462.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus CGS00]
          Length = 449

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 223/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDKNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|258423773|ref|ZP_05686659.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9635]
 gi|257846005|gb|EEV70033.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9635]
          Length = 449

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 223/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDSNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVQPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKTKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|15924173|ref|NP_371707.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926766|ref|NP_374299.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus N315]
 gi|57650295|ref|YP_186059.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus COL]
 gi|82750790|ref|YP_416531.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus RF122]
 gi|87160865|ref|YP_493774.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88194889|ref|YP_499689.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148267675|ref|YP_001246618.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus JH9]
 gi|150393733|ref|YP_001316408.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus JH1]
 gi|151221305|ref|YP_001332127.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156979504|ref|YP_001441763.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509360|ref|YP_001575019.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus USA300_TCH1516]
 gi|221140645|ref|ZP_03565138.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus str. JKD6009]
 gi|253733578|ref|ZP_04867743.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|255005970|ref|ZP_05144571.2| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257795761|ref|ZP_05644740.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9781]
 gi|258415985|ref|ZP_05682255.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9763]
 gi|258419732|ref|ZP_05682699.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9719]
 gi|258438774|ref|ZP_05689927.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9299]
 gi|258444520|ref|ZP_05692849.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8115]
 gi|258447647|ref|ZP_05695791.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A6300]
 gi|258449489|ref|ZP_05697592.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A6224]
 gi|258451881|ref|ZP_05699902.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A5948]
 gi|258454868|ref|ZP_05702832.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A5937]
 gi|262048756|ref|ZP_06021638.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus D30]
 gi|269202798|ref|YP_003282067.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282892669|ref|ZP_06300904.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8117]
 gi|282916433|ref|ZP_06324195.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus D139]
 gi|282919964|ref|ZP_06327693.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9765]
 gi|282929228|ref|ZP_06336803.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A10102]
 gi|283770245|ref|ZP_06343137.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus H19]
 gi|284024107|ref|ZP_06378505.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus 132]
 gi|294848176|ref|ZP_06788923.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9754]
 gi|295407121|ref|ZP_06816922.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8819]
 gi|296276141|ref|ZP_06858648.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus MR1]
 gi|297245993|ref|ZP_06929852.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8796]
 gi|304381257|ref|ZP_07363910.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ATCC BAA-39]
 gi|60392791|sp|P0A089|MURD_STAAM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|60392792|sp|P0A090|MURD_STAAN RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|60392793|sp|P0A091|MURD_STAAU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|62900659|sp|Q5HGP8|MURD_STAAC RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|122063260|sp|Q2FHQ4|MURD_STAA3 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|122063261|sp|Q2FZ92|MURD_STAA8 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|122063262|sp|Q2YXD9|MURD_STAAB RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|166224766|sp|A7X1C4|MURD_STAA1 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|172048845|sp|A6QG83|MURD_STAAE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|189082916|sp|A6U103|MURD_STAA2 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|189082917|sp|A5IS69|MURD_STAA9 RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|189082918|sp|A8Z3M4|MURD_STAAT RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|2271510|gb|AAC46291.1| UDP-N-acetylmuramoyl-L-alanine : D-glutamate ligase [Staphylococcus
           aureus]
 gi|13700982|dbj|BAB42278.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus N315]
 gi|14246953|dbj|BAB57345.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus Mu50]
 gi|57284481|gb|AAW36575.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus COL]
 gi|82656321|emb|CAI80735.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus RF122]
 gi|87126839|gb|ABD21353.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus USA300_FPR3757]
 gi|87202447|gb|ABD30257.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus NCTC 8325]
 gi|147740744|gb|ABQ49042.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus JH9]
 gi|149946185|gb|ABR52121.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus JH1]
 gi|150374105|dbj|BAF67365.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus str. Newman]
 gi|156721639|dbj|BAF78056.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus Mu3]
 gi|160368169|gb|ABX29140.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|253728448|gb|EES97177.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus TCH130]
 gi|257789733|gb|EEV28073.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9781]
 gi|257839321|gb|EEV63795.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9763]
 gi|257844317|gb|EEV68699.1| UDP-N-acetylMuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9719]
 gi|257848033|gb|EEV72026.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9299]
 gi|257850013|gb|EEV73966.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8115]
 gi|257853838|gb|EEV76797.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A6300]
 gi|257857477|gb|EEV80375.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A6224]
 gi|257860489|gb|EEV83316.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A5948]
 gi|257863251|gb|EEV86015.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A5937]
 gi|259163212|gb|EEW47772.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus D30]
 gi|262075088|gb|ACY11061.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus ED98]
 gi|269940677|emb|CBI49056.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus TW20]
 gi|282319873|gb|EFB50221.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus D139]
 gi|282589187|gb|EFB94284.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A10102]
 gi|282594680|gb|EFB99664.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9765]
 gi|282764666|gb|EFC04791.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8117]
 gi|283460392|gb|EFC07482.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus H19]
 gi|283470393|emb|CAQ49604.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ST398]
 gi|285816865|gb|ADC37352.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus 04-02981]
 gi|294824976|gb|EFG41398.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A9754]
 gi|294967974|gb|EFG44002.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8819]
 gi|297177157|gb|EFH36411.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus A8796]
 gi|302751006|gb|ADL65183.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|304340240|gb|EFM06181.1| UDP-N-acetylmuramoyl-L-alanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ATCC BAA-39]
 gi|312829577|emb|CBX34419.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ECT-R 2]
 gi|315130974|gb|EFT86958.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus CGS03]
 gi|315196913|gb|EFU27256.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus CGS01]
 gi|320141002|gb|EFW32849.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MRSA131]
 gi|320143058|gb|EFW34848.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MRSA177]
 gi|323440955|gb|EGA98662.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus O11]
 gi|323442272|gb|EGA99902.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus O46]
 gi|329313851|gb|AEB88264.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus T0131]
 gi|329725034|gb|EGG61530.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 21189]
 gi|329727477|gb|EGG63933.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 21172]
          Length = 449

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 223/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|319953738|ref|YP_004165005.1| udp-n-acetylmuramoylalanine--d-glutamate ligase [Cellulophaga
           algicola DSM 14237]
 gi|319422398|gb|ADV49507.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Cellulophaga
           algicola DSM 14237]
          Length = 444

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 132/468 (28%), Positives = 222/468 (47%), Gaps = 54/468 (11%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWS------- 63
           + + G G SG+  A   K  G  V   D         KD   +V++  EI W        
Sbjct: 4   LVILGGGESGVGTAILAKKKGYEVFVSDKGII-----KDKYRKVLEHFEIEWEDQQHTEE 58

Query: 64  -IISFLVL--SPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
            I++  V+  SPGI     +    ++   +  + +I +IE   +        +  I +TG
Sbjct: 59  KILNADVVMKSPGIP----DKIALIQKLKEKKIPVISEIEFASK-----YTDAKIIGITG 109

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTID 180
           +NGK++T  L++H+L+  G  V + GNIG     +   +   +YV+E SS+Q++      
Sbjct: 110 SNGKTTTTMLVNHILKSEGLHVGMAGNIGDSYAKMVAENDFEYYVLEISSFQLDGIVDFK 169

Query: 181 PSIGVLLNISPDHLDRH-HTLENYVNIKKKIV---TMSKHAIICINDHQC----EKIAYD 232
           P I +L NISPDHLDR+ +  ENY+  K +I    T   + I   +D       +K    
Sbjct: 170 PHIAILTNISPDHLDRYDYKYENYIASKFRIAENQTEDDYFIYDADDKDLTDWLKKHPVK 229

Query: 233 MNFIGHSISR-ISSQSLQSDSDLYI--DESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
              + +SI R I   +  ++ D+ I  +   LK    S      S E K HN++N + ++
Sbjct: 230 AKLMPYSIERTIEEGAFSTNKDITITTNNDTLKMKTDS-----LSLEGK-HNLKNTMAAS 283

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
                +G++ E I+ ++ +  G  HRL+ + ++ HV +INDSKATN+++  +A  + +  
Sbjct: 284 TASKLIGIRKETIRNSVANFQGAEHRLEKVLKIHHVEYINDSKATNVNATYYALDSVRTP 343

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGGKIN-----STLSKTLD 403
             WI GG+ K +D+ +L P + +  KA   +G         FG  ++       +S+T+ 
Sbjct: 344 TVWIVGGVDKGNDYKSLMPLVREKVKAIICLGKDNTKIIEAFGNVVDLIVEAYDMSETVK 403

Query: 404 QALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            A K   R          VL SP CASFD ++N+ +RG  F + V  +
Sbjct: 404 IAYKMAER-------GDTVLLSPACASFDLFDNYEDRGNQFKAAVQNL 444


>gi|326693779|ref|ZP_08230784.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           argentinum KCTC 3773]
          Length = 448

 Score =  173 bits (438), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 130/468 (27%), Positives = 219/468 (46%), Gaps = 36/468 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAW-------DDHPCAVKQAKDMGIE 53
           MK  +F N  + VFG  RSG +AA  L   G  V          DD      Q +  G+ 
Sbjct: 1   MKAQAFNNKKVMVFGWARSGKAAAQRLVTLGAQVTVVNGGDFVPDD---TFNQLQAAGVT 57

Query: 54  VIDFREIPWSIISF--LVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL 111
            I+  E      SF  L+ +PGI          V+ A   ++ ++ ++ +       SS 
Sbjct: 58  FINHDEATSLDASFDYLIKNPGIPYDTA----LVQRAIALDIPVLTEVAV-----ALSSF 108

Query: 112 QSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSS 170
           +   IAVTG+NGK++T +LI  +L  +G  V   GNIG P+  +    + +   ++E SS
Sbjct: 109 EGRLIAVTGSNGKTTTTSLIREMLLADGQRVTTAGNIGTPVSEVVADLTADDTLLLELSS 168

Query: 171 YQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCE 227
           +Q+   P I P I ++ NI  +HLD H T E YV  K ++    T+++  ++  +     
Sbjct: 169 FQLMGVPDIQPDIALITNIFANHLDYHGTREQYVAAKFQLTQNQTVAQTLVLNADSPDTA 228

Query: 228 KIAYDMNFIGHSISRISS--QSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNL 285
           +   D        SR  S  +   +  +L ID+  +      +++         HN++N+
Sbjct: 229 QFTADTAAQVVPFSRTQSGHRVAATAGNLVIDDQVVMPLTAIKLV-------GPHNLENI 281

Query: 286 VTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN 345
           + +  V    G++ E I++ L S GG+ HRL+ +     V++ NDSKAT++ +   A  +
Sbjct: 282 LAAVTVAKLAGVENEAIRQVLASFGGVAHRLEYLFTDQAVMYYNDSKATDIEATQTALDS 341

Query: 346 EKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA 405
             +   W+AGGL + DD + L P ++ +      G +          K      +T+D  
Sbjct: 342 FDQPTIWLAGGLDRGDDLTRLLPNMTHVKTVVAFGETQQKVVAV--AKAAGLPVQTVDDV 399

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
             +    V   Q   +VL SP  AS+DQY+NF  RG +F+S++ ++ G
Sbjct: 400 TAAARLAVTLAQAGDVVLLSPAAASWDQYDNFEVRGEAFVSELKKVLG 447


>gi|225023739|ref|ZP_03712931.1| hypothetical protein EIKCOROL_00603 [Eikenella corrodens ATCC
           23834]
 gi|224943621|gb|EEG24830.1| hypothetical protein EIKCOROL_00603 [Eikenella corrodens ATCC
           23834]
          Length = 451

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 135/457 (29%), Positives = 217/457 (47%), Gaps = 33/457 (7%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAK------DMGIEVIDF 57
           S ++N  I V G+G SG+S    L   G  V A+D    A KQA+       +       
Sbjct: 7   SEWQNQKILVAGMGGSGISMLDFLSRQGAAVAAYDADFPAAKQAELQQRFPGLACHTGYL 66

Query: 58  REIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIA 117
           +         L LSPG++         ++   Q    ++GD+E+   E   S  ++  IA
Sbjct: 67  KNALAEGFDILALSPGVSERTPE----IEAFKQAGGRVLGDVEILAHE--LSGKRNKIIA 120

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR-----FYVIECSSYQ 172
           +TG+NGK++  +L+ H+ R+ G D  + GNIG P+L  E +   +      +V+E SS+Q
Sbjct: 121 ITGSNGKTTVTSLVGHLCRECGLDTVVAGNIGTPVL--EAYEDRQEQSADVWVLELSSFQ 178

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYD 232
           +E T  ++ +   +LNIS DHL+R+  L +Y + K KI   S   +I  +D  C      
Sbjct: 179 LENTDHLNAAAAAVLNISEDHLNRYDDLLDYAHAKDKIFRGSGVQVINADDALCRA---- 234

Query: 233 MNFIGHSISRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
           M   G  + R S   LQ ++D + D +  +LK  A + +          HN  N++ +  
Sbjct: 235 MKRSGREVRRFS---LQQETDYWFDAASGYLKHGAETLIAAADIPLQGLHNAANVLAALA 291

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E++ R + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 292 LCEAIGLPREQLLRHVRTFKGLPHRVEKIGEKNGVVFIDDSKGTNVGATEAAIAGLQSPL 351

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + IAGG  K  DF+ L   +   A+A   IG  A        G  +      +L +A+++
Sbjct: 352 FLIAGGQGKGQDFTPLKNVLPGKARAVLLIGEDAPQIRRDLAGCGVEMMDCASLQEAVQT 411

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFM 445
             R  E      IVL SP CASFD +  +  R   F+
Sbjct: 412 AYRLAEP---GDIVLLSPACASFDMFKGYAHRSQVFI 445


>gi|292490622|ref|YP_003526061.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Nitrosococcus
           halophilus Nc4]
 gi|291579217|gb|ADE13674.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Nitrosococcus
           halophilus Nc4]
          Length = 452

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 137/452 (30%), Positives = 215/452 (47%), Gaps = 26/452 (5%)

Query: 10  SIAVFGLGRSGLSAACALKDSGVHVIAWD--DHPCAV----KQAKDMGIEVIDFREIPWS 63
           S  + GLG++GLS A  L + G+ V   D  + P  +    +Q   + + + DF      
Sbjct: 13  SAVIVGLGKTGLSCARFLANRGLSVTVVDSREAPPGLAALQEQVPGVAVRLGDFEVALMQ 72

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
               LV+SPG+AL+       +++A    + ++GDIELF         Q+P IA+TG+NG
Sbjct: 73  QAERLVISPGVALS----EPAIQVAQARGIPVLGDIELFAYWA-----QAPVIAITGSNG 123

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+   L+  + R+ G  V  GGN+GLP L L        YV+E SS+Q+E T T++   
Sbjct: 124 KSTVTVLVEAMARQAGKKVLSGGNLGLPALELLEKPVPDLYVLELSSFQLETTSTLNAVA 183

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
             +LNISPDH+DR+  LE YV  K ++   +   +I  +D Q   +A       H +   
Sbjct: 184 ACILNISPDHMDRYPNLEAYVQAKGRVYHGTGAMVINADDVQVAGLAQPER---HCLRFT 240

Query: 244 SSQSLQSDSDLYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTSAVVCMQLGLKVEE 301
                  +  L         +   E++    Q     +HN+ N + +  +    GL    
Sbjct: 241 LGAPAADEYGLRERAGETWLARGHELLLPARQFPLVGRHNLANALAALALGEAAGLPQLA 300

Query: 302 IKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSK 359
           +  AL    GL HR + +A+   V + NDSK TN+ + + A   L+ + ++  IAGG+ K
Sbjct: 301 MLSALREFRGLPHRCEWVAQANGVDWYNDSKGTNVGATVAAIEGLHCQGKLVLIAGGVGK 360

Query: 360 SDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQL 418
             DFS L   +S+ A+A   +G  A           NS     ++   ++V +     + 
Sbjct: 361 GADFSPLCAPLSRRARAVVLMGQDAPRLEAALA---NSVPLYQVNDMGEAVNKASALAEP 417

