BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781100|ref|YP_003065513.1|
phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
Liberibacter asiaticus str. psy62]
         (366 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|163738711|ref|ZP_02146125.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Phaeobacter
           gallaeciensis BS107]
 gi|163741578|ref|ZP_02148969.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161385312|gb|EDQ09690.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Phaeobacter
           gallaeciensis 2.10]
 gi|161388039|gb|EDQ12394.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Phaeobacter
           gallaeciensis BS107]
          Length = 360

 Score =  305 bits (780), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 187/366 (51%), Positives = 251/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   + ++ +Y+TFR+  AF +A+L  F FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDLFNLFRYITFRAGGAFLTALLFGFLFGPPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ ++LLWA   +  V ++L +TLSF L+GF DDY K
Sbjct: 60  DGPEGHLAKAGTPTMGGLLIVGALVTATLLWARLDNPFVWLVLFVTLSFALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+ GK+R+ +   IA++A         S    +E +  +  P F+D ++++GL
Sbjct: 120 VSKQNTAGVPGKLRLALGITIAVIAALW-----ASAYHPVELQNQLALPVFKDTLINLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PF+  VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 FYVPFSICVIVGAANAVNLTDGLDGLAIMPVMIATSTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHE++L I+G
Sbjct: 235 GTGEILIFAAALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|83592289|ref|YP_426041.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodospirillum
           rubrum ATCC 11170]
 gi|97179552|sp|Q2RVU1|MRAY_RHORT RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|83575203|gb|ABC21754.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodospirillum
           rubrum ATCC 11170]
          Length = 360

 Score =  305 bits (780), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 190/366 (51%), Positives = 262/366 (71%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ +      +V +Y+TFR+  A  +AML+ F FGP +I+ L+  Q   GQP+R 
Sbjct: 1   MLYFLSELTAQVSALNVFRYLTFRTGGAVMTAMLVAFVFGPGIIEWLKRKQ-GEGQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGGI+IL+G+  ++LLWAD S  +V  +LLLTL +G +GF DDY+K
Sbjct: 60  DGPESHLTKKGTPTMGGIMILLGVGVATLLWADLSKGYVWAVLLLTLGYGAIGFADDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T  +  GLSG+++++ +  +A++A   ++          +  +S+  PFF+D+  ++G 
Sbjct: 120 LTKRNTKGLSGRLKLVAQVGMAVIAGLWIMLLGQ-----GDQASSLALPFFKDLTFNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PFAAFV+V  +NAVNLTDGLDGLAIVPVMIA+  F  IAY+ GNI+ S+YLQ+  VP
Sbjct: 175 FYLPFAAFVMVGASNAVNLTDGLDGLAIVPVMIAAGVFMLIAYLVGNIIFSNYLQIQHVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V   A++GA +GFLWFN  PA++FMGDTGSLALG  +G ++V TKHEI+L I+G
Sbjct: 235 GTGELAVFCGAIVGAAVGFLWFNAPPAMVFMGDTGSLALGGALGAVSVVTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+ET+SVI+QV  FK+T KRVF MAP+HHHFEKKGW E  +VIRFWII+ I A++GL
Sbjct: 295 GLFVLETVSVIVQVASFKLTGKRVFRMAPLHHHFEKKGWAEPTVVIRFWIIAMILAIVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|56459544|ref|YP_154825.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Idiomarina
           loihiensis L2TR]
 gi|61213956|sp|Q5R0M4|MRAY_IDILO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|56178554|gb|AAV81276.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Idiomarina
           loihiensis L2TR]
          Length = 360

 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 250/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   +    +V  Y+T R+  +  +A+++    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLTQFESAFNVFSYLTLRAILSVLTALVLSLWLGPTLIRRLQRLQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++GSSLLWAD  + +V ++LL+T  FG+VGF DDY 
Sbjct: 59  DDGPESHLVKSGTPTMGGVLILAAVLGSSLLWADLDNRYVWVVLLVTTGFGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +   + +IA +A   L + S         +T+++ PFF+D++  +G
Sbjct: 119 KVVRKDPKGLIAKWKYFWQSVIASVAAVYLYWSSTQG-----AETALLVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + ++  A FVIV T+NAVNLTDGLDGLAI+P ++ + A    AYV+GN+  + YLQ+ ++
Sbjct: 174 MLYMLMAYFVIVGTSNAVNLTDGLDGLAIMPTIMVAAALGIFAYVSGNVNFAEYLQIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   EL+VV +A++GAG+GFLWFN  PA++FMGD GSLALGA +G IA+  + E++L I+
Sbjct: 234 PLTAELLVVCTAIVGAGLGFLWFNTYPALVFMGDVGSLALGAALGIIAILVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QVG +K+  KRVF MAPIHHH+E KGW E ++++RFWI+S IF +IG
Sbjct: 294 GGVFVMETLSVMLQVGSYKLRGKRVFRMAPIHHHYELKGWPEPRVIVRFWILSLIFVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|254465999|ref|ZP_05079410.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacterales
           bacterium Y4I]
 gi|206686907|gb|EDZ47389.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacterales
           bacterium Y4I]
          Length = 360

 Score =  302 bits (773), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 181/366 (49%), Positives = 251/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFYNLFRYITFRAGGAFLTALIFGFLFGKPLINVLRKRQGK-GQPIRN 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ ++L+WA + +  V ++L +T+++GL+GF DDY K
Sbjct: 60  DGPEGHFSKAGTPTMGGLLIVGALLTATLMWARWDNPFVWLVLFVTMAYGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+ GKVR+L+  +IA+ A      Y          +  +  P F+D ++++G+
Sbjct: 120 VSKQNTKGVPGKVRLLLGVLIAVTASLWAAAY-----HPEPLQNQLALPVFKDTLINLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PF+  VIV  ANAVNLTDGLDGLAI+P MIA+     IAY  G +  + YL V++VP
Sbjct: 175 FYVPFSICVIVGAANAVNLTDGLDGLAIMPSMIAAGTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL GAG+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFTAALFGAGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T +RVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGRRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|85712536|ref|ZP_01043584.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Idiomarina
           baltica OS145]
 gi|85693670|gb|EAQ31620.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Idiomarina
           baltica OS145]
          Length = 360

 Score =  302 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 248/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   +    +V  Y+T R+  +  SA+++    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLTQFESGFNVFSYLTLRAILSVLSALMLSVWLGPWLIRRLQRLQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ SSLLWA+  + +V + L + + FG++GF DDY 
Sbjct: 59  DDGPESHLSKSGTPTMGGVLILAAIVASSLLWANLENKYVIVTLFVVVGFGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +   + IIA  A+  L + S      I  +T+++ PFF++++  +G
Sbjct: 119 KVVRKDPKGