RPSBLAST alignment for GI: 254781099 and conserved domain: PRK11929

>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional. Length = 958
 Score = 75.9 bits (187), Expect = 2e-14
 Identities = 47/242 (19%), Positives = 97/242 (40%), Gaps = 40/242 (16%)

Query: 116 IAVTGTNGKSSTVALISHVLRKNGYDV----QLGGNIGLPILNLEYFSPN---------- 161
           +AVTGTNGK+S   L++ +L + G        LG  +   ++     +P+          
Sbjct: 115 VAVTGTNGKTSCAQLLAQLLTRLGKPCGSIGTLGARLDGRLIPGSLTTPDAIILHRILAR 174

Query: 162 ------RFYVIECSSYQIELT--PTIDPSIGVLLNISPDHLDRHHTLENYVNIKKKIVTM 213
                     +E SS+ +E      +  ++    N++ DHLD H T+++Y   K  + + 
Sbjct: 175 MRAAGADAVAMEASSHGLEQGRLDGLRIAVAGFTNLTRDHLDYHGTMQDYEEAKAALFSK 234

Query: 214 SK---HAIICINDHQCEKIAYDMNFIGHSISRISSQSLQSDSDLYIDESFLKCSATSEVI 270
                 A+I  +D    ++   +        ++      + +D+   +  L+ +A  +V 
Sbjct: 235 LPGLGAAVINADDPAAARLLAALP----RGLKVGYSPQNAGADVQARD--LRATAHGQVF 288

Query: 271 -FDFSQET--------KKHNIQNLVTSAVVCMQLGLKVEEIKRALLSCGGLTHRLQTIAR 321
                  +         + N+ NL+  A    +LGL + +I RAL +   +  R++ +  
Sbjct: 289 TLATPDGSYQLVTRLLGRFNVSNLLLVAAALKKLGLPLAQIARALAAVSPVPGRMERVGP 348

Query: 322 LG 323
             
Sbjct: 349 TA 350