Query: 419 PSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
              VL SP CASFD Y+ F  RG +F+  V E
Sbjct: 418 GDSVLLSPACASFDMYSGFEARGQAFIQAVQE 449


>gi|49486023|ref|YP_043244.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Staphylococcus aureus subsp. aureus MSSA476]
 gi|297208175|ref|ZP_06924605.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|60390422|sp|Q6GA29|MURD_STAAS RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|49244466|emb|CAG42894.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus MSSA476]
 gi|296886914|gb|EFH25817.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ATCC 51811]
 gi|329728830|gb|EGG65251.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Staphylococcus
           aureus subsp. aureus 21193]
          Length = 449

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 223/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIIYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRAMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|308048066|ref|YP_003911632.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ferrimonas
           balearica DSM 9799]
 gi|307630256|gb|ADN74558.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Ferrimonas
           balearica DSM 9799]
          Length = 433

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 136/443 (30%), Positives = 215/443 (48%), Gaps = 34/443 (7%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKD---MGIEVIDFREIPWSIIS 66
           + GLG +GLS    L      +  WD   + P A   A+D   + ++   F     +   
Sbjct: 10  ILGLGITGLSVVRHLAAESESLAVWDSRANPPGADTLARDFAHVALQTGPFDGDVLAQAK 69

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            LV+SPGI L        +  A    VE++GDIELF R     +  +P +A+TG+NGKS+
Sbjct: 70  RLVVSPGIDLRTP----ALAQAIAAGVEVVGDIELFAR-----AADAPVVAITGSNGKST 120

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
              L+ H+ +  G  V +GGNIG P L+L     ++ YV+E SS+Q+E T ++   +G +
Sbjct: 121 VTTLVGHLAQACGVSVGVGGNIGTPALDL-LGQGHQLYVLELSSFQLETTRSLPAQVGTV 179

Query: 187 LNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISR-ISS 245
           LN+SPDHLDR+ + E Y + K  +    + A+    DH         N +  S  R +S 
Sbjct: 180 LNVSPDHLDRYDSYEAYRDAKLALYPQCRIALFNRADH---------NTLPSSHPRTLSF 230

Query: 246 QSLQSDSDLY-IDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKR 304
                D D + +   +L    T     D       HN QN++ +  +    GL+++ +  
Sbjct: 231 GPDAPDGDNFGVVGDWLMQGQTRLKRRDQLTLVGAHNEQNVLAALALGQAAGLEMDAMLS 290

Query: 305 ALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN-EKRRIYWIAGGLSKSDDF 363
           AL S  GL HR + +A    V ++NDSKATNL +   A    E  R++ IAGG +K  D 
Sbjct: 291 ALDSYRGLPHRCELVAERAGVRYVNDSKATNLGATQAALDGLELGRVWLIAGGDAKGQDL 350

Query: 364 STLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVL 423
           S L P ++++A    +G            + ++T   +++ A   V    +  +   IVL
Sbjct: 351 SVLAPALNQLAGLITLGQDGPAIAAL---RSDATEVVSIESA---VAVAADQARAGDIVL 404

Query: 424 FSPGCASFDQYNNFRERGFSFMS 446
            SP C+S D + +F +RG  F +
Sbjct: 405 LSPACSSLDMFASFEQRGECFAA 427


>gi|270263957|ref|ZP_06192225.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Serratia odorifera
           4Rx13]
 gi|270042150|gb|EFA15246.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Serratia odorifera
           4Rx13]
          Length = 439

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 140/467 (29%), Positives = 220/467 (47%), Gaps = 44/467 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ ++   + + GLG +GLS        GV     D     P   K  + +   + D   
Sbjct: 1   MADYQGKKVVIIGLGLTGLSCVDFFMARGVTPRVMDTRISPPGLDKLPESVERHLGDL-N 59

Query: 60  IPWSIIS-FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           + W + +  +V SPG+AL    AH  +  A    VEIIGD+ELF RE      Q+P +A+
Sbjct: 60  LDWLLAADLIVASPGMAL----AHPALSAAADAGVEIIGDVELFCRE-----AQAPIVAI 110

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPT 178
           TG+NGKS+   L+  + +  G+ V +GGNIGLP L+L      + YV+E SS+Q+E T +
Sbjct: 111 TGSNGKSTVTTLVGEMAKAAGWAVGVGGNIGLPALSL-LRQECQLYVLELSSFQLETTFS 169

Query: 179 IDPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG 237
           +  +   +LN++ DH+DR+   L+ Y   K ++   +   ++  +D      A  M   G
Sbjct: 170 LKAAAATILNVTEDHMDRYPFGLQQYRAAKLRVYENAALCVVNADD------ALTMPVRG 223

Query: 238 HSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCMQL 295
                IS  +   D  L   +         E I +  +   T +HN  N + +  +   +
Sbjct: 224 ADQRCISFGADVGDYHLNRQQGETWLRVRGEKILNTREMKLTGRHNYTNALAALALADAV 283

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWI 353
            +      +AL +  GL HR Q       V +INDSKATN+ S   A   L     ++ +
Sbjct: 284 NIPRASSLKALTTFTGLAHRFQLAWEHNGVRWINDSKATNVGSTEAALNGLQVDGTLHLL 343

Query: 354 AGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQAL 406
            GG  KS DFS L          Y  G++  L+ F   G ++       +TL+ T++QA+
Sbjct: 344 LGGDGKSADFSPL--------GRYLQGDNVRLYCFGRDGEQLAELRPEVATLTDTMEQAM 395

Query: 407 KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           +++      VQ   +VL SP CAS DQ+ NF  RG  F     E+ G
Sbjct: 396 QAI---AGRVQPGDMVLLSPACASLDQFRNFEVRGDEFARLAQELGG 439


>gi|260893414|ref|YP_003239511.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Ammonifex degensii
           KC4]
 gi|260865555|gb|ACX52661.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Ammonifex degensii
           KC4]
          Length = 457

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 142/461 (30%), Positives = 217/461 (47%), Gaps = 26/461 (5%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           +K    R   + V G G+SG++A   L   G  V+  D     +    D    V+   E 
Sbjct: 3   LKKVELRGKKVLVIGAGKSGIAATRLLLRHGAEVVLADSQKVDLPPFPDKVRLVLG--EY 60

Query: 61  PWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
           P +     LVLSPG+ LT       V+ A +  +EI+G++EL  R  R     +P +AVT
Sbjct: 61  PSAKEFDLLVLSPGVPLTVPP----VREAKEAGIEIVGELELAFRFAR-----APVVAVT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIELTPT 178
           GTNGK++T AL   + +  G    + GNIGLP+  + E   P    V+E SS+Q+E T T
Sbjct: 112 GTNGKTTTTALTGAIFQAAGLRTWVAGNIGLPLSEVVEEARPEDILVVEVSSFQLETTST 171

Query: 179 IDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKIAYDMNF 235
             P + V+LN++PDHLDRH    +Y   K +I    T  +  ++  +D +   +A D   
Sbjct: 172 FKPVVAVILNLTPDHLDRHGDFNSYRQAKARIFARQTDKEVTVLNYDDPEVRNMAADS-- 229

Query: 236 IGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCM 293
            G  +       L +   +   E  +K       + + +       HN++N + +    +
Sbjct: 230 CGRVLFFSRRHKLATGVWVAKGEILVKWEGVEGKVTEVASLALPGAHNLENALAATAAAV 289

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
              + +E I R L    G+ HRL+ +A +  V ++NDSK TN  + I A       I  I
Sbjct: 290 AQNVPLEVIGRVLREFKGVAHRLELVAEINGVKYVNDSKGTNPEATIKALEAYDCPIVLI 349

Query: 354 AGGLSKSDDFSTLFPFISKIAKAY-FIGNSAMLFFHH--FGGKINSTLSKTLDQALKSVV 410
           AGG +K  DF  L   + +  KA   IG SA L        G  +  L++ L  A++   
Sbjct: 350 AGGRNKGSDFRLLASKMKEKVKALVLIGESAPLLAAQAKAAGVSDIVLARDLPDAVR--- 406

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           R  E  +   +VL SP CAS+D + N+ ERG  F   V E+
Sbjct: 407 RAREKARPGDVVLLSPACASWDMFRNYEERGECFRQAVKEL 447


>gi|261379336|ref|ZP_05983909.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Neisseria
           subflava NJ9703]
 gi|284797775|gb|EFC53122.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Neisseria
           subflava NJ9703]
          Length = 445

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 215/458 (46%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVI----DFR 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++      +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLAGIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E     +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAELQREGKKADMWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+  +D ++ E    C          +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHKADFWL-ERETGCLKQGNEDLIATQDIPLQGLHNAANVMAAIA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL  E +   + +  GL HR++ I     V+FI+DSK TN+ +   A    +  +
Sbjct: 286 LCEAVGLPREALLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   ++  AK  F IG  A        G  +N     TL++A++ 
Sbjct: 346 FVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMIDCATLEEAVQK 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYAQAE---AGDIVLLSPACASFDMFKGYAHRSEVFIE 440


>gi|56459545|ref|YP_154826.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Idiomarina
           loihiensis L2TR]
 gi|62900480|sp|Q5R0M3|MURD_IDILO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|56178555|gb|AAV81277.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Idiomarina
           loihiensis L2TR]
          Length = 463

 Score =  172 bits (437), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 143/479 (29%), Positives = 221/479 (46%), Gaps = 70/479 (14%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           I V GLG++G+S    L+    H    D     VK      I+V D RE P         
Sbjct: 12  IVVLGLGKTGVSVLRYLQ----HKRQQDQKLAEVK------IQVFDSRENPPGLEEAKQI 61

Query: 62  ----------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRER 106
                     W +        ++ SPGI L  +     V LA   ++ I+GD+ELF +E 
Sbjct: 62  LGDAELINRHWELEDTLAADLIIASPGIDLRED----PVVLARDADIPIVGDVELFAQES 117

Query: 107 RFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL--EYFSPNRFY 164
           +      P +AVTG+NGKS+   ++  V ++ G +V   GNIG+P+L+L  +   P+   
Sbjct: 118 KL-----PIVAVTGSNGKSTVTRMVEFVAKQCGKNVAAAGNIGVPVLDLLLQEQHPDAV- 171

Query: 165 VIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH 224
           ++E SS+Q+E   ++      L+NIS DH+DR+ TL+ YV  K++I T +K  I  +N  
Sbjct: 172 ILELSSFQLESVSSLKLKAAALMNISADHMDRYCTLDEYVKAKQRIFTHAKTWI--LNRQ 229

Query: 225 QCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--------QE 276
           Q +   +    +   +    + S      L +  +  + S    V FD S        Q 
Sbjct: 230 QQDTWPHP---VTGKLMTFGNDSHPKHFGL-LSGNIDRVSGPVAVTFDGSVVLRADQLQL 285

Query: 277 TKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNL 336
              HN+ N+  +  +C  + + +E   RA+    GL HR + ++    V+++NDSKATN+
Sbjct: 286 QGIHNLVNVQAALALCQAIDIDIEAAVRAVKEFKGLPHRCELVSDNEGVLWVNDSKATNI 345

Query: 337 HSVIHAFLNEKR----RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGG 392
            +   A    +     R+  IAGG+ K  DF  L   + ++     IG         F G
Sbjct: 346 GATAAAVEGLRPMINGRLLLIAGGVGKGADFRELQSTLERVDILLTIGEDGPRIGQLFNG 405

Query: 393 KINSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              S   K+L QA++        VQ   +VL SP CASFDQ+ NF  RG SF   V  +
Sbjct: 406 ---SRQVKSLQQAVELA---ASLVQTGDMVLLSPACASFDQFQNFEHRGDSFRHAVEAL 458


>gi|262190386|ref|ZP_06048646.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae CT
           5369-93]
 gi|262033726|gb|EEY52206.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae CT
           5369-93]
          Length = 440

 Score =  172 bits (437), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 218/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 10  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTRETPPGQEQLSSD 53

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 54  VALHRGGWNLEWLLNADLVVTNPGIALATPEIQQVLAAG----IPVVGDIELFAWH---- 105

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 106 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 162

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 163 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 222

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   +E+F+ C+  S V         +HN+ 
Sbjct: 223 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLVARNEAFMACAELSLV--------GRHNVA 274

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 275 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 334

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 335 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 385

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 386 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 432


>gi|229514032|ref|ZP_04403494.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           TMA 21]
 gi|229349213|gb|EEO14170.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           TMA 21]
          Length = 467

 Score =  172 bits (437), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 37  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTRETPPGQEQLSSD 80

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 81  VALHRGGWNLEWLLNADLVVTNPGIALATPEIQQVLAAG----IPVVGDIELFAWH---- 132

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 133 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 189

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 190 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 249

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 250 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 302 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 361

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 362 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 412

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 413 SARFYDSMESIIRSIRT-QLKSGDMVLLSPACASFDQFKNFMARGDIF 459


>gi|238918676|ref|YP_002932190.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Edwardsiella
           ictaluri 93-146]
 gi|238868244|gb|ACR67955.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 438

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 139/460 (30%), Positives = 214/460 (46%), Gaps = 36/460 (7%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQAKDMGIEVIDFREI 60
           ++ ++   + + GLG +GLS      + GV   VI     P  + Q        +   E 
Sbjct: 1   MADYQGKRVVIIGLGLTGLSCVDFFMERGVVPRVIDTRATPPGLDQLPASVERHLGSIEQ 60

Query: 61  PWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
            W +    +V SPGIAL+       +  A Q  VEI+GDIELF RE      Q P +A+T
Sbjct: 61  SWLMDADLIVASPGIALSSP----ALDQAAQAGVEIVGDIELFCRE-----AQVPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  +    G+ V +GGNIG+P L+L      R YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMACAAGWQVGVGGNIGVPALSLLKHE-CRLYVLELSSFQLETTASL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN+S DH++R+   L+ Y   K +I   ++  ++  +D      A  M   G 
Sbjct: 171 RAAAATILNVSEDHMNRYPLGLQQYRAAKLRIYENARACVVNADD------ALTMPIHGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFS--QETKKHNIQNLVTSAVVCMQLG 296
               +S      D  L   +  +      E I +    Q T  HN  N + +  +   +G
Sbjct: 225 DTRCVSFGVDVGDYHLNRQQGEIWLRVRGEKILNTKEMQLTGIHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      RAL +  GL HR Q +     V +INDSKATN+ S   A   L+    ++ + 
Sbjct: 285 LPRASSLRALTTFRGLAHRFQLVLEHSGVRWINDSKATNVGSTEAALKGLHLNGTLHLLL 344

Query: 355 GGLSKSDDFSTLFPFI-SKIAKAYFIGNSA---MLFFHHFGGKINSTLSKTLDQALKSVV 410
           GG  K  DF+ L P++     + Y  G  A   ML       + +     T++QA++++ 
Sbjct: 345 GGDGKDADFTPLLPYLRGDRIRLYCFGRDAGPLMLLRPEVSRRFD-----TMEQAMRAL- 398

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
                 +   +VL SP CAS DQ+ NF +RG  F     E
Sbjct: 399 --APLTRAGDMVLLSPACASLDQFKNFEQRGDEFARLARE 436


>gi|300868200|ref|ZP_07112832.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oscillatoria sp.
           PCC 6506]
 gi|300333824|emb|CBN58016.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oscillatoria sp.
           PCC 6506]
          Length = 449

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 218/454 (48%), Gaps = 41/454 (9%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFRE----IPWSIIS 66
           + GLGRSG++AA  LK  G  V   D    P   +Q +++  E I         P + + 
Sbjct: 6   IIGLGRSGIAAARLLKREGYSVTLSDRASSPILQQQQQELATEGIAVELCHSFAPATPLK 65

