HHsearch alignment for GI: 254781100 and conserved domain: cd06854

>cd06854 GT_WbpL_WbcO_like The members of this subfamily catalyze the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate (Und-P) molecule and N-acetylhexosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylhexosamine precursor. The WbcO/WbpL substrate specificity has not yet been determined, but the structure of their biosynthetic end products implies that UDP-N-acetyl-D-fucosamine (UDP-FucNAc) and/or UDPN-acetyl-D-quinosamine (UDP-QuiNAc) are used. The subgroup of bacterial UDP-HexNAc:polyprenol-P HexNAc-1-P transferases includes the WbcO protein from Yersinia enterocolitica and the WbpL protein from Pseudomonas aeruginosa. These transferases initiate LPS O-antigen biosynthesis. Similar to other GlcNAc/MurNAc-1-P transferase family members, WbpL is a highly hydrophobic protein possessing 11 predicted transmembrane segments.
Probab=100.00  E-value=0  Score=384.30  Aligned_cols=243  Identities=27%  Similarity=0.393  Sum_probs=202.9

Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC---CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
Q ss_conf             538873110246578851257787779999998753---56789899988778999999987446787531356603688
Q gi|254781100|r   57 PVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWA---DFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLSGKV  133 (366)
Q Consensus        57 ~~r~~~~~~H~~K~~tP~~GGiai~~~~l~~~ll~~---~~~~~~~~~~l~~~l~~~liG~iDD~~ki~~~~~~GLs~~~  133 (366)
T Consensus         2 vD~P~~Rk~H--~~~tP~~GGi~i~~~~~i~~~~~~~~~~~~~~~~~~ll~~~~~~~~iGl~DD~~--------~l~~~~   71 (253)
T cd06854           2 LDIPNERSSH--TKPTPRGGGIAFVLAFLLALLLAAAAGPLNDLSYLLLLIGLLLLAAVGFIDDLR--------SLSPKI   71 (253)
T ss_pred             CCCCCCCCCC--CCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHC--------CCCHHH
T ss_conf             6799998889--999887519999999999999999835521289999999999999999999760--------687779


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999864027766556666533775121100000001222202357889985987521111665798999
Q gi|254781100|r  134 RILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMI  213 (366)
Q Consensus       134 Kl~~Q~i~a~i~~~~l~~~~~~~~~~~~~~~~~~iPf~~~~~l~lg~l~i~~~~~~ivg~~NavNl~DGlDGLa~g~~~i  213 (366)
T Consensus        72 kl~~q~~~~~~~i~~~~~~~~-----------------~~~~~~~~~~~~~~ti~~iv~~iNa~N~iDGiDGLa~g~~~i  134 (253)
T cd06854          72 RLLVQLLAAALALYALGPLTS-----------------LLLNFLPPWLIALLLLLAIVWIINLYNFMDGIDGLAGGEALV  134 (253)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-----------------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             999999999999999875111-----------------000121489999999999999999999971751178899999


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH-
Q ss_conf             9999999764147534666641014788346789988867788898885567410016461088799999999999624-
Q gi|254781100|r  214 ASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH-  292 (366)
Q Consensus       214 ~~~~l~ii~~~~g~~~~~~~~~~~~~~~~~~l~i~~~~l~Ga~lgFL~fN~~PAkIFmGD~GS~~LG~~la~~ai~~~~-  292 (366)
T Consensus       135 ~~~~l~~i~~~~~~~---------------~~~~~~~~l~~~ll~Fl~~N~~pakiFmGDsGS~~lG~~l~~~~i~~~~~  199 (253)
T cd06854         135 VFLALALLGYLAGEP---------------ALALLALALAGALLGFLPFNWPPAKIFMGDVGSTFLGFLLAALLLLLALS  199 (253)
T ss_pred             HHHHHHHHHHHCCCH---------------HHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHHCC
T ss_conf             999999999845666---------------89999999999988899870775767625607899999999999998435


Q ss_pred             ---HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC--CCHHHHHHHHCCCCCCHH
Q ss_conf             ---5899999999999999999999999860887666--781228999679885158
Q gi|254781100|r  293 ---EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFL--MAPIHHHFEKKGWTENQI  344 (366)
Q Consensus       293 ---~~~l~ii~~i~i~~~~sviiq~~~~k~~~kr~f~--~~plHH~l~~~G~s~~~i  344 (366)
T Consensus       200 ~~~~~~~l~~~~~~~~D~~~v~~~R~---~~~~~p~~~D~~Hlhh~L~~~G~s~~~v  253 (253)
T cd06854         200 GQSPWAWLLLLSPFLVDATVTLLRRL---LRGENIFQAHRKHLYQRLARAGKSHRKV  253 (253)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHH---HCCCCCCCCCCCCHHHHHHHCCCCCCCC
T ss_conf             52599999999999999999999999---8699999999867899998768997889