RPSBLAST alignment for GI: 254781099 and conserved domain: PRK02472

>gnl|CDD|179428 PRK02472, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 447
 Score =  235 bits (603), Expect = 1e-62
 Identities = 132/471 (28%), Positives = 209/471 (44%), Gaps = 50/471 (10%)

Query: 6   FRNHSIAVFGLGRSGLSAACALKDSGVHVIAWD-----DHPCAVKQAKDMGIEVIDFREI 60
           ++N  + V GL +SG +AA  L   G +V   D     ++P   ++  + GI+VI     
Sbjct: 3   YQNKKVLVLGLAKSGYAAAKLLHKLGANVTVNDGKPFSENP-EAQELLEEGIKVI-CGSH 60

Query: 61  PWSI----ISFLVLSPGIALTGENAHWCVKLANQFNVEIIGDIELFVRERRFSSLQSPFI 116
           P  +       +V +PGI     N    V+ A +  + II ++EL      +   ++P I
Sbjct: 61  PLELLDEDFDLMVKNPGIP--YTNP--MVEKALEKGIPIITEVEL-----AYLISEAPII 111

Query: 117 AVTGTNGKSSTVALISHVLRKNGYDVQLGGNIGLPILNL-EYFSPNRFYVIECSSYQIEL 175
            +TG+NGK++T  LI  +L+  G    L GNIG P   + +  + +   V+E SS+Q+  
Sbjct: 112 GITGSNGKTTTTTLIGEMLKAGGQHALLAGNIGYPASEVAQKATADDTLVMELSSFQLMG 171

Query: 176 TPTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIV-TMSKHAIICINDHQCEKIAYDMN 234
             T  P I V+ NI P HLD