Query: 67  FLVLSPGIALTGENAHWCVKL---ANQFNVEIIGDIELFVRERRFSSLQS-PFIAVTGTN 122
            +V+SPG+        W +     A +  +E IG++EL  R      LQS P+I +TGTN
Sbjct: 66  LIVVSPGVP-------WDLPALIRARELGIETIGEVELAWRH-----LQSQPWIGITGTN 113

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFS-PNRFYVIECSSYQIELTPTIDP 181
           GK++T ALI+ + +  G+     GNIG     L     P  + + E SSYQIE +P+I P
Sbjct: 114 GKTTTTALIAAIFQTAGFYAPACGNIGYAACELALGEKPPDWVIAEMSSYQIESSPSIAP 173

Query: 182 SIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSIS 241
            I +    +PDHL RH TLENY NIK  ++  S+  +I  +D    +   +      S  
Sbjct: 174 RISIWTTFTPDHLSRHKTLENYYNIKAHLLKQSELQVINGDDPYLREKGVE------SWP 227

Query: 242 RISSQSLQSDSDL--------YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCM 293
           +    S+   ++L        YI++ +        +  D  +    HN QNL+ +     
Sbjct: 228 KACWTSVNGKAELLGDPARGAYIEDGWAIALGEKILPVDSLRMVGSHNQQNLLMAVATAR 287

Query: 294 QLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWI 353
             G++ + I +A+ +  G++HRL+ I     + FINDSKATN  +      +       I
Sbjct: 288 LAGIEKDAIAQAITNFPGVSHRLEHIRTWAGIDFINDSKATNYDAAEVGLASVATPAILI 347

Query: 354 AGGLSK-SDDFSTLFPFISKIAKAYFIGNSAMLFFHHF--GGKINSTLSKTLDQALKSVV 410
           AGG +K  DD + +    +K A    IGN+A  F          N  + +T+++A+ S  
Sbjct: 348 AGGEAKEGDDIAWIETIQAKAAAVLLIGNAADTFAKRLQQANYNNWEIVETMERAV-SRS 406

Query: 411 RDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
            ++       +VL SP CASFDQY NF +RG  F
Sbjct: 407 SELAKEHNAKVVLLSPACASFDQYQNFEQRGDDF 440


>gi|254282164|ref|ZP_04957132.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma
           proteobacterium NOR51-B]
 gi|219678367|gb|EED34716.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [gamma
           proteobacterium NOR51-B]
          Length = 441

 Score =  172 bits (436), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 213/456 (46%), Gaps = 38/456 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHP--------CAVKQAKDMGIEVIDFREIPWSI 64
           + GLG +G S A   + +G+   A D  P        C      +  +   DF  +    
Sbjct: 2   ILGLGATGCSVARFWQRNGIPFKACDTRPEMESELLHCEATAGAEQ-VLFGDFDPVVVDG 60

Query: 65  ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGK 124
           ++ LV+SPGIA+     H  V  A +  V +IGDI+LF+ E       +P I +TG+NGK
Sbjct: 61  LTELVVSPGIAMD----HPLVDRALKAGVRVIGDIDLFMAE-----ANAPVIGITGSNGK 111

Query: 125 SSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIG 184
           S+   +++ +LR +G  V +GGN+G P L+L    P   YV+E SS+Q+E +  +  ++ 
Sbjct: 112 STVTEMVAAILRASGSAVAVGGNLGTPALDL-LEHPADIYVLELSSFQLERSEKLGLAVA 170

Query: 185 VLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRIS 244
            +LNIS DHLDRH ++  Y   K +I   ++  +    D     +  +   +   + R  
Sbjct: 171 TVLNISADHLDRHGSMPRYHQAKHRIFRGARTVVANRADPLTVPLLEEKADV--VVWRDG 228

Query: 245 SQSLQS------DSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLK 298
              L+       D ++ +   F   +A +E+         +HN+ N + +  V    G+ 
Sbjct: 229 EPDLREFGTRVVDGEVMLCRGFDTLAAATELPL-----PGRHNLANALAAMAVASAAGVD 283

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGG 356
            E++   L    GL HR   +  L  + FINDSK TN+ +   A   L     +  IAGG
Sbjct: 284 DEQLVPGLKHFHGLPHRCALVRELDGIRFINDSKGTNIGATRAALEGLGGNGNVVLIAGG 343

Query: 357 LSKSDDFSTLFPFIS-KIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVEN 415
           + K  DF+ L      +  +   +G SA       G  +     +T++QA   V R  E 
Sbjct: 344 VGKGQDFTELQASAEQRCRRVLTVGESAREIELALGATVPCQRVETIEQA---VTRGREL 400

Query: 416 VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +   IVL SP CASFDQ++ +  RG +F   V  +
Sbjct: 401 AKAGDIVLLSPACASFDQFSGYAARGLAFEEAVKAL 436


>gi|16759121|ref|NP_454738.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29140671|ref|NP_804013.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|213052851|ref|ZP_03345729.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213417202|ref|ZP_03350346.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213426157|ref|ZP_03358907.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213646588|ref|ZP_03376641.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213859656|ref|ZP_03385360.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|289823736|ref|ZP_06543348.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|30316091|sp|Q8Z9H0|MURD_SALTI RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|25293608|pir||AC0518 UDP-N-acetylmuramoyl-L-alanine,D-glutamate ligase [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16501411|emb|CAD01283.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29136295|gb|AAO67862.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 438

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/472 (28%), Positives = 224/472 (47%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +++ ++ + GLG +GLS        GV     D     P   K  +++   V    +
Sbjct: 1   MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  EWLLAADLIVASPGIAL----AHPSLSAAASAGVEIVGDIELFCREA-----QAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDADRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           +++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 VSFGVNMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +GL      +AL +  GL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLS 399
              ++ + GG  KS DFS L          Y  G+   L+ F   G ++       +  +
Sbjct: 337 DGTLHLLLGGDGKSADFSPL--------ARYLTGDRIRLYCFGRDGAQLAALRPEIAQQT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T+++A++ +     +VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEEAMRLL---APHVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKEL 437


>gi|197334972|ref|YP_002156999.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio fischeri
           MJ11]
 gi|226722954|sp|B5FB37|MURD_VIBFM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|197316462|gb|ACH65909.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio fischeri
           MJ11]
          Length = 440

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 211/442 (47%), Gaps = 59/442 (13%)

Query: 44  VKQAKDMGIEVIDFREIP--------------------WSI-ISFLVLSPGIALTGENAH 82
           ++Q + + I+VID R+ P                    W I    +V +PGIAL      
Sbjct: 27  LRQPEALTIKVIDTRDTPPGHDQLPENVELHSGGWQQDWLINADLIVTNPGIALASPQ-- 84

Query: 83  WCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALISHVLRKNGYDV 142
             +K A    ++I+GDIELF       ++ +P IA+TG+NGKS+   L   + +  G   
Sbjct: 85  --LKPAIDKGIQIVGDIELFAW-----AVNAPVIAITGSNGKSTVTDLTGEMAKAAGVKT 137

Query: 143 QLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPDHLDRHHTLEN 202
            +GGNIG   L+L        YV+E SS+Q+E T T+       LN+S DH+DR+  + +
Sbjct: 138 AVGGNIGFAALDL-LEQDAELYVLELSSFQLETTSTLKLKAAAFLNLSEDHMDRYQGMAD 196

Query: 203 YVNIKKKIVTMSKHAIICINDHQCEKIAYDM--NFIGHSISRISSQSLQSDSDLYIDESF 260
           Y   K +I     HA +CI +   ++   D+          +     ++ D   Y+ +  
Sbjct: 197 YRQAKLRIF---DHAEVCIVNRDDKQTYPDVEKTLKSFGFDQGDYGCIEKDGIEYLAKDA 253

Query: 261 LKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIA 320
           +   A +E+         KHNI N + +  +   +G+ ++     L +  GLTHR Q +A
Sbjct: 254 MSLLAANELGL-----VGKHNIANSLVAIALLDAVGINLDATLDTLRTYNGLTHRCQVVA 308

Query: 321 RLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYF 378
               + ++NDSKATN+ S + A   L  + +++ + GG+ K  DFS L P +  +     
Sbjct: 309 DNNGIRWVNDSKATNVASTLAALSGLQLEGKLHLLVGGVGKGADFSELSPALHDL----- 363

Query: 379 IGNSAMLFFHHFGGKI-----NSTLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQ 433
             N  M  F   G +       S L +T+D+A+ ++      +    +V+ SP CASFDQ
Sbjct: 364 --NLMMYCFGEDGDQFVSLDPRSLLCETMDEAVATL---YPTLNKGDMVMLSPACASFDQ 418

Query: 434 YNNFRERGFSFMSQVSEIPGIE 455
           Y NF  RG +F +Q+++   IE
Sbjct: 419 YANFMARGDAF-TQLAKQYSIE 439


>gi|307244134|ref|ZP_07526252.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
           [Peptostreptococcus stomatis DSM 17678]
 gi|306492505|gb|EFM64540.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
           [Peptostreptococcus stomatis DSM 17678]
          Length = 454

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 226/458 (49%), Gaps = 26/458 (5%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA-VKQAKD-----MGIEVIDFREIPWSI 64
           I V G+ RSGL+A   L   G  V+  D  P   + Q  D      G+E +  +     +
Sbjct: 5   ILVVGMARSGLAAVKYLAKKGYSVVVNDSKPEEELGQVLDELKAYQGLEYVLGKNPSEEV 64

Query: 65  ---ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGT 121
              +   ++SPG+ L      + VKL  +   E+I ++EL  RE +  +++  FI +TGT
Sbjct: 65  LRQVDLALVSPGVPL---ELDFLVKL-REMGKEVISEVELAYREGQEKNIK--FIGITGT 118

Query: 122 NGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-LEYFSPNRFYVIECSSYQIELTPTID 180
           NGK++T +++  + ++ G D  + GNIG P ++ +E   P    VIE SS+Q+E      
Sbjct: 119 NGKTTTTSIVGEICKEAGLDTYVVGNIGNPAISAVEEAQPGAVLVIELSSFQLEAVYDFR 178

Query: 181 PSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSI 240
           P +  +LN++ DH++RHHT+ENY   K  I        +C+ ++  + I  DM     + 
Sbjct: 179 PEVSTVLNLTEDHMNRHHTMENYAKAKANIFAKQTPESVCVLNYD-DPITRDMGNTCQAR 237

Query: 241 SRISSQSLQSDSDLYIDES--FLKCSATSEVIFDFSQETK---KHNIQNLVTSAVVCMQL 295
               S+  + ++ +Y+D++   +      EV    +++      HN++N + +  +C+  
Sbjct: 238 PVYFSRQSRPEAGIYLDDNKNIIAVKDGREVEIVNAEDLSLPGGHNLENSMAAIGLCLHF 297

Query: 296 GLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRIYWIAG 355
           G+  E IK+ L +   + HRL+ +  +  V+++NDSK TN  S I A  + K  I  IAG
Sbjct: 298 GIDKEIIKKVLTTFKAVEHRLEYVNTVNGVVYVNDSKGTNPDSTIKAVQSYKTPIILIAG 357

Query: 356 GLSKSDDFSTLFPF-ISKIAKAYFIGNSAMLFFH-HFGGKINSTLSKTLDQALKSVVRDV 413
           G  K  DF  LF   ++ +     IG +A L     F   I       LD   ++V++  
Sbjct: 358 GYDKGSDFRELFDIAVNYVRTVLVIGQTADLIADTAFKAGIKEIYK--LDSLKEAVIKAS 415

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +      +VL SP CAS+  Y N+ ERG  F   V+ I
Sbjct: 416 QIADKDDVVLLSPACASWGMYKNYEERGQEFKDIVNNI 453


>gi|148244846|ref|YP_001219540.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
           Vesicomyosocius okutanii HA]
 gi|146326673|dbj|BAF61816.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 432

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 133/459 (28%), Positives = 236/459 (51%), Gaps = 61/459 (13%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKDMGIEVIDFREIP----WSII 65
           + GLG++G S A  L +  ++    D   + P   K    +      F+  P    W+  
Sbjct: 4   ILGLGKTGFSIARFLSEQNINYKIADSRMNPPFLSKYTSLL------FKSKPILGIWTS- 56

Query: 66  SFLV------LSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
           S L+      +SPGIA +     W +K     N+ I+ DIELF    RF+  ++P I +T
Sbjct: 57  SLLIEVDEVFISPGIAQSETIVGWAMKK----NIPIVSDIELF---SRFA--KAPVIGIT 107

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN-----LEYFSPNRFYVIECSSYQIE 174
           G+NGKS+   L++ ++  +G  V +GGNIG+P L+     +EY      YV+E SSYQ++
Sbjct: 108 GSNGKSTVTKLLTQMIADSGMLVAIGGNIGIPALDCLNEKIEY------YVLELSSYQLD 161

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN 234
            +  ++   GV+LNI+PDHLDR+ + E Y++ K  +    +++++ +++    K   ++ 
Sbjct: 162 YSYHLNLITGVVLNITPDHLDRYSSFEYYIHSKLSLYQYCQYSVVNLDEPLIPK-QTNVK 220

Query: 235 FIGHSISRISSQ--SLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVC 292
           + G +I + ++   ++   +  Y+ +      +  EV     Q   +HN +N++ +  + 
Sbjct: 221 YFGINIPKRANDFGTVTCHNICYLLKGNNTLMSVDEV-----QLIGEHNTKNILAALALG 275

Query: 293 MQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHA---FLNEKRR 349
            Q+ L +  + +++ +   L HRL+ + +  ++ + NDSKATN  S I A    + + + 
Sbjct: 276 DQIKLPISSMIQSIKNFKALEHRLEWVIKKQNIDYYNDSKATNAISTIIAIQTLMYKHQN 335

Query: 350 IYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINSTL---SKTLDQA 405
           I  I GG++K +D++ LF FI+K I     IG S   F        NS +   + T+ +A
Sbjct: 336 IVLILGGIAKKEDYTLLFKFINKGITGVVLIGQSTRQFLQEI--NTNSIIYANTNTMQEA 393

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
           +      + N     ++L SPGCASFD ++NF  RG  F
Sbjct: 394 VNIARSMISN----GVILLSPGCASFDMFDNFEHRGRVF 428


>gi|56412398|ref|YP_149473.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|167550679|ref|ZP_02344436.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|168234890|ref|ZP_02659948.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168262189|ref|ZP_02684162.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464322|ref|ZP_02698225.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|168820880|ref|ZP_02832880.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194442341|ref|YP_002039358.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194736856|ref|YP_002113144.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197361334|ref|YP_002140969.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|200387467|ref|ZP_03214079.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204926704|ref|ZP_03217906.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|238911183|ref|ZP_04655020.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|62900669|sp|Q5PDC2|MURD_SALPA RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|56126655|gb|AAV76161.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|194401004|gb|ACF61226.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194712358|gb|ACF91579.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|195633046|gb|EDX51500.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197092809|emb|CAR58235.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|197291916|gb|EDY31266.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|199604565|gb|EDZ03110.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204323369|gb|EDZ08564.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205324366|gb|EDZ12205.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205342390|gb|EDZ29154.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205348968|gb|EDZ35599.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|320084369|emb|CBY94162.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322615947|gb|EFY12864.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322620731|gb|EFY17591.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322623917|gb|EFY20754.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322627365|gb|EFY24156.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322630672|gb|EFY27436.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322638108|gb|EFY34809.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322640594|gb|EFY37245.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647735|gb|EFY44220.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648084|gb|EFY44551.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322656884|gb|EFY53170.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657406|gb|EFY53678.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322663725|gb|EFY59925.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322666558|gb|EFY62736.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322672283|gb|EFY68395.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676405|gb|EFY72476.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322679502|gb|EFY75547.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322686169|gb|EFY82153.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|323195013|gb|EFZ80199.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323200078|gb|EFZ85165.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323201101|gb|EFZ86170.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323209498|gb|EFZ94431.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323212250|gb|EFZ97074.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323216555|gb|EGA01281.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219904|gb|EGA04382.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323225816|gb|EGA10036.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323228642|gb|EGA12771.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323236744|gb|EGA20820.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239755|gb|EGA23802.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323242197|gb|EGA26226.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323249379|gb|EGA33295.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323252288|gb|EGA36139.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323256622|gb|EGA40352.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262991|gb|EGA46541.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323265476|gb|EGA48972.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323271736|gb|EGA55154.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 438

