Query         gi|254781100|ref|YP_003065513.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 366
No_of_seqs    212 out of 2824
Neff          7.0 
Searched_HMMs 33803
Date          Wed Jun  1 22:46:38 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781100.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >2j8s_A ACRB, acriflavine resi  65.0     7.8 0.00023   17.2   6.6   31   68-98     65-95  (251)
  2 >2v50_A Multidrug resistance p  64.2     8.1 0.00024   17.1   3.6   27   70-96     66-92  (248)
  3 >3few_X Colicin S4; cell lysis  31.8      29 0.00085   14.1   2.7   27  286-312   162-188 (211)
  4 >1ots_A Voltage-gated CLC-type  12.2      79  0.0023   11.7   9.8   47  247-295   119-165 (223)
  5 >2v5c_A O-GLCNACASE NAGJ; glyc  11.8      40  0.0012   13.3  -0.7   16  259-274   214-234 (256)
  6 >1jdw_A L-arginine\:glycine am  11.7      81  0.0024   11.6   1.3   11   63-73    113-123 (156)
  7 >1xk7_A Crotonobetainyl-COA:ca  11.6      82  0.0024   11.6   3.0   30  316-345   217-251 (263)
  8 >2v5d_A O-GLCNACASE NAGJ; fami  10.2      49  0.0014   12.8  -0.7   17  259-275   214-235 (292)
  9 >2cho_A Glucosaminidase, hexos   9.1      58  0.0017   12.4  -0.7   16  259-274   209-229 (286)
 10 >3bws_A Protein LP49; two-doma   7.7      99  0.0029   11.2   0.0   12  327-338     1-12  (108)

No 1  
>>2j8s_A ACRB, acriflavine resistance protein B; membrane protein/complex, designed ankyrin repeat protein, multidrug resistance protein; HET: LMT LMU; 2.54A {Escherichia coli} PDB: 2dhh_A 1iwg_A 2dr6_A* 2drd_A* 2hqf_A 2hqg_A 2hqd_A 2hqc_A 2i6w_A 1oy6_A* 1oy9_A* 1oyd_A* 1oy8_A* 1oye_A 2rdd_A* 2w1b_A* 3d9b_A 1t9x_A* 1t9t_A* 1t9v_A* ... (A:505-567,A:868-1055)
Probab=64.98  E-value=7.8  Score=17.23  Aligned_cols=31  Identities=13%  Similarity=0.246  Sum_probs=20.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             6578851257787779999998753567898
Q gi|254781100|r   68 RKIDTPTMGGIIILMGLIGSSLLWADFSSLH   98 (366)
Q Consensus        68 ~K~~tP~~GGiai~~~~l~~~ll~~~~~~~~   98 (366)
                      .++.++...++++++.+++..+.+..+...-
T Consensus        65 s~~~~~~~~~iaivlv~ivl~i~~rs~~~~l   95 (251)
T 2j8s_A           65 SGNQAPSLYAISLIVVFLCLAALYESWSIPF   95 (251)
T ss_dssp             SSCCCTHHHHHHHHHHHHHHHHHTTCSSTHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9989999999999999999999986399999


No 2  
>>2v50_A Multidrug resistance protein MEXB; DDM, RND, membrane, detergent, transport, cell membrane, transmembrane, membrane protein; HET: LMT; 3.00A {Pseudomonas aeruginosa PA01} (A:505-566,A:867-1052)
Probab=64.22  E-value=8.1  Score=17.15  Aligned_cols=27  Identities=15%  Similarity=0.329  Sum_probs=14.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             788512577877799999987535678
Q gi|254781100|r   70 IDTPTMGGIIILMGLIGSSLLWADFSS   96 (366)
Q Consensus        70 ~~tP~~GGiai~~~~l~~~ll~~~~~~   96 (366)
                      ...+...++++...+++..+.+..+..
T Consensus        66 ~~~~~~l~ial~~v~ivl~l~~~s~~~   92 (248)
T 2v50_A           66 SQAPALYALSLLVVFLCLAALYESWSI   92 (248)
T ss_dssp             CCSHHHHHHHHHHHHHHHHHHTTCSST
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             899999999999999999999862999


