HHsearch alignment for GI: 254781100 and conserved domain: TIGR02380

>TIGR02380 ECA_wecA undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase; InterPro: IPR012750 Members of this family are the WecA enzymes of enterobacterial common antigen (ECA) biosynthesis, undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase. This family represents one narrow clade, and closely related sequences outside this clade may represent enzymes that catalyse the same specific reaction, but in the context of different pathways. A His-rich motif in a cytosolic loop of this integral membrane protein, shown to be critical to enzymatic activity for WecA is variously present or absent in the clade that includes Bacillus subtilis TagO teichoic acid biosynthesis enzyme, which may catalyse the same reaction as WecA. ; GO: 0000287 magnesium ion binding, 0016780 phosphotransferase activity for other substituted phosphate groups, 0030145 manganese ion binding, 0009103 lipopolysaccharide biosynthetic process, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=100.00  E-value=0  Score=412.63  Aligned_cols=291  Identities=23%  Similarity=0.365  Sum_probs=249.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH-HHHHHHHHCCCCCHHHHHHHHHHHHHHH
Q ss_conf             999999988999999986220698538873110246578851257787779-9999987535678989998877899999
Q gi|254781100|r   33 MLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHARKIDTPTMGGIIILMG-LIGSSLLWADFSSLHVSIILLLTLSFGL  111 (366)
Q Consensus        33 f~i~~~~~~~~I~~l~~~~~~~g~~~r~~~~~~H~~K~~tP~~GGiai~~~-~l~~~ll~~~~~~~~~~~~l~~~l~~~l  111 (366)
T Consensus         4 li~iFL~sF~~LF~~RkvA~~vGLVDKPn~RK~H~G--~iPLVGGiSif~~nLc~~l~~~~~~i~-~~~LyL~ca~~Lv~   80 (349)
T TIGR02380         4 LIVIFLSSFLTLFLMRKVAKIVGLVDKPNARKRHQG--VIPLVGGISIFLTNLCITLLLHDELIP-HLSLYLACATILVV   80 (349)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHH
T ss_conf             878999999999998675312057268888765545--413330199999999999977555651-03789999999999


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCC-CCCCCCHHHHH
Q ss_conf             99874467875313566036889999999999999986402776655666653377512110000000-12222023578
Q gi|254781100|r  112 VGFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG-LFFIPFAAFVI  190 (366)
Q Consensus       112 iG~iDD~~ki~~~~~~GLs~~~Kl~~Q~i~a~i~~~~l~~~~~~~~~~~~~~~~~~iPf~~~~~l~lg-~l~i~~~~~~i  190 (366)
T Consensus        81 iG~lDDrfD--------isv~iR~~IQa~vs~vMi~~G~~~L~----sLG-------~i~g~~el~LgP~~g~iITiFAv  141 (349)
T TIGR02380        81 IGVLDDRFD--------ISVKIRLAIQAAVSIVMIQFGNIYLH----SLG-------NIFGSKELTLGPLFGYIITIFAV  141 (349)
T ss_pred             HHHHHCCCC--------CCCCHHHHHHHHHHHHHHHHCCCCHH----HCC-------CCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             852320226--------78207799999999999985472523----155-------30204688887678899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCC-----C
Q ss_conf             89985987521111665798999999999976414753466664101478834678998886778889888556-----7
Q gi|254781100|r  191 VATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNI-----S  265 (366)
Q Consensus       191 vg~~NavNl~DGlDGLa~g~~~i~~~~l~ii~~~~g~~~~~~~~~~~~~~~~~~l~i~~~~l~Ga~lgFL~fN~-----~  265 (366)
T Consensus       142 ~gAINAFNMvDGIDGLLGGLs~V~F~ALg~Lf~~dg~~---------------~La~~c~~~i~A~lPYl~LNLGiplGr  206 (349)
T TIGR02380       142 IGAINAFNMVDGIDGLLGGLSCVTFAALGYLFYLDGQV---------------ELAYWCFALIVAILPYLLLNLGIPLGR  206 (349)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHH---------------HHHHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             99986124534310344589999999999998616626---------------899999999999988999846663468


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC--CCHHHHHHH
Q ss_conf             410016461088799999999999624--------5899999999999999999999999860887666--781228999
Q gi|254781100|r  266 PAVIFMGDTGSLALGAFIGGIAVSTKH--------EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFL--MAPIHHHFE  335 (366)
Q Consensus       266 PAkIFmGD~GS~~LG~~la~~ai~~~~--------~~~l~ii~~i~i~~~~sviiq~~~~k~~~kr~f~--~~plHH~l~  335 (366)
T Consensus       207 k~KVFMGDAGS~~IGFTViWLLl~~tQg~~~p~~~PVTALWlIA~PLmDM~aIm~RR~---rkG~SPFkPDR~HlHH~~~  283 (349)
T TIGR02380       207 KFKVFMGDAGSTLIGFTVIWLLLEATQGESSPSMRPVTALWLIALPLMDMAAIMLRRI---RKGDSPFKPDREHLHHILQ  283 (349)
T ss_pred             CCCEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH---HCCCCCCCCCHHHHHHHHH
T ss_conf             8603115600157889999998720013665788740579998614777999999874---2777769777356879998


Q ss_pred             HCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6798851589877899999999999862
Q gi|254781100|r  336 KKGWTENQIVIRFWIISFIFAVIGLLTL  363 (366)
Q Consensus       336 ~~G~s~~~iv~~~~~i~~~~~~~~i~~~  363 (366)
T Consensus       284 r~GLtSRq~L~vIc~~a~l~A~iGI~se  311 (349)
T TIGR02380       284 RLGLTSRQSLVVICLAAALLAAIGILSE  311 (349)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7077277999999999999998768987