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/472 (28%), Positives = 223/472 (47%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +++ ++ + GLG +GLS        GV     D     P   K  +++   V    +
Sbjct: 1   MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  EWLLAADLIVASPGIAL----AHPSLSAAASAGVEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDADRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           +++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 VSFGVNMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +GL      +AL +  GL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLS 399
              ++ + GG  KS DFS L          Y  G+   L+ F   G ++       +  +
Sbjct: 337 DGTLHLLLGGDGKSADFSPL--------ARYLTGDRIRLYCFGRDGAQLAALRPEIAQQT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T+++A++ +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEEAMRLL---APRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKEL 437


>gi|298694474|gb|ADI97696.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Staphylococcus
           aureus subsp. aureus ED133]
          Length = 449

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 131/460 (28%), Positives = 223/460 (48%), Gaps = 33/460 (7%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D    +     K  + MGI V+ 
Sbjct: 2   LNYTGLENKNVLVVGLAKSGYEAAKLLSKLGANVTVNDGKDLSQDAHAKDLESMGISVVS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P +++     +V +PGI  T       VK      ++I+ ++EL      +   ++
Sbjct: 62  GSH-PLTLLDNNPIIVKNPGIPYTVSIIDEAVKRG----LKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG     + +   P  + V E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFKKSRLTGRLSGNIGYVASKVAQEVKPTDYLVTELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT--MSKHAIICINDHQCEKIA 230
           +       P I ++ NI   HLD H  LENY N KK+I      +  +IC N HQ + I 
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHENLENYQNAKKQIYKNQTEEDYLIC-NYHQRQVIE 230

Query: 231 YDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAV 290
            +   +       S+Q  Q    +YI + F+       +  +      +HN++N++ + +
Sbjct: 231 SEE--LKAKTLYFSTQ--QEVDGIYIKDGFIVYKGVRIINTEDLVLPGEHNLENILAAVL 286

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
            C+  G+ ++ I  +L +  G+ HRLQ +       + NDSKATN  +   A  +  + I
Sbjct: 287 ACILAGVPIKAIIDSLTTFSGIEHRLQYVGTNRTNKYYNDSKATNTLATQFALNSFNQPI 346

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA--LKS 408
            W+ GGL + ++F  L P++  +      G +   F      K+ ++  K++ +A  ++ 
Sbjct: 347 IWLCGGLDRGNEFDELIPYMENVRVMVVFGQTKAKF-----AKLGNSQGKSVIEANNVED 401

Query: 409 VVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            V  V+++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 402 AVDKVQDIIEPNDVVLLSPACASWDQYSTFEERGEKFIER 441


>gi|123969098|ref|YP_001009956.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Prochlorococcus marinus str. AS9601]
 gi|123199208|gb|ABM70849.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Prochlorococcus
           marinus str. AS9601]
          Length = 476

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 145/468 (30%), Positives = 227/468 (48%), Gaps = 33/468 (7%)

Query: 4   SSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVID------- 56
           SS RN ++ V GLG+SG  AA  L+     VI W+ +       +   +E +D       
Sbjct: 6   SSKRNINL-VIGLGKSGFWAAKYLRSINKRVIVWESNDGIEFLERKTALEELDVLVSLNK 64

Query: 57  ---FREIPWSI--ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSL 111
              F EI   +  I  +V+SP I       H  +    +  + +IG+I +     +    
Sbjct: 65  EFVFEEIQPFVREIESVVVSPSIPYD----HVTIVELKKKGIRVIGEINVAWEILK---- 116

Query: 112 QSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIEC 168
            + +I +TGTNGK++   L+SH+L   G      GNIG P+    Y   +    + V E 
Sbjct: 117 DTNWIGITGTNGKTTVTHLLSHILCDTGLYAPFAGNIGTPLCKYAYSKKHEKIDWVVAEL 176

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEK 228
           SSYQIE++P + P+IG+    + DHL+RH TLENY NIKK ++  S   I   +D     
Sbjct: 177 SSYQIEISPEVKPNIGIWTTFTEDHLERHKTLENYFNIKKSLLEKSDFRIYNYDDKNLRN 236

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK--HNIQNLV 286
               ++  G  I+    +S     D +ID+         + +F     + K  HN+QNL+
Sbjct: 237 YYSSLSR-GVWITTSLDKSNFIHCDYWIDDQAYIVERGKK-LFKLEHFSLKGMHNLQNLL 294

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
                  ++GL  ++IK +L +   L HR++TI +   +  INDSKATN  S I    + 
Sbjct: 295 LVIAAARKVGLSGKKIKDSLSNYKQLPHRMETIYKNNGLEIINDSKATNFDSSIAGISSI 354

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFI-GNSAMLF---FHHFGGKINSTLSKTL 402
           + +I  IAGG  K +++S     + K  K  F+ G S+ +      + G K N      L
Sbjct: 355 EGQIIIIAGGRLKGNEYSEWIKVLKKKVKCVFLFGESSKVLKMALINEGFKKNIFEFSEL 414

Query: 403 DQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
            + L  V   ++N ++ ++ LFSP C+SFDQ+ N+ ERG  F   +SE
Sbjct: 415 KELLNFVFHYLQNNRVGTL-LFSPSCSSFDQFKNYEERGDYFKKLISE 461


>gi|319939629|ref|ZP_08013988.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Streptococcus
           anginosus 1_2_62CV]
 gi|319811218|gb|EFW07524.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Streptococcus
           anginosus 1_2_62CV]
          Length = 450

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 140/475 (29%), Positives = 222/475 (46%), Gaps = 52/475 (10%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHP----CAVKQAKDMGIEVIDFR 58
           +++F N  + V GL +SG SAA  L   G  V   D  P     A +   + GI+V+   
Sbjct: 4   ITNFANKKVLVLGLAKSGESAARLLDKLGAIVTVNDGKPFEENPAAQSLLEEGIKVVTGG 63

Query: 59  EIPWSII----SFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP 114
             P  ++      +V +PGI       +  VK A +  + +I ++EL      +    +P
Sbjct: 64  H-PLELLDEDFELMVKNPGIRYD----NPMVKKALEKEIPVITEVEL-----AYLISDAP 113

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYF-SPNRFYVIECSSYQI 173
            I +TG+NGK++T  +I+ VL   G    L GNIG P   +    + N   V+E SS+Q+
Sbjct: 114 IIGITGSNGKTTTTTMIAEVLTAGGQSGLLSGNIGFPASQVATTATKNDTLVMELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYV----NIKKKIVTMSKHAIICINDHQCEKI 229
               T  P I V+ N+ P H+D H + ENYV    NI+K    MSK   + +N +Q   +
Sbjct: 174 MGIETFHPEIAVITNLMPTHIDYHGSFENYVAAKWNIQK---NMSKSDFLVLNFNQT--L 228

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSA 289
           A ++     +     S + + D   Y++ + L       +  D       HN++N + + 
Sbjct: 229 AKELAAKTQATVVPFSTTEKVDG-AYLEGNMLTFRGEPVMAADELGVPGSHNVENALATI 287

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN-EKR 348
            V    G++ + IK  L   GG+ HRLQ +  + HV F NDSK+TN+ +   A    +  
Sbjct: 288 AVAKLRGIENQVIKETLAGFGGVKHRLQYVGEINHVKFYNDSKSTNILATQKALSGFDNS 347

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKS 408
           ++  IAGGL + ++F  L P I  + K   +G SA            + + +  D+A  S
Sbjct: 348 KVILIAGGLDRGNEFDELVPDIQGLKKMVILGESA------------ARVKRAADKAGVS 395

Query: 409 VV--RDVEN--------VQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
            +   DV++         Q   IVL SP  AS+D Y NF  RG  F++   E+ G
Sbjct: 396 YMDAADVKDATQKAFAEAQAGDIVLLSPANASWDMYPNFEVRGDEFIATFEELKG 450


>gi|94501898|ref|ZP_01308408.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanobacter sp.
           RED65]
 gi|94425951|gb|EAT10949.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Oceanobacter sp.
           RED65]
          Length = 446

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/475 (28%), Positives = 228/475 (48%), Gaps = 56/475 (11%)

Query: 2   KLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP 61
           ++++  N+ + V GLG++G SA   L   G +VIA D    A   A ++     D + I 
Sbjct: 3   QVNALTNYHV-VIGLGKTGDSAVRHLLAQGENVIAMDTREEA-PFASELRATYPDLQLIE 60

Query: 62  WSI-------ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP 114
             +        + ++ SPGI L  +     ++ A    V ++ DI++F       +  +P
Sbjct: 61  GGLDASVLINAARIIASPGIPLATDE----IQRAIDAGVPVVSDIQVFAE-----AANAP 111

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIE 174
            IA+TG+N KS+   L+  + ++ G    +GGN+G P L L   S    YV+E SS+Q+E
Sbjct: 112 IIAITGSNAKSTVTTLVGEMAKQCGLKAAVGGNLGTPALEL-LNSDIDVYVMELSSFQLE 170

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDH-------QC- 226
            T  ++  +  +LNISPDHLDR+ + E Y   K KI    + A+I ++D+        C 
Sbjct: 171 ATEHLNAKVATVLNISPDHLDRYDSYEGYYQTKYKIFNGCEKAVINLDDNLAQPKTLNCP 230

Query: 227 EKIAYDM-----NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHN 281
           E+I + +     +F+    ++     ++ D+ L +D+  +K                 HN
Sbjct: 231 EQIGFSIDGKGADFVLDRTAQPWQLIVEGDALLSVDQLKIK---------------GLHN 275

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
             N + +  +    GL ++ + +AL S  GL HR Q I ++  V F NDSK TN+ +   
Sbjct: 276 YSNALAALALGHGFGLDMDGMLKALKSFPGLDHRCQWIKQVDEVDFYNDSKGTNVGATEA 335

Query: 342 AFLN----EKRRIYWIAGGLSKSDDFSTLFPFISK-IAKAYFIGNSAMLFFHHFGGKINS 396
           A         +RI  + GG+ K  DF  L P I + ++K    G    +      G ++ 
Sbjct: 336 ALKGLGPEYAKRIVLMLGGVGKDADFKVLRPVIDQYVSKVIVYGQDQDIIAKDLSG-VDL 394

Query: 397 TLSKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
             +++ +QA +   R+ ++      V+FSP CASFD ++ F  RG +F S V  +
Sbjct: 395 DRAESFEQAFEMAYRNADH---KGAVVFSPACASFDMFSGFEARGEAFKSMVEAL 446


>gi|16763516|ref|NP_459131.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167989999|ref|ZP_02571099.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168243459|ref|ZP_02668391.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|194448105|ref|YP_002044096.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|197265563|ref|ZP_03165637.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198243206|ref|YP_002214078.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205351465|ref|YP_002225266.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207855640|ref|YP_002242291.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|30316095|sp|Q8ZRU4|MURD_SALTY RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|16418625|gb|AAL19090.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|194406409|gb|ACF66628.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|197243818|gb|EDY26438.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197937722|gb|ACH75055.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205271246|emb|CAR36034.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205331455|gb|EDZ18219.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205337477|gb|EDZ24241.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|206707443|emb|CAR31716.1| UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|261245359|emb|CBG23148.1| D-glutamic acid adding enzyme [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267991804|gb|ACY86689.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301156754|emb|CBW16229.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312911095|dbj|BAJ35069.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|323128446|gb|ADX15876.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326621822|gb|EGE28167.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|326626492|gb|EGE32835.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332987079|gb|AEF06062.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 438

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/472 (28%), Positives = 223/472 (47%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +++ ++ + GLG +GLS        GV     D     P   K  +++   V    +
Sbjct: 1   MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  EWLLAADLIVASPGIAL----AHPSLSAAASAGVEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDADRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           +++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 VSFGVNMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +GL      +AL +  GL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLS 399
              ++ + GG  KS DFS L          Y  G+   L+ F   G ++       +  +
Sbjct: 337 DGTLHLLLGGDGKSADFSPL--------TRYLTGDRIRLYCFGRDGAQLAALRPEIAQQT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T+++A++ +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEEAMRLL---APRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKEL 437


>gi|116618590|ref|YP_818961.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
 gi|122271210|sp|Q03W34|MURD_LEUMM RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|116097437|gb|ABJ62588.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
          Length = 449

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 137/474 (28%), Positives = 223/474 (47%), Gaps = 53/474 (11%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIA-----WDDHPCAVKQ--AKDMGIE 53
           M+ + F+N  + VFG  RSG +AA  L   G  V       +D      +   A D+ + 
Sbjct: 1   MQATDFKNKKVMVFGWARSGKAAAQLLTKLGSKVTVVNGGEFDAQDATYRSLLAADVTLI 60

Query: 54  VIDFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
             D  E   S   +L+ +PGI       H  V+ A + N+ I+ ++E+       S+   
Sbjct: 61  GTDNAETLDSTYDYLIKNPGINYD----HPLVQKAEKLNIPILTEVEI-----ALSTFNG 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEY-FSPNRFYVIECSSYQ 172
             IAVTG+NGK++T +LI  +L+ +G +V   GNIG+P+  + +  +     ++E SS+Q
Sbjct: 112 RLIAVTGSNGKTTTTSLIRDMLKADGQNVITAGNIGVPVSEVVFDLTREDTLLLELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV---TMSKHAIICINDHQCEKI 229
           +   P I P I ++ NI  +HLD H T  NYV  K +I      +++ ++  +    EK 
Sbjct: 172 LLGLPDIQPDIALVTNIFSNHLDYHKTRANYVAAKFRITRHQNANQYLVLNADGQDTEKF 231

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETK---KHNIQNLV 286
             +        SR             +  S    + T E++   +++ K    HN +N++
Sbjct: 232 KNETEAQVLEFSRTKQH-------FPVAFSNGNLTLTDEIVMP-TKDIKLVGPHNQENIL 283

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
            +  V    G+    I+  L +  G+ HRLQ +   G V + NDSKAT++ +   A  + 
Sbjct: 284 AAVTVANLAGVSKPAIREVLKTFSGVAHRLQYLFTAGDVKYYNDSKATDIEATQTALDSF 343

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
                WI GGL + DD   L P +  +     +G +              TL++   +A 
Sbjct: 344 DCPTIWIGGGLERGDDLERLLPNLKNVKAVIAVGETQQKIV---------TLAR---EAG 391

Query: 407 KSV--VRDVEN-----VQLPS---IVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           K V  V DVE+     VQL S   +VL SP  AS+DQY++F ERG +F++ + E
Sbjct: 392 KPVIAVTDVEHAAPVAVQLASPGDVVLLSPAQASWDQYSSFEERGDNFVASLKE 445


>gi|226328330|ref|ZP_03803848.1| hypothetical protein PROPEN_02224 [Proteus penneri ATCC 35198]
 gi|225203063|gb|EEG85417.1| hypothetical protein PROPEN_02224 [Proteus penneri ATCC 35198]
          Length = 436