No 3  
>>3few_X Colicin S4; cell lysis, Y-RAY, cell killing, immune system; 2.45A {Escherichia coli} (X:295-505)
Probab=31.81  E-value=29  Score=14.12  Aligned_cols=27  Identities=15%  Similarity=0.289  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999962458999999999999999999
Q gi|254781100|r  286 IAVSTKHEILLIIIGGLFVVETLSVIM  312 (366)
Q Consensus       286 ~ai~~~~~~~l~ii~~i~i~~~~svii  312 (366)
                      .++....+..+.-+.++.++-..+..|
T Consensus       162 ~~l~~~~~~t~igi~gili~a~v~a~I  188 (211)
T 3few_X          162 YALSLGAPAIAVGIVGILLAAVVGALL  188 (211)
T ss_dssp             HHHHCCSCSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             877325640379999999999999986


No 4  
>>1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} (A:243-465)
Probab=12.17  E-value=79  Score=11.70  Aligned_cols=47  Identities=15%  Similarity=0.385  Sum_probs=20.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9988867788898885567410016461088799999999999624589
Q gi|254781100|r  247 VVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEIL  295 (366)
Q Consensus       247 i~~~~l~Ga~lgFL~fN~~PAkIFmGD~GS~~LG~~la~~ai~~~~~~~  295 (366)
                      +...+..|..+|-++.+..|  .-.=|.+.+.+..+-|..+-..+.|+.
T Consensus       119 l~~Ga~~G~~~~~~~~~~~~--~~~~~~~~~a~~G~aA~~~~~~~aPlt  165 (223)
T 1ots_A          119 LALGTVLGTAFGMVAVELFP--QYHLEAGTFAIAGMGALLAASIRAPLT  165 (223)
T ss_dssp             HHHHHHHHHHHHHHHHHHCG--GGTCCHHHHHHHHHTHHHHHTSCCHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCC--CCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             79989999999999998577--666668999999999999999755999


No 5  
>>2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* (A:149-404)
Probab=11.77  E-value=40  Score=13.30  Aligned_cols=16  Identities=19%  Similarity=0.576  Sum_probs=13.2

Q ss_pred             HHHHCCC-----CCCCCCCCC
Q ss_conf             8885567-----410016461
Q gi|254781100|r  259 FLWFNIS-----PAVIFMGDT  274 (366)
Q Consensus       259 FL~fN~~-----PAkIFmGD~  274 (366)
                      |+|.|+|     +.|+|||..
T Consensus       214 ~iWdNyPVND~~~~rL~lgp~  234 (256)
T 2v5c_A          214 AVWWNYPVTDYFKGKLALGPM  234 (256)
T ss_dssp             EEEECCSCCTTSTTSCCCCCC
T ss_pred             EEEECEECCCCCCCCEEECCC
T ss_conf             698370026788786656776


No 6  
>>1jdw_A L-arginine\:glycine amidinotransferase; creatine biosynthesis, catalytic triad, reaction mechanism, novel fold, fivefold pseudosymmetry; 1.90A {Homo sapiens} (A:1-83,A:117-166,A:401-423)
Probab=11.73  E-value=81  Score=11.62  Aligned_cols=11  Identities=27%  Similarity=0.078  Sum_probs=4.3

Q ss_pred             CCCCCCCCCCC
Q ss_conf             11024657885
Q gi|254781100|r   63 LPIHARKIDTP   73 (366)
Q Consensus        63 ~~~H~~K~~tP   73 (366)
                      |..|.++.+||
T Consensus       113 pvD~s~~~~TP  123 (156)
T 1jdw_A          113 PIDWSLKYKTP  123 (156)
T ss_dssp             CCCTTCEEECS
T ss_pred             CCCCCCCCCCC
T ss_conf             76753210245


