RPSBLAST alignment for GI: 254781099 and conserved domain: PRK03369

>gnl|CDD|179571 PRK03369, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional. Length = 488
 Score = 58.6 bits (142), Expect = 3e-09
 Identities = 48/195 (24%), Positives = 75/195 (38%), Gaps = 40/195 (20%)

Query: 295 LGLKVEEIKRALLSCGGLTHRLQTIARLGHVIFINDSKATNLHSV---IHAFLNEKRRIY 351
           +G+    I  AL S     HR + +A    + +++DSKATN H+    I A+     R+ 
Sbjct: 298 VGVPAGAIADALASFRVGRHRAEVVAVADGITYVDDSKATNPHAARASILAY----PRVV 353

Query: 352 WIAGGLSKSDDFSTLFPFI-SKIAKAYFIG--------------------------NSAM 384
           WIAGGL K      L   + S++  A  IG                          ++ M
Sbjct: 354 WIAGGLLKGASVDALVAEMASRLVGAVLIGRDRAVVAEALSRHAPDVPVVQVVTGEDAGM 413

Query: 385 L----FFHHFGGKINSTLSKTL-DQALKSVVRDVENVQLP-SIVLFSPGCASFDQYNNFR 438
                        +     +TL D  + + V     +  P   VL +P  ASFDQ+  + 
Sbjct: 414 PATPEVPVACVTDVADDDGETLGDAVMAAAVAAARRLARPGDTVLLAPAGASFDQFTGYG 473

Query: 439 ERGFSFMSQVSEIPG 453
           +RG +F + V     
Sbjct: 474 DRGDAFAAAVRAAIR 488