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 140/462 (30%), Positives = 223/462 (48%), Gaps = 40/462 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAV-KQAKDMGIEVIDFRE 59
           +++++   + V GLG +GLS        GV   VI     P  + K   D+      F +
Sbjct: 1   MANYQGKKVVVVGLGITGLSCVDFFIRQGVTPKVIDTRQKPGGLDKLPADVEYHTGSFHQ 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
              +    ++ SPGIAL+       V+ AN   VEI+GDIELF RE +     +P +A+T
Sbjct: 61  AWLNDADLIISSPGIALS---TPALVEAANH-GVEIVGDIELFCREAK-----APIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  +   +G  V +GGNIG+P L L    P+  YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMASADGIRVGVGGNIGVPALTL-LTEPHDLYVLELSSFQLETTYSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LNIS DH++R+   LE Y   K +I   +K  +   +D      A  +   G 
Sbjct: 171 KAAAATVLNISEDHMNRYPLGLEQYREAKLRIYDNAKACVYNEDD------ALTLPLAGK 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLK 298
               +S    Q D  L      LK      +       + +HN  N + +  +   +G+ 
Sbjct: 225 DNRCVSFGVGQGDYQLDNINRILKVKGEKVLSTAEMYLSGQHNYTNALAALALADAVGIS 284

Query: 299 VEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGG 356
            +     L +  GL HR Q +    +V +INDSKATN+ S   A   L  +  ++ + GG
Sbjct: 285 RKATIEVLKTYHGLAHRFQLVYSHQNVRWINDSKATNVGSTEAALRGLEVEGTLHLLLGG 344

Query: 357 LSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALKSV 409
             KS DF++L P+IS        G++  L+ F   G  +       S L+ T+++A++++
Sbjct: 345 DGKSADFTSLLPYIS--------GDNIRLYCFGQDGQALANLRPDVSLLTVTMEEAMRAL 396

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
              V++     +VL SP CAS DQ+  F +RG  F     E+
Sbjct: 397 APTVKS---GDMVLLSPACASLDQFKCFEQRGDEFARLAREL 435


>gi|325980953|ref|YP_004293355.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Nitrosomonas sp.
           AL212]
 gi|325530472|gb|ADZ25193.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Nitrosomonas sp.
           AL212]
          Length = 471

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 235/472 (49%), Gaps = 39/472 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD--DHPCAVKQAKDMGIEVIDFR-EIP 61
           + +  ++ V G+G +GLS    L   G  V   D    P A K+  +   EV  +R +  
Sbjct: 2   NLQGKAVLVLGMGETGLSMVKWLLRQGAKVRVADSRQEPPAWKEIVEKYSEVQVYRGKFE 61

Query: 62  WSI---ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP-FIA 117
             I   I  + +SPG+ +    A   V+ A +  + +IGD+ LF      + LQ P  +A
Sbjct: 62  AQILDGIEMIAISPGVPV----ADPFVQQAIRLGIPVIGDLVLFSWALEQNKLQKPKVLA 117

Query: 118 VTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILN--LEYFSPNRF---YVIECSSYQ 172
           +TG+NGK++  +++  +LRK+G+DV + GNIG  ILN  +E      +   +V+E SS+Q
Sbjct: 118 ITGSNGKTTVTSMVGAMLRKSGWDVAVAGNIGPAILNVLMEQVDAGNWPQAWVLETSSFQ 177

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICI-----NDHQCE 227
           +E T  ++  +  +LN+S DHLDR+  +++Y+  K KI  + ++  +C      ND    
Sbjct: 178 LETTHNLNADVATVLNVSEDHLDRYTCMQDYIAAKLKIF-LRENGSVCTQILNRNDSGIS 236

Query: 228 KIAY----DMNFIGHSISRISSQ-SLQSDSD-LYIDESFLKCSATSEVIFDFSQETKKHN 281
           ++A      + F G  I    +   +Q D D L++ E   +   TSE++ +       HN
Sbjct: 237 EMALADGKQITF-GWDIPPTDADFGIQRDGDDLWLMEGPHRLMKTSELVVN-----GLHN 290

Query: 282 IQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIH 341
             N + +  +C  L + +  +  AL    GL HR++ +A    V F +DSK+TN+ + I 
Sbjct: 291 AVNALAALAMCRALDIPMNPLVSALREFRGLPHRMEKVAAFNGVTFFDDSKSTNVGATIA 350

Query: 342 AFLNEKRRIYWIAGGLSKSDDFSTLFPFISKIAKA-YFIGNSAMLFFHHFGG-KINSTLS 399
           A    K+ +  IAGG  K  DFS L   +++  +A   IG  A +         +    +
Sbjct: 351 ALNGMKQNVILIAGGDGKGQDFSHLRQTVAENTRAVVLIGRDAGIIADELKDCGVPVHFA 410

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            T+++A++   +     Q   +VL SP CASFD + N+  R   F++ V +I
Sbjct: 411 TTMEEAMQ---KSFLLAQAGDVVLLSPACASFDMFRNYIHRAEVFVAAVKDI 459


>gi|296101251|ref|YP_003611397.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295055710|gb|ADF60448.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 438

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 138/464 (29%), Positives = 218/464 (46%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ ++   + + GLG +GLS        GV     D     P   K  + +   +    +
Sbjct: 1   MADYQGKKVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVSPPGLDKLPEQVERHLGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPG+AL    AH  +  A    VEI+GDIELF RE      Q+P IA+T
Sbjct: 61  DWLQAADLIVASPGMAL----AHPSLSAAADAGVEIVGDIELFCREA-----QAPVIAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L        YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGKNVGVGGNIGLPALML-LDKGCELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
             +   +LN++ DH+DR+   L+ Y   K +I   +K  ++  +D      A  M   G 
Sbjct: 171 HAAAATILNVTEDHMDRYPFGLQQYRAAKLRIYENAKVCVVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDL--YIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLG 296
               IS      D  L   + E++L+      +     + + +HN  N + +  +   +G
Sbjct: 225 DDRCISFGITMGDYHLNRQLGETWLRVKGEKVLNVKEMKLSGQHNYTNALAALALADAVG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      +AL +  GL HR Q       V +INDSKATN+ S   A   L  +  ++ + 
Sbjct: 285 LPRSSSLQALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLQVEGTLHLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL-------SKTLDQALK 407
           GG  KS DF++L        K Y  G++  L+     G+  + L       ++T++QA++
Sbjct: 345 GGDGKSADFTSL--------KQYLSGDNIRLYCFGRDGRELAELRPEIAEQTETMEQAMR 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      V+   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 LI---APRVKPGDMVLLSPACASLDQFKNFEQRGDLFTRLAKEL 437


>gi|167614196|gb|ABZ89700.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Buchnera
           aphidicola]
          Length = 441

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 149/460 (32%), Positives = 230/460 (50%), Gaps = 30/460 (6%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGV--HVIAWDDHPCAVKQ-AKDMGIEVIDF 57
           MK + F    I + G+G +G+S        GV   +I    +P  +K+  K++   + + 
Sbjct: 1   MKYNYF-GKKILILGIGLTGISCIHFFLKKGVIPKIIDESKNPVFLKKIPKNIPFFLGNL 59

Query: 58  REIPWSI-ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
               W +    +V+SPGI+    +    +  A    +EII DIELF RE  F     P I
Sbjct: 60  NN-KWILEADIIVISPGIS----SFKPILIHARSLGIEIISDIELFSREAIF-----PII 109

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           ++TGTNGKS+   ++  + +K+GY V LGGNIG+PILN+     + FY++E SS+Q+E T
Sbjct: 110 SITGTNGKSTVATMVEKIAKKSGYKVCLGGNIGVPILNMLNQKVD-FYILELSSFQLENT 168

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI 236
            T+   I V+LNIS DH++R+   E +   KK  +++ + A ICI + + +   +D+   
Sbjct: 169 FTLKSKIAVVLNISEDHINRYP--EGFKQYKKIKLSLYQRAEICIVNVKNK--LHDVIQT 224

Query: 237 GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQ 294
             S   I+  +  SD  ++ +   +  S  ++ I D SQ      HN QN + +  +   
Sbjct: 225 NKSKKYITFGTQNSDYQVHYNHKNVILSRKNKKILDISQTLLWGAHNHQNALVALAISDS 284

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYW 352
           +      I   L     L HRLQ I R   + +INDSK+TN++S   A   LN    I  
Sbjct: 285 IKCPRHCIITTLQKFSSLPHRLQIIHRKKGIDWINDSKSTNVNSTKVALNSLNTSGTIRL 344

Query: 353 IAGGLSKSDDFSTLFPFISKIA-KAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVR 411
           + GG SKS +F+ L     K   K Y  G            K  S    TL QA+K +++
Sbjct: 345 LLGGDSKSANFNILKDDFEKFKIKIYCFGKDGKNISQICKKK--SIYFDTLQQAMKLIIK 402

Query: 412 DVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +  +      VL SPGC+S DQ+++F ERG  FM    +I
Sbjct: 403 EAIS---GDTVLLSPGCSSLDQFSSFEERGNIFMKITKDI 439


>gi|153214090|ref|ZP_01949224.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           1587]
 gi|153826875|ref|ZP_01979542.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           MZO-2]
 gi|124115516|gb|EAY34336.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           1587]
 gi|149739291|gb|EDM53547.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           MZO-2]
          Length = 440

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 138/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 10  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTRETPPGQEQLSSD 53

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W+I        +V +PGIAL        +       + ++GDIELF       
Sbjct: 54  VALHRGGWNIEWLLNADLVVTNPGIALATPEIQQVLAAG----IPVVGDIELFAWH---- 105

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 106 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPSLDL--ISPDVELYVLEL 162

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 163 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 222

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 223 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 274

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 275 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 334

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 335 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 385

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 386 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 432


>gi|152968673|ref|YP_001333782.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|330012009|ref|ZP_08307226.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Klebsiella sp.
           MS 92-3]
 gi|150953522|gb|ABR75552.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|328533998|gb|EGF60650.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Klebsiella sp.
           MS 92-3]
          Length = 438

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 141/464 (30%), Positives = 213/464 (45%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ ++   + + GLG +GLS        GV     D     P   K  + +   V    +
Sbjct: 1   MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPPGLDKLPESVECHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P IA+T
Sbjct: 61  TWLLAADLIVASPGIAL----AHPSLSAAADAGVEIVGDIELFCREA-----QAPIIAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDTDRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
                 +LN++ DH+DR+   L+ Y   K +I   +K  ++  +D      A  M   G 
Sbjct: 171 QAVAATILNVTEDHMDRYPLGLQQYRAAKLRIYENAKTCVVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCMQLG 296
               IS      D  L   +         E + +  +   T +HN  N + +  +    G
Sbjct: 225 DERCISFGVDVGDYHLNRQQGETWLRVKGEKVLNVKEMPLTGQHNYSNALAALALADAAG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      +AL +  GL HR Q +     V +INDSKATN+ S   A   L     +Y + 
Sbjct: 285 LPRASSLKALTTFTGLAHRFQLVLDHNGVRWINDSKATNVGSTEAALNGLQLDGTLYLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALK 407
           GG  KS DF+ L        K Y  G+   L+ F   G ++       +  ++T++QA++
Sbjct: 345 GGDGKSADFTPL--------KRYLGGDRIRLYCFGRDGAELAELRPEVAVQTETMEQAMR 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      V+   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QI---APLVKAGDMVLLSPACASLDQFKNFEQRGEMFARLAKEL 437


>gi|153803325|ref|ZP_01957911.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           MZO-3]
 gi|254226621|ref|ZP_04920201.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           V51]
 gi|254291799|ref|ZP_04962584.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           AM-19226]
 gi|124121143|gb|EAY39886.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           MZO-3]
 gi|125620840|gb|EAZ49194.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           V51]
 gi|150422311|gb|EDN14273.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           AM-19226]
 gi|327484899|gb|AEA79306.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           LMA3894-4]
          Length = 440

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 10  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTRETPPGQEQLSSD 53

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 54  VALHRGGWNLEWLLNADLVVTNPGIALATPEIQQVLAA----GIPVVGDIELFAWH---- 105

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 106 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 162

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 163 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 222

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 223 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 274

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 275 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 334

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 335 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 385

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 386 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 432


>gi|297581030|ref|ZP_06942955.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Vibrio cholerae
           RC385]
 gi|297534856|gb|EFH73692.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Vibrio cholerae
           RC385]
          Length = 444

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 14  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTRETPPGQEQLSSD 57

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 58  VALHRGGWNLEWLLNADLVVTNPGIALATPEIQQVLAA----GIPVVGDIELFAWH---- 109

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 110 -VDTPVIAITGSNGKSTVTDLSGMLANAAGVKAAVGGNIGVPALDL--ISPDVDLYVLEL 166

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 167 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 226

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 227 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 278

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 279 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 338

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 339 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 389

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 390 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 436


>gi|34499800|ref|NP_904015.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
           [Chromobacterium violaceum ATCC 12472]
 gi|62900566|sp|Q7NPZ7|MURD_CHRVO RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|34105650|gb|AAQ62004.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Chromobacterium
           violaceum ATCC 12472]
          Length = 453

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 140/468 (29%), Positives = 224/468 (47%), Gaps = 44/468 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDM----GIEVI--DFRE 59
           + N  + V GLG SGL+AA  L   G  V   D +P A + A+      G+EV+   F +
Sbjct: 3   YANRHVTVVGLGGSGLAAARYLAAHGARVRVADANPSAERLAELERCLPGVEVMVGAFDD 62

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
             ++    LV+SPG+ L    A+  +    +   E++GDIE+  R        S  IA+T
Sbjct: 63  ATFAGAELLVVSPGVPL----ANPAIAAFRRAGGEVVGDIEILARA--IQGDGSKVIAIT 116

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL---EYFSPNR--FYVIECSSYQIE 174
           G+NGKS+  +L+ H+    G D  + GNIGL +L        S  R   +V+E SS+Q+E
Sbjct: 117 GSNGKSTVTSLVGHLCEAAGLDTVVAGNIGLAVLEALLAREQSGKRPDVWVLELSSFQLE 176

Query: 175 LTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMN 234
            T ++      +LNIS DHLDR+  L +Y + K ++       ++  +D     +   M 
Sbjct: 177 STFSLAADAATVLNISEDHLDRYADLLDYAHAKTRVFNGKGVQVLNKDD----ALVRAMV 232

Query: 235 FIGHSISRISSQSLQSDSDLYIDES---FLKCSATSEVIFDFS--QETKKHNIQNLVTSA 289
             GH +   S   L   +D  +  +   +LK     E +FD +  Q    HN  N + + 
Sbjct: 233 RPGHPVKWFS---LNGAADYALARNGGYWLKVD--GEKVFDCADMQLQGLHNAANALAAL 287

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRR 349
            +C  +GL +E++   L +  GL HR++ +     + FI+DSK TN+ +   A     R+
Sbjct: 288 GLCQGIGLPLEKLLDGLKTFRGLAHRVELVDEFDGIAFIDDSKGTNVGATEAALNGMTRQ 347

Query: 350 IYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKT---LDQ-- 404
           +  IAGG  K  DF+ L P   +IA+       A+L      G+I + L  +   L++  
Sbjct: 348 VVLIAGGDGKGQDFAPLKPACQRIAR-------AVLLIGRDAGRIEAALEDSGLALERCD 400

Query: 405 ALKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            L+   R    +  P  +VL SP CAS D + N+  R   F+  V+ +
Sbjct: 401 TLEEATRRAAALARPGDVVLLSPACASLDMFKNYAHRAQVFIDTVAAV 448


>gi|238754433|ref|ZP_04615788.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Yersinia ruckeri
           ATCC 29473]
 gi|238707262|gb|EEP99624.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Yersinia ruckeri
           ATCC 29473]
          Length = 438

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 136/460 (29%), Positives = 215/460 (46%), Gaps = 40/460 (8%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD---DHPCAVKQAKDMGIEVIDFREIPW 62
           ++   + + GLG +GLS        GV     D   + P   K    +   + D  +   
Sbjct: 4   YQGKQVVIIGLGLTGLSCVDFFMTRGVTPRVMDTRINPPGLDKLPTSLERHLGDLNQQWL 63

Query: 63  SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTN 122
                +V SPG+AL    AH  +  A    VEI+GDIELF RE      Q+P IA+TG+N
Sbjct: 64  LDADLIVASPGMAL----AHPALSAAADAGVEIVGDIELFCREN-----QAPIIAITGSN 114