No 7  
>>1xk7_A Crotonobetainyl-COA:carnitine COA-transferase; CAIB, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics; 1.60A {Escherichia coli} (A:1-224,A:370-408)
Probab=11.58  E-value=82  Score=11.60  Aligned_cols=30  Identities=20%  Similarity=0.340  Sum_probs=24.1

Q ss_pred             HHHHCCCCCCCCCHHH-----HHHHHCCCCCCHHH
Q ss_conf             9986088766678122-----89996798851589
Q gi|254781100|r  316 YFKMTKKRVFLMAPIH-----HHFEKKGWTENQIV  345 (366)
Q Consensus       316 ~~k~~~kr~f~~~plH-----H~l~~~G~s~~~iv  345 (366)
                      .+-.+|+.+.|-.|.|     ..|.+.|+||.+|-
T Consensus       217 ~y~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (263)
T 1xk7_A          217 DYFNGGEXIWRGXPSHGXDTAAILKNIGYSENDIQ  251 (263)
T ss_dssp             HHHTTSCCCCCCCCCTTTTHHHHHHHTTCCHHHHH
T ss_pred             HHHCCCCCCCCCCCCCCCCHHHHHHHCCCCHHHHH
T ss_conf             01012233889999998559999998599999999


No 8  
>>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} (A:149-440)
Probab=10.25  E-value=49  Score=12.84  Aligned_cols=17  Identities=18%  Similarity=0.514  Sum_probs=13.6

Q ss_pred             HHHHCCC-----CCCCCCCCCC
Q ss_conf             8885567-----4100164610
Q gi|254781100|r  259 FLWFNIS-----PAVIFMGDTG  275 (366)
Q Consensus       259 FL~fN~~-----PAkIFmGD~G  275 (366)
                      |+|.|+|     +.|+|||..-
T Consensus       214 ~iWdNyPvNDy~~~~L~lgp~~  235 (292)
T 2v5d_A          214 AVWWNYPVTDYFKGKLALGPMH  235 (292)
T ss_dssp             EEEECCSCCSSCTTSCCCCCCC
T ss_pred             EEEEEECCCCCCCCCEEECCCC
T ss_conf             8985141488777855655655


No 9  
>>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} (A:127-412)
Probab=9.06  E-value=58  Score=12.44  Aligned_cols=16  Identities=19%  Similarity=0.858  Sum_probs=13.3

Q ss_pred             HHHHCCC-----CCCCCCCCC
Q ss_conf             8885567-----410016461
Q gi|254781100|r  259 FLWFNIS-----PAVIFMGDT  274 (366)
Q Consensus       259 FL~fN~~-----PAkIFmGD~  274 (366)
                      |+|.|+|     +.|+|||..
T Consensus       209 ~iWdNyPVNDy~~~~L~lgp~  229 (286)
T 2cho_A          209 YIWWNFPVSDYVRDHLLLGPV  229 (286)
T ss_dssp             EEEECCSCCTTSTTCCCCSCC
T ss_pred             EEEECCCCCCCCCCCEEECCC
T ss_conf             799682136677785775564


No 10 
>>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} (A:1-108)
Probab=7.75  E-value=99  Score=11.15  Aligned_cols=12  Identities=50%  Similarity=0.850  Sum_probs=0.0

Q ss_pred             CCHHHHHHHHCC
Q ss_conf             781228999679
Q gi|254781100|r  327 MAPIHHHFEKKG  338 (366)
Q Consensus       327 ~~plHH~l~~~G  338 (366)
                      |.|-|||++-.|
T Consensus         1 mhhhhhhle~sg   12 (108)
T 3bws_A            1 MHHHHHHLESSG   12 (108)
T ss_dssp             ------------
T ss_pred             CCCCCCCHHCCC
T ss_conf             975422000379


Done!