Query: 123 GKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPS 182
           GKS+   L+  + +  G+ V +GGNIG+P L L     N+  V+E SS+Q+E T ++  +
Sbjct: 115 GKSTVTMLVGEMAKAAGWQVGVGGNIGVPALTL-LKQENQLVVLELSSFQLETTSSLQAT 173

Query: 183 IGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKI-AYDMNFIGHSI 240
              +LN++ DH DR+   L+ Y   K +I   +K  ++  +D     +   D   I   +
Sbjct: 174 AATILNVTEDHTDRYPFGLQQYRAAKLRIYDNAKICVVNADDALTMPVRGADSRCISFGV 233

Query: 241 SRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVE 300
                   +   ++++  S  K   T E+       T +HN  N + +  +    G+   
Sbjct: 234 DVGDYHLNKQQGEIWLRVSGEKVLNTREMKL-----TGRHNYTNALAALALADAAGIPRS 288

Query: 301 EIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLS 358
              +AL +  GL HR Q +     V +INDSKATN+ S   A   L+    ++ + GG  
Sbjct: 289 SSLKALTTYAGLAHRFQLVFENHGVRWINDSKATNVGSTEAALDGLHIDGTLHLLLGGDG 348

Query: 359 KSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALKSVVR 411
           KS DFS L  F+         G+   ++ F   G ++       S L+ T++QA+K +  
Sbjct: 349 KSADFSGLTRFLQ--------GDKVQVYCFGRDGEQLAQLRPEVSQLTDTMEQAVKLL-- 398

Query: 412 DVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
               ++   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 399 -APTLKAGDMVLLSPACASLDQFRNFEQRGTEFARLAEEL 437


>gi|269798175|ref|YP_003312075.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Veillonella parvula
           DSM 2008]
 gi|269094804|gb|ACZ24795.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Veillonella parvula
           DSM 2008]
          Length = 456

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 226/461 (49%), Gaps = 42/461 (9%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKD-----MGIEVIDFR-- 58
           + +  I V G G SG+ A+  L   G HV+  D  P  +  A++      G+ +I  R  
Sbjct: 3   YGDKHILVLGAGASGIGASWVLAQVGAHVVLNDYKPMTLPTAEEKRLVAAGVNIITGRQD 62

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAV 118
           E     +  +V+SPGI+L        VK A    ++++ ++EL      +   +SP +AV
Sbjct: 63  ESLLDGVDRIVISPGISLDIP----IVKAAQARGIDVVSEVEL-----AYEVSKSPIVAV 113

Query: 119 TGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSP-NRFYVIECSSYQIELTP 177
           TGTNGK++T  L++ VL  +G  V +GGNIG  +  + Y  P + F V E SSYQ+E   
Sbjct: 114 TGTNGKTTTTTLLTKVLEGSGKPVHVGGNIGDSLSEVAYSMPADGFLVAELSSYQLETIK 173

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT---MSKHAIICINDHQCEKIAYDMN 234
              P   ++LNI+PDHL RH T+ENY+  K++I      + + ++ I+D     +  DM 
Sbjct: 174 HFRPIGAIMLNITPDHLARHKTMENYIAAKERIFENQLSTDYLVLNIDD----PVVADME 229

Query: 235 FIGHS-ISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKK------HNIQNLVT 287
               S I +IS +    +   Y D    KC    + +  F    +       HNI+N++T
Sbjct: 230 HRAPSHILKISQKKAVENGAYYADG---KCYIAKDGVAKFVIADEDIHIPGSHNIENILT 286

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
              +   LG+ VE I R +    G+ HRL+ +  +  + F NDSKATN+ SV+ A  +  
Sbjct: 287 VIALSYALGVPVETIHRIISEFHGVEHRLERVKTIDGITFYNDSKATNVDSVVKALESFD 346

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAY-FIGNSAMLFFHHFGGKINSTLSKTLDQAL 406
           +++  +AGG  K          + +  KA  F+G +A      F         K + +AL
Sbjct: 347 QQVILLAGGHDKMTPLEDFMELVKEKTKAVIFMGEAA----DRFETAAKKAGVKPIYRAL 402

Query: 407 ---KSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSF 444
               +V +  +  +   IVL SP C+SFD Y+ F ERG  F
Sbjct: 403 SMKDAVEKGYKLAETGDIVLLSPACSSFDWYSCFEERGDDF 443


>gi|62178693|ref|YP_215110.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|224581969|ref|YP_002635767.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|75484866|sp|Q57TD2|MURD_SALCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|62126326|gb|AAX64029.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224466496|gb|ACN44326.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamatesynthetase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|322713146|gb|EFZ04717.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
          Length = 438

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/472 (28%), Positives = 222/472 (47%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +++ ++ + GLG +GLS        GV     D     P   K  +++   V    +
Sbjct: 1   MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q P +A+T
Sbjct: 61  EWLLAADLIVASPGIAL----AHPSLSAAASAGVEIVGDIELFCRE-----AQEPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDADRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           +++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 VSFGVNMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +GL      +AL +  GL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLS 399
              ++ + GG  KS DFS L          Y  G+   L+ F   G ++       +  +
Sbjct: 337 DGTLHLLLGGDGKSADFSPL--------TRYLTGDRIRLYCFGRDGAQLAALRPEIAQQT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T+++A++ +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEEAMRLL---APRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKEL 437


>gi|288937140|ref|YP_003441199.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Klebsiella
           variicola At-22]
 gi|290512563|ref|ZP_06551929.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Klebsiella sp.
           1_1_55]
 gi|288891849|gb|ADC60167.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Klebsiella
           variicola At-22]
 gi|289774904|gb|EFD82906.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Klebsiella sp.
           1_1_55]
          Length = 438

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 141/464 (30%), Positives = 213/464 (45%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ ++   + + GLG +GLS        GV     D     P   K  + +   V    +
Sbjct: 1   MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPPGLDKLPESVECHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P IA+T
Sbjct: 61  TWLLAADLIVASPGIAL----AHPSLSAAADAGVEIVGDIELFCREA-----QAPIIAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDTDRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
                 +LN++ DH+DR+   L+ Y   K +I   +K  ++  +D      A  M   G 
Sbjct: 171 QAVAATILNVTEDHMDRYPLGLQQYRAAKLRIYENAKTCVVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCMQLG 296
               IS      D  L   +         E + +  +   T +HN  N + +  +    G
Sbjct: 225 DDRCISFGVDVGDYHLNRQQGETWLRVKGEKVLNVKEMPLTGQHNYSNALAALALADAAG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      +AL +  GL HR Q +     V +INDSKATN+ S   A   L     +Y + 
Sbjct: 285 LPRASSLKALTTFTGLAHRFQLVLDHNGVRWINDSKATNVGSTEAALNGLQLDGTLYLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALK 407
           GG  KS DF+ L        K Y  G+   L+ F   G ++       +  ++T++QA++
Sbjct: 345 GGDGKSADFTPL--------KRYLGGDRIRLYCFGRDGAELAELRPDVAVQTETMEQAMR 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      V+   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QI---APLVKAGDMVLLSPACASLDQFKNFEQRGDMFARLAKEL 437


>gi|229521234|ref|ZP_04410654.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae TM
           11079-80]
 gi|229341766|gb|EEO06768.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae TM
           11079-80]
          Length = 467

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 37  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTREAPPGQEQLSSD 80

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 81  VVLHRSGWNLEWLLNADLVVTNPGIALATPEIQQVLAAG----IPVVGDIELFAWH---- 132

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 133 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 189

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 190 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 249

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 250 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 302 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 361

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 362 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 412

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 413 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 459


>gi|24379029|ref|NP_720984.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Streptococcus
           mutans UA159]
 gi|30316024|sp|Q8DVE3|MURD_STRMU RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|24376923|gb|AAN58290.1|AE014899_9 putative D-glutamic acid adding enzyme MurD;
           UDP-N-acetylmuramoylalanine--D-glutamate ligase
           [Streptococcus mutans UA159]
          Length = 451

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/466 (29%), Positives = 227/466 (48%), Gaps = 34/466 (7%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVI-----AWDDHPCAVKQAKDMGIEVI-- 55
           + +F N  + V GL RSG +AA  L   G  V       +D++P A +   + GI+VI  
Sbjct: 4   VKNFENKKVLVLGLARSGEAAARLLAKLGAIVTVNDGKPFDENPSA-QALLEEGIKVICG 62

Query: 56  -DFREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSP 114
               E+     +++V +PGI  T    +  V  A + N+ +I ++EL      +   ++P
Sbjct: 63  SHPLELLDEAFAYMVKNPGIPYT----NPMVVRALEKNIPVITEVEL-----AYLISEAP 113

Query: 115 FIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQI 173
            I +TG+NGK++T  +I+ VL   G   +L GNIG P   + +  +     V+E SS+Q+
Sbjct: 114 IIGITGSNGKTTTTTMIADVLNHAGQSARLSGNIGFPASEVAQPVTEKDILVMELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV-TMSKHAIICINDHQCEKIAYD 232
             T +  P + V+ N+ P H+D H + ENY+  K  I   M+K   + +N +Q   +A D
Sbjct: 174 MGTESFHPHMAVITNLMPTHIDYHGSFENYIEAKWNIQKNMTKEDFLVLNFNQ--DLAKD 231

Query: 233 MNFIGHSISRISSQSLQSDSD-LYIDESFLKCSATSEVIFDFSQ--ETKKHNIQNLVTSA 289
           +     + ++I   S +   D  Y+D   L C    + I   S+      HN++N + + 
Sbjct: 232 L--ANQTQAKIIPFSTKEKVDGAYLDGQML-CF-KGQAIMSASELGVPGSHNVENALATI 287

Query: 290 VVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN-EKR 348
            V    G+  E I+  L+  GG+ HRLQ++  +  V F NDSK+TN+ +   A    +  
Sbjct: 288 AVAKLSGVSNEAIRETLIHFGGVKHRLQSLGNIAGVKFYNDSKSTNILATQKALSGFDNS 347

Query: 349 RIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFH-HFGGKINSTLSKTLDQALK 407
           ++  IAGGL + ++F  L P I  + K   +G SA    H      +    +K + QA +
Sbjct: 348 KVILIAGGLDRGNEFDELVPDIKGLKKMIILGESAPRLKHAAVQAGVTYLNAKDVAQATR 407

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
              ++        +VL SP  AS+D Y NF  RG  F++    + G
Sbjct: 408 IAFQEASP---GDVVLLSPANASWDMYKNFEVRGDEFITTFKSLKG 450


>gi|15607039|ref|NP_214421.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Aquifex aeolicus
           VF5]
 gi|30315978|sp|O67852|MURD_AQUAE RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|2984290|gb|AAC07814.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Aquifex aeolicus
           VF5]
          Length = 415

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 139/444 (31%), Positives = 218/444 (49%), Gaps = 46/444 (10%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIPWSIISFLVLSP 72
           V+GLGRSG  A   LK+ G  V A DD      Q  ++  EV+         +  +VLSP
Sbjct: 5   VWGLGRSGKGALKLLKERGFEVYAGDDS-----QNPELWREVL-------GEVDTVVLSP 52

Query: 73  GIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSSTVALIS 132
           GI      +H   K A +   E++G++EL  R       +   IA+TGT+GKS+T  L  
Sbjct: 53  GIP----PSHPLWKEALKKEKEVVGELELAYR-----FFKGKVIAITGTDGKSTTTRLTY 103

Query: 133 HVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVLLNISPD 192
            +L+K   +V   GNIG P   +   +P    V+E SS+Q +   T  P+IG  ++ S D
Sbjct: 104 LILKKFFDEVFEAGNIGKPFSEVVLENPEGIAVLEVSSFQGKTLKTFRPNIGAFISFSVD 163

Query: 193 HLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRISSQSLQS-D 251
           HLD H ++E+Y+  K +I            ++Q E+    +N + + I +  S++ +   
Sbjct: 164 HLDWHPSIEDYLKSKYRIF-----------ENQTEEDFLILNDLVYEIKKTPSRARKVLF 212

Query: 252 SDLYIDESFLKCSATSEVIFDFSQETKK----HNIQNLVTSAVVCMQLGLKVEEIKRALL 307
           S+LYI+      S   + I  F+ +  K    HN+ N   ++++ + LGLK E+ +  + 
Sbjct: 213 SELYINSD----SVFYKDIRLFNPKNLKIRGLHNVYNASVASLIALTLGLKPEDFEEVIY 268

Query: 308 SCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLN-EKRRIYWIAGGLSKSDDFSTL 366
              GL HRL+ +     V   NDSK+T  H+++HA        +  I GG  K  DF +L
Sbjct: 269 EFRGLPHRLEFLGNFNGVEVYNDSKSTTPHALMHALKTFPDNSVILIVGGKDKGADFYSL 328

Query: 367 FPFISKIAK-AYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDVENVQLPSIVLFS 425
              + K  K A  IG +       +          TL++A+K + R+V   +L ++VLFS
Sbjct: 329 RHIVQKKVKIALAIGETKEKIKDSWKDITEVKTCNTLEEAVK-LAREVS--KLGNVVLFS 385

Query: 426 PGCASFDQYNNFRERGFSFMSQVS 449
           P C+SFD + N+ ERG  F   V 
Sbjct: 386 PACSSFDMFRNYEERGEKFKELVE 409


>gi|254230420|ref|ZP_04923800.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio sp. Ex25]
 gi|262395261|ref|YP_003287115.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio sp. Ex25]
 gi|151937053|gb|EDN55931.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio sp. Ex25]
 gi|262338855|gb|ACY52650.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio sp. Ex25]
          Length = 437

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 130/449 (28%), Positives = 212/449 (47%), Gaps = 36/449 (8%)

Query: 9   HSIAVFGLGRSGLSAACALKDSGVHVI-----AWDDHPCAVKQAKDMGIEVIDFREIPWS 63
           HS+ V GLG +GLS    L+ +   ++        + P A +  +D+ +    +     S
Sbjct: 8   HSVVVVGLGITGLSVVKHLRKNQPQLVVKVIDTRVNPPGAERLPEDVQLHSGGWNTDWLS 67

Query: 64  IISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNG 123
               +V +PGIAL        ++        ++GDIELF       ++Q P IA+TG+NG
Sbjct: 68  DADLIVTNPGIALATPE----IQAVLAKGTTVVGDIELFAW-----AVQKPVIAITGSNG 118

Query: 124 KSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSI 183
           KS+   L   +++  G DV +GGNIG+P L+L     +  YV+E SS+Q+E T ++    
Sbjct: 119 KSTVTDLTGVMVKAAGLDVGVGGNIGVPALDLLEQDAD-LYVLELSSFQLETTSSLKLKA 177

Query: 184 GVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGHSISRI 243
              LN+S DH+DR+  + +Y   K +I   +  A++  +D +         F    +  +
Sbjct: 178 AAFLNLSEDHMDRYQGMSDYRQAKLRIFDHAALAVVNRDDQET--------FPDAEMPLV 229

Query: 244 SSQSLQSDSDLYID--ESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQLGLKVEE 301
           +  S   D  L +D   ++L       V  D  +   KHN+ N +    +    G+    
Sbjct: 230 TFGSDNQDFGLEVDGNRTWLLDHGQRVVASDELKLVGKHNLSNALVVLALLKAAGVDYHN 289

Query: 302 IKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIAGGLSK 359
              AL +  GLTHR Q +A    V ++NDSKATN+ S + A   L    ++Y + GG+ K
Sbjct: 290 ALNALKNYTGLTHRCQVVADNQGVKWVNDSKATNIASTMAALSGLESTGKLYLLVGGVGK 349

Query: 360 SDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLD-QALKSVVRDVENVQL 418
             DFS L P  + +       N  +  F   G          +    ++ V++ V +   
Sbjct: 350 GADFSPLKPIFATL-------NLQLCCFGADGDDFMPLHESAIRFDTMEDVIQQVSSQLK 402

Query: 419 PS-IVLFSPGCASFDQYNNFRERGFSFMS 446
           P  +V+ SP CASFDQ++NF  RG +F +
Sbjct: 403 PGDMVMLSPACASFDQFDNFMARGDAFAA 431


>gi|161581989|ref|NP_232033.2| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           cholerae O1 biovar El Tor str. N16961]
 gi|254849525|ref|ZP_05238875.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Vibrio cholerae
           MO10]
 gi|298500237|ref|ZP_07010042.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Vibrio cholerae MAK
           757]
 gi|254845230|gb|EET23644.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Vibrio cholerae
           MO10]
 gi|297540930|gb|EFH76984.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Vibrio cholerae MAK
           757]
          Length = 444

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 14  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTREAPPGQEQLSSD 57

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 58  VALHRSGWNLEWLLNADLVVTNPGIALATPEIQQVLAA----GIPVVGDIELFAWH---- 109

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 110 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 166

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 167 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 226

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 227 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 278

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 279 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 338

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 339 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 389

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 390 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 436


>gi|238893068|ref|YP_002917802.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238545384|dbj|BAH61735.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 438

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 141/464 (30%), Positives = 213/464 (45%), Gaps = 42/464 (9%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ ++   + + GLG +GLS        GV     D     P   K  + +   V    +
Sbjct: 1   MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPPGLDKLPESVECHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P IA+T
Sbjct: 61  TWLLAADLIVASPGIAL----AHPSLSAAADAGVEIVGDIELFCREA-----QAPIIAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDTDRELYVLELSSFQLETTFSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIGH 238
                 +LN++ DH+DR+   L+ Y   K +I   +K  ++  +D      A  M   G 
Sbjct: 171 QAVAATILNVTEDHMDRYPLGLQQYRAAKLRIYENAKTCVVNADD------ALTMPVRGA 224

Query: 239 SISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE--TKKHNIQNLVTSAVVCMQLG 296
               IS      D  L   +         E + +  +   T +HN  N + +  +    G
Sbjct: 225 DERCISFGVDVGDYHLNRQQGETWLRVKGEKVLNVKEMPLTGQHNYSNALAALALADAAG 284

Query: 297 LKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYWIA 354
           L      +AL +  GL HR Q +     V +INDSKATN+ S   A   L     +Y + 
Sbjct: 285 LPRASSLKALTTFTGLAHRFQLVQEHNGVRWINDSKATNVGSTEAALNGLQLDGTLYLLL 344

Query: 355 GGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQALK 407
           GG  KS DF+ L        K Y  G+   L+ F   G ++       +  ++T++QA++
Sbjct: 345 GGDGKSADFTPL--------KRYLGGDRIRLYCFGRDGAELAELRPEVAVQTETMEQAMR 396

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
            +      V+   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 397 QI---APLVKAGDMVLLSPACASLDQFKNFEQRGEMFARLAKEL 437


>gi|261401755|ref|ZP_05987880.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Neisseria
           lactamica ATCC 23970]
 gi|269208133|gb|EEZ74588.1| UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase [Neisseria
           lactamica ATCC 23970]
          Length = 445

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 222/458 (48%), Gaps = 35/458 (7%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVIDF----R 58
           +F+N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++ +    +
Sbjct: 2   TFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALSNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKDKIFRGDGVQVLNADDVFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQE---TKKHNIQNLVTSAV 290
              G  +   S   L+ ++D +++    +     E +   +Q+      HN  N++ +  
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGDEDLI-ATQDIPLQGLHNAANVMAAVA 285

Query: 291 VCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEKRRI 350
           +C  +GL   E+   + +  GL HR++ I     V+FI+DSK TN+ + + A    +  +
Sbjct: 286 LCEAVGLPRNELLEHVKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATVAAIAGLQNPL 345

Query: 351 YWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQALKS 408
           + I GG+ K  DF+ L   +   AK  F IG  A        G  +N T   TL++A+++
Sbjct: 346 FVILGGMGKGQDFTPLRDALKDKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEAVQT 405

Query: 409 VVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
                E      IVL SP CASFD +  +  R   F+ 
Sbjct: 406 AYARAE---AGDIVLLSPACASFDMFKGYAHRSEVFIE 440


>gi|288939892|ref|YP_003442132.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Allochromatium
           vinosum DSM 180]
 gi|288895264|gb|ADC61100.1| UDP-N-acetylmuramoylalanine/D-glutamate ligase [Allochromatium
           vinosum DSM 180]
          Length = 458

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 133/460 (28%), Positives = 216/460 (46%), Gaps = 40/460 (8%)

Query: 13  VFGLGRSGLSAACALKDSGVHVIAWD--DHPCAV----KQAKDMGIEVIDFREIPWSIIS 66
           + GLG++GLS A  L   GV V   D  + P  +     +  ++ + V  F    ++  +
Sbjct: 20  IVGLGKTGLSCARHLSARGVRVAVTDSRERPPGLDVLQSELPEVAVFVGGFDPDVFAAAT 79

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            LV+SPG+ L    A   ++ A    V  +GDIELF RE     + +P  A+TG+NGKS+
Sbjct: 80  ELVVSPGVPL----AEPLIRQAIARGVPAVGDIELFARE-----IHAPLCAITGSNGKST 130

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIECSSYQIELTPTIDPSIGV 185
              L+  + R  G  V +GGN+G P+L+L   +P+   YV+E SS+Q+E  P++     V
Sbjct: 131 VTTLVGLMARLAGQRVAVGGNLGEPVLDL--LAPDVERYVVELSSFQLETVPSLRADAAV 188

Query: 186 LLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNF-IGHSISRIS 244
           +LN+S DHLDR+  L++Y   K +I   ++ A++  +D     +  D    IG ++    
Sbjct: 189 VLNVSADHLDRYAGLDDYARTKARIYQGARIAVVNRDDPIVAAMPRDPEREIGFTL---- 244

Query: 245 SQSLQSDSDLYI----DESFLKCSATSEVIFDFS-QETKKHNIQNLVTSAVVCMQLGLKV 299
              +   SD  +     +S++ C     ++   + +   +HN+ N + +  +     + +
Sbjct: 245 --GVPEGSDFGVRVLEGQSWI-CQGEEPILPTAAIRLPGRHNLANALAALALAQASAIPM 301

Query: 300 EEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF-----LNEKRRIYWIA 354
                AL    GL HR + +A      + +DSK TN  + I A       +   R+  IA
Sbjct: 302 AGACEALRVFPGLPHRSEFVAERAGARWYDDSKGTNPGATIAALEGLIPEDGSGRVVLIA 361

Query: 355 GGLSKSDDFSTL-FPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALKSVVRDV 413
           GG  K  DF+ L             IG  A L      G +    +  +D A   V    
Sbjct: 362 GGEGKGADFAPLRAAVERAARAVVLIGRDAPLIASALDGTVPLIRATDMDAA---VALAA 418

Query: 414 ENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           E+++    VL SP CASFD ++N+  RG  F   V  +PG
Sbjct: 419 EHIEPGDCVLLSPACASFDMFDNYEHRGRVFAEAVRRLPG 458


>gi|319401523|gb|EFV89733.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Staphylococcus
           epidermidis FRI909]
          Length = 449

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 132/464 (28%), Positives = 230/464 (49%), Gaps = 41/464 (8%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDHPCA----VKQAKDMGIEVID 56
           +  +   N ++ V GL +SG  AA  L   G +V   D +  +     K  + MGIEVI 
Sbjct: 2   LNYTELENKNVLVVGLAKSGYEAAKLLLKLGANVKVNDGNDLSQDAHAKDLESMGIEVIS 61

Query: 57  FREIPWSIIS---FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQS 113
               P+S++     +V +PGI  T       ++ A +  ++I+ ++EL      +   ++
Sbjct: 62  GSH-PFSLLDDDPIIVKNPGIPYTVS----IIEEAAKRGLKILTEVEL-----SYLISEA 111

Query: 114 PFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQ 172
           P IAVTGTNGK++  +LI  + +K+    +L GNIG    N+ +    + + + E SS+Q
Sbjct: 112 PIIAVTGTNGKTTVTSLIGDMFQKSVLTGRLSGNIGYVASNVAQEVKSDEYLITELSSFQ 171

Query: 173 IELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV-TMSKHAIICINDHQCEKIAY 231
           +       P I ++ NI   HLD H TLENY N KK+I    +K   +  N HQ   I  
Sbjct: 172 LLGIEKYKPHIAIITNIYSAHLDYHETLENYQNAKKQIYKNQTKDDYLICNYHQRHLIES 231

Query: 232 DMNFIGHSISRISSQSLQSDSDLYIDESFL-----KCSATSEVIFDFSQETKKHNIQNLV 286
           + N    +    + Q +     +YI + F+     +   T +++        +HN++N++
Sbjct: 232 E-NLEAKTFYFSTQQEVDG---IYIKDGFIVFNGIRIINTKDLVL-----PGEHNLENIL 282

Query: 287 TSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNE 346
            + +  +  G+ V+ I  +L++  G+ HRLQ I       + NDSKATN  +   A  + 
Sbjct: 283 AAVLASIIAGVPVKAIVDSLVTFSGIDHRLQYIGTNRTNKYYNDSKATNTLATQFALNSF 342

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQA- 405
            + I W+ GGL + ++F  L P++  +      G +   F      K+ ++  K + +A 
Sbjct: 343 DQPIIWLCGGLDRGNEFDELIPYMENVRVMVVFGETQDKF-----AKLGNSQGKYVIKAT 397

Query: 406 -LKSVVRDVENVQLPS-IVLFSPGCASFDQYNNFRERGFSFMSQ 447
            ++  V  ++++  P+ +VL SP CAS+DQY+ F ERG  F+ +
Sbjct: 398 DVEDAVDKIQDIVEPNDVVLLSPACASWDQYHTFEERGEKFIDR 441


>gi|121635446|ref|YP_975691.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Neisseria
           meningitidis FAM18]
 gi|158513150|sp|A1KVL5|MURD_NEIMF RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|120867152|emb|CAM10919.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Neisseria
           meningitidis FAM18]
          Length = 445

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 133/461 (28%), Positives = 219/461 (47%), Gaps = 41/461 (8%)

Query: 5   SFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH--PCAVKQAKDMGIEVI----DFR 58
           +  N  I V GLG +G+S    L+ +G  V A+D    P  V Q   M   ++      +
Sbjct: 2   TLENKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRLK 61

Query: 59  EIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELF--VRERRFSSLQSPFI 116
           +   +    L LSPGI+    +    ++   Q    ++GDIEL   +  RR   +    I
Sbjct: 62  DALDNGFDILALSPGISERQPD----IEAFKQNGGRVLGDIELLADIVNRRGDKV----I 113

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNR---FYVIECSSYQI 173
           A+TG+NGK++  +L+ ++  K G D  + GNIG P+L  E+    +    +V+E SS+Q+
Sbjct: 114 AITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQL 173

Query: 174 ELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDM 233
           E T ++ P+   +LNIS DHLDR+  L +Y + K KI       ++  +D  C      M
Sbjct: 174 ENTESLRPTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRA----M 229

Query: 234 NFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNL------VT 287
              G  +   S   L+ ++D +++    +    +E +      TK   +Q L      + 
Sbjct: 230 KRAGREVKWFS---LEHEADFWLERETGRLKQGNEDLI----ATKDIPLQGLHNAANVMA 282

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +  +C  +GL  E +   + +  GL HR++ I +   V+FI+DSK TN+ +   A    +
Sbjct: 283 AVALCEAVGLPREALLEHVKTFQGLPHRVEKIGKKNGVVFIDDSKGTNVGATAAAIAGLQ 342

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYF-IGNSAMLFFHHFGG-KINSTLSKTLDQA 405
             ++ I GG+ K  DF+ L   ++  AK  F IG  A        G  +N T   TL++A
Sbjct: 343 NPLFVILGGMGKGQDFTPLRDALAGKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLEEA 402

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMS 446
           +++     E      IVL SP CASFD +  +  R   F+ 
Sbjct: 403 VQTAYAQAEAC---DIVLLSPACASFDMFKGYAHRSEVFIE 440


>gi|87123641|ref|ZP_01079491.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           RS9917]
 gi|86168210|gb|EAQ69467.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Synechococcus sp.
           RS9917]
          Length = 466

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 142/471 (30%), Positives = 227/471 (48%), Gaps = 49/471 (10%)

Query: 13  VFGLGRSGLSAACALKDSG--VHVIAWDDHPCAVKQAKDM---GIEVIDFREI------P 61
           V GLGRSG+ AA  L+  G  V V+   +     ++A+D+   GIEV   R +      P
Sbjct: 6   VVGLGRSGIGAARLLRAQGKTVTVLERLEGDSQTRRARDLINQGIEVQLGRPLTLPSFAP 65

Query: 62  W-SIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTG 120
           W   +  +V+SPGI    +  H  ++   Q  V +IG++ L  +   F + ++P+I +TG
Sbjct: 66  WLDDLEAVVVSPGI----DWNHPTLEALRQQGVAVIGEMALAWQ---FLN-RTPWIGITG 117

Query: 121 TNGKSSTVALISHVLRKNGYDVQLGGNIGLPI----LNLEYFSPNR-------FYVIECS 169
           TNGK++   L+ HVL   G    + GN+G       L+L   +PN        + V+E S
Sbjct: 118 TNGKTTVTQLLQHVLSSGGLHAPMAGNVGHSATELALSLSAVAPNDGDPATPDWLVMEMS 177

Query: 170 SYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC--E 227
           SYQIE    + P IG+   ++PDHL+RH TLE Y  IK+ ++  S+  I   +D     +
Sbjct: 178 SYQIEAAAIVAPRIGIWTTLTPDHLERHGTLEAYRAIKRGLLERSQIRIFNADDSDLSRQ 237

Query: 228 KIAYDMNFIGHSISRISSQSLQSDSDLYID-ESFLKCSATSEVIFDFS--QETKKHNIQN 284
           + ++D    G  IS   +    + +DL+ D E  + C      +F  S       HN QN
Sbjct: 238 RASWDH---GLWISAAGAGDGATAADLWCDAEGVVHCRRRGP-LFPASALAMPGDHNRQN 293

Query: 285 LVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFL 344
           ++      ++ GL+ E I  AL +  G+ HRL+ +  L  +   NDSKATN  + + A  
Sbjct: 294 MLLVTAAALEAGLEPEVIAAALRTFPGVPHRLERLGELKGMQVFNDSKATNFDAAVVALR 353

Query: 345 NEKRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSA------MLFFHHFGGKINSTL 398
           +  R    +AGG +K  +       + + + A  +  S       +L    + G+I    
Sbjct: 354 SVPRPAVVLAGGQTKQGEAGEWLTLMGERSCAVVLYGSGAEELANLLSSSGYPGQIRR-- 411

Query: 399 SKTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVS 449
              LD A+  +  D+        +L SP CASFDQY++F  RG  F + ++
Sbjct: 412 CDDLDAAVP-IALDLGRQLRAGTLLLSPACASFDQYSDFEARGDHFRTLIA 461


>gi|188532900|ref|YP_001906697.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Erwinia
           tasmaniensis Et1/99]
 gi|188027942|emb|CAO95799.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Erwinia
           tasmaniensis Et1/99]
          Length = 438

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 189/405 (46%), Gaps = 57/405 (14%)

Query: 67  FLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVTGTNGKSS 126
            +V SPG+AL    AH  +  A Q  VEI+GD+ELF RE      Q+P +A+TG+NGKS+
Sbjct: 68  LIVASPGVAL----AHPSLIAAAQAGVEIVGDVELFCREA-----QAPIVAITGSNGKST 118

Query: 127 TVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTIDPSIGVL 186
              L+  + R  G+ V +GGNIGLP L L    P + YV+E SS+Q+E T ++  +   L
Sbjct: 119 VTTLVGEMARAAGWQVGVGGNIGLPALTL-LQQPAQLYVLELSSFQLETTSSLKAAAATL 177

Query: 187 LNISPDHLDRH---------HTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFIG 237
           LN++ DH+DR+           L  Y N    +V       + I       +++  +F  
Sbjct: 178 LNVTEDHMDRYPLGMQQYRAAKLRIYENATACVVNADDAMTMPIRGADARCVSFGADFGD 237

Query: 238 HSISRISSQS---LQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTSAVVCMQ 294
           + ++R    +   +Q +  L  DE  L                 +HN  N + +  +   
Sbjct: 238 YHLTRQQGSTWLRVQGEKVLNTDEMHL---------------VGQHNYTNALAALALADA 282

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNEKRRIYW 352
           +GL      +AL +  GL HR Q +     V +INDSKATN+ S   A   L+    ++ 
Sbjct: 283 VGLPRATSLKALTTFNGLPHRFQLVHEHNGVRWINDSKATNVGSTEAALNGLHPAGTLWL 342

Query: 353 IAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLF-FHHFGGKIN------STLSKTLDQA 405
           + GG  KS DF+ L          Y  G    ++ F   G ++       +  + T+ +A
Sbjct: 343 LLGGDGKSADFTPL--------TRYLQGERIRVYCFGRDGAELAALRPEIAVQTATMAEA 394

Query: 406 LKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
           ++ +   V    L   VL SP CAS DQ+ NF +RG  F     E
Sbjct: 395 VRQIAAQVRPGDL---VLLSPACASLDQFKNFEQRGDLFAQLARE 436


>gi|290890680|ref|ZP_06553750.1| hypothetical protein AWRIB429_1140 [Oenococcus oeni AWRIB429]
 gi|290479655|gb|EFD88309.1| hypothetical protein AWRIB429_1140 [Oenococcus oeni AWRIB429]
          Length = 438

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 131/466 (28%), Positives = 216/466 (46%), Gaps = 43/466 (9%)

Query: 1   MKLSSFRNHSIAVFGLGRSGLSAACALKDSGVHV-IAWDDHPCAVKQAKDMGIEVIDFRE 59
           M   +++N  + V+G  RSG +    LK  G +V +  D+ P  +        + ++F +
Sbjct: 1   MDQMNYQNKKVLVYGWARSGKAVYQLLKKIGANVYVTADEEPTDL-------FDDVNFVD 53

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   LV +PGI    E     +K A   N+ +I ++++ + +      +   +AVT
Sbjct: 54  DIDESFDLLVKNPGIRYEKE----IIKKALNLNIPVITEVQVALDQ-----FKGEVLAVT 104

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPI--LNLEYFSPNRFYVIECSSYQIELTP 177
           G+NGK++T  LI  +L+ +  DV++GGNIG+P+  L L    P R  ++E SS+Q+    
Sbjct: 105 GSNGKTTTTTLIGKMLKADNVDVKVGGNIGIPVSELMLSDSQP-RVLMLELSSFQLLGAQ 163

Query: 178 TIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVT-MSKHAIICINDHQCEKI------- 229
            I P I V+ N+   H+D HHT ENY+  K  I    +K   + +ND   +         
Sbjct: 164 NIKPKIAVITNLFSSHIDFHHTRENYLRAKFSITQHQTKDDYLVLNDSSIDSKDFAKRSQ 223

Query: 230 AYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVT 287
           A D  F   S +  S  +  +D  +Y D+         E I D S+     +HN++N++ 
Sbjct: 224 ADDYYF---SPTNTSVNTYVNDGTIYFDD---------EKIIDLSKVVLVGEHNLENILA 271

Query: 288 SAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAFLNEK 347
           +       G+    I++ L S  GL HRL+ +  +      NDSKAT++ +   A  + K
Sbjct: 272 AVTAAKIFGVSNRAIEKVLTSFKGLEHRLEAVGVIKERTIYNDSKATDIEATQKALASFK 331

Query: 348 RRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTLSKTLDQALK 407
             I  IAGGL + DD + L P    +      G +        G K     +  +D   +
Sbjct: 332 EPINLIAGGLDRGDDLNRLVPNFKNVVSLITYGQTKNK-LQSAGEKAGIKQTVVVDTLKE 390

Query: 408 SVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEIPG 453
           +V +  E  +   ++LFSP  AS+DQ+ NF  RG  F   +    G
Sbjct: 391 AVAKAKELSRPGQVLLFSPAAASWDQFPNFEIRGEEFKKMIKNREG 436


>gi|168230405|ref|ZP_02655463.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|194469017|ref|ZP_03075001.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197248149|ref|YP_002145112.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|194455381|gb|EDX44220.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197211852|gb|ACH49249.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|205334952|gb|EDZ21716.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
          Length = 438

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 134/472 (28%), Positives = 221/472 (46%), Gaps = 58/472 (12%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCAVKQAKDMGIEVIDFRE 59
           ++ +++ ++ + GLG +GLS        GV     D     P   K  +++   V    +
Sbjct: 1   MADYQDKNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRVTPPGLDKLPQEVERHVGGLND 60

Query: 60  IPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFIAVT 119
                   +V SPGIAL    AH  +  A    VEI+GDIELF RE      Q+P +A+T
Sbjct: 61  EWLLAADLIVASPGIAL----AHPSLSAAASAGVEIVGDIELFCRE-----AQAPIVAIT 111

Query: 120 GTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELTPTI 179
           G+NGKS+   L+  + +  G +V +GGNIGLP L L   +    YV+E SS+Q+E T ++
Sbjct: 112 GSNGKSTVTTLVGEMAKAAGVNVGVGGNIGLPALML-LDADRELYVLELSSFQLETTSSL 170

Query: 180 DPSIGVLLNISPDHLDRHH-TLENYVNIKKKIVTMSKHAIICIN----------DHQCEK 228
             +   +LN++ DH+DR+   L+ Y   K ++   +K  ++  +          D +C  
Sbjct: 171 QAAAATVLNVTEDHMDRYPFGLQQYRAAKLRVYEKAKVCVVNADDALTMPVRGADERC-- 228

Query: 229 IAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQETKKHNIQNLVTS 288
           +++ +N   + ++R               E++L+      +     + + +HN  N + +
Sbjct: 229 VSFGVNMGDYHLNRQQG------------ETWLRVKGEKVLNVKEMKLSGQHNYTNALAA 276

Query: 289 AVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF--LNE 346
             +   +GL      +AL +  GL HR Q       V +INDSKATN+ S   A   L+ 
Sbjct: 277 LALADAVGLPRASSLKALTTFTGLAHRFQLALEHNGVRWINDSKATNVGSTEAALNGLHV 336

Query: 347 KRRIYWIAGGLSKSDDFSTLFPFISKIAKAYFIGNSAMLFFHHFGGKINSTL-------S 399
              ++ + GG  KS DFS L          Y  G+   L+     G   + L       +
Sbjct: 337 DGTLHLLLGGDGKSADFSPL--------ARYLTGDRIRLYCFGRDGAQFAALRPEIAQQT 388

Query: 400 KTLDQALKSVVRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSEI 451
           +T+++A++ +      VQ   +VL SP CAS DQ+ NF +RG  F     E+
Sbjct: 389 ETMEEAMRLL---APRVQPGDMVLLSPACASLDQFKNFEQRGDVFTRLAKEL 437


>gi|121587626|ref|ZP_01677390.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           2740-80]
 gi|153818416|ref|ZP_01971083.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           NCTC 8457]
 gi|153830351|ref|ZP_01983018.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           623-39]
 gi|255746924|ref|ZP_05420869.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholera
           CIRS 101]
 gi|262161533|ref|ZP_06030643.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           INDRE 91/1]
 gi|30316132|sp|Q9KPG5|MURD_VIBCH RecName: Full=UDP-N-acetylmuramoylalanine--D-glutamate ligase;
           AltName: Full=D-glutamic acid-adding enzyme; AltName:
           Full=UDP-N-acetylmuramoyl-L-alanyl-D-glutamate
           synthetase
 gi|121548136|gb|EAX58209.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           2740-80]
 gi|126511049|gb|EAZ73643.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           NCTC 8457]
 gi|148874158|gb|EDL72293.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           623-39]
 gi|255735326|gb|EET90726.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholera
           CIRS 101]
 gi|262028844|gb|EEY47498.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           INDRE 91/1]
          Length = 440

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 10  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTREAPPGQEQLSSD 53

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 54  VALHRSGWNLEWLLNADLVVTNPGIALATPEIQQVLAA----GIPVVGDIELFAWH---- 105

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 106 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 162

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 163 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 222

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 223 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 274

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 275 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 334

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 335 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 385

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 386 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 432


>gi|88858800|ref|ZP_01133441.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pseudoalteromonas
           tunicata D2]
 gi|88819026|gb|EAR28840.1| UDP-N-acetylmuramoylalanine-D-glutamate ligase [Pseudoalteromonas
           tunicata D2]
          Length = 442

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 143/461 (31%), Positives = 220/461 (47%), Gaps = 38/461 (8%)

Query: 3   LSSFRNHSIAVFGLGRSGLSAACALKDSGVHVIAWDDH---PCA---VKQAKDMGIEVID 56
           L+  +   I V GLG SGLS    L    ++ I  D     P A     QA  +      
Sbjct: 4   LTRLKTKKIIVLGLGVSGLSTVRFLLGQTINPIVVDSRAKPPGAEWLTSQAPHLVCYFGS 63

Query: 57  FREIPWSIISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
             + P + +  +++SPGIAL+       V+ A   NVE+IGDIELF R         P +
Sbjct: 64  LSQAPLTEVDMIIISPGIALSTHE----VQQAIAANVEVIGDIELFARIN-----DKPVV 114

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPNRFYVIECSSYQIELT 176
           AVTG+NGKS+ V L + VL   GY+V L GNIG+  L+L + S    +V+E SS+Q+E T
Sbjct: 115 AVTGSNGKSTVVTLAARVLADAGYNVGLAGNIGISPLDL-FASEIDVFVLELSSFQLETT 173

Query: 177 PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQCEKIAYDMNFI 236
            ++ P    +LN+  DH+DR+  ++ Y   K+ I   ++ A+     +Q + + Y     
Sbjct: 174 TSLAPISATILNLCEDHMDRYAGMDEYYAAKQTIYRNAQWAVY----NQADLLTYPH--- 226

Query: 237 GHSISRISSQSLQSDSDLYIDESFLKCSATSEVIFDFSQET--KKHNIQNLVTSAVVCMQ 294
             + + +S     SD  L  DES    +   + I   S  T   KHN  N +    +   
Sbjct: 227 -EAKATLSFGESGSDYHLEHDESGSFFAYQQQTILPVSDLTIVGKHNQLNALAVMALLKP 285

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLH---SVIHAFLNEKRRIY 351
             +       +  +  GL HR Q +A++  V F NDSKATN+    S I    +  +R+ 
Sbjct: 286 FNIDSFVYSTSFKAFTGLAHRCQFVAQIDGVNFYNDSKATNVGACISSIEGLYSPNKRLI 345

Query: 352 WIAGGLSKSDDFSTL-FPFISKIAKAYFIG-NSAMLFFHHFGGKINSTLSKTLDQALKSV 409
            I GG  K  DFS L + F +++ +   +G +   L     G    S++++ +  A K +
Sbjct: 346 LIVGGDGKGADFSPLQYYFAAQVTELICLGRDGKALAALKAGSHFVSSMAQAVACA-KKL 404

Query: 410 VRDVENVQLPSIVLFSPGCASFDQYNNFRERGFSFMSQVSE 450
               +N      VL +P CAS D Y+N+  RG  F+  V+E
Sbjct: 405 AASGDN------VLLAPACASLDMYSNYMARGDDFVHCVTE 439


>gi|227082526|ref|YP_002811077.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           M66-2]
 gi|229507535|ref|ZP_04397040.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae BX
           330286]
 gi|229512269|ref|ZP_04401748.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           B33]
 gi|229519405|ref|ZP_04408848.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           RC9]
 gi|229607041|ref|YP_002877689.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Vibrio
           cholerae MJ-1236]
 gi|9656976|gb|AAF95546.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|227010414|gb|ACP06626.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           M66-2]
 gi|229344094|gb|EEO09069.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           RC9]
 gi|229352234|gb|EEO17175.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           B33]
 gi|229355040|gb|EEO19961.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae BX
           330286]
 gi|229369696|gb|ACQ60119.1| UDP-N-acetylmuramoylalanine--D-glutamate ligase [Vibrio cholerae
           MJ-1236]
          Length = 467

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/468 (29%), Positives = 217/468 (46%), Gaps = 79/468 (16%)

Query: 11  IAVFGLGRSGLSAACALKDSGVHVIAWDDHPCAVKQAKDMGIEVIDFREIP--------- 61
           + V GLG +GLS    L+           HP          ++VID RE P         
Sbjct: 37  VVVVGLGITGLSVVNYLRKY---------HPSVT-------VQVIDTREAPPGQEQLSSD 80

Query: 62  -------WSI-----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFS 109
                  W++        +V +PGIAL        +       + ++GDIELF       
Sbjct: 81  VALHRSGWNLEWLLNADLVVTNPGIALATPEIQQVLAAG----IPVVGDIELFAWH---- 132

Query: 110 SLQSPFIAVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNLEYFSPN-RFYVIEC 168
            + +P IA+TG+NGKS+   L   +    G    +GGNIG+P L+L   SP+   YV+E 
Sbjct: 133 -VDTPVIAITGSNGKSTVTDLSGVLANAAGVKAAVGGNIGVPALDL--ISPDVELYVLEL 189

Query: 169 SSYQIELTPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTMSKHAIICINDHQC-E 227
           SS+Q+E T ++       LN+S DH+DR+  +E+Y   K +I   ++ A++  +D Q   
Sbjct: 190 SSFQLETTSSLKLKAAAFLNLSEDHMDRYQGMEDYRQAKLRIFDHAETAVVNADDTQTFP 249

Query: 228 KIAYDMNFIGHSISRISSQSL-QSDSDLYI---DESFLKCSATSEVIFDFSQETKKHNIQ 283
             A  +  +   + + +  SL Q     Y+   DE+ + C+  S V         +HN+ 
Sbjct: 250 DHAAHLQVVTFGVEQAAQFSLAQHQGREYLFARDEAVMACAELSLV--------GRHNVA 301

Query: 284 NLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSVIHAF 343
           N++T   +    G+       AL S  GLTHR Q +A    + ++NDSKATN+ S + A 
Sbjct: 302 NVLTVLALLDSAGVNFRLALDALKSYTGLTHRCQVVADNHGIKWVNDSKATNVASTLAAL 361

Query: 344 --LNEKRRIYWIAGGLSKSDDFSTLFPFISKIAK---AYFIGNSAMLFFHHFGGKINSTL 398
             L  + ++Y + GG+ K  DF+ L P ++ +      + +     +  H          
Sbjct: 362 SGLKIEGQLYLLVGGVGKGADFTPLAPVLATLPVQLCCFGVDGHQFMPLHP--------- 412

Query: 399 SKTLDQALKSVVRDVENVQLPS--IVLFSPGCASFDQYNNFRERGFSF 444
           S     +++S++R +   QL S  +VL SP CASFDQ+ NF  RG  F
Sbjct: 413 SARFYDSMESIIRSIRP-QLKSGDMVLLSPACASFDQFKNFMARGDIF 459


>gi|16078584|ref|NP_389403.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221309394|ref|ZP_03591241.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bacillus
           subtilis subsp. subtilis str. 168]
 gi|221313719|ref|ZP_03595524.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bacillus
           subtilis subsp. subtilis str. NCIB 3610]
 gi|221318643|ref|ZP_03599937.1| UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase [Bacillus
           subtilis subsp. subtilis str. JH642]
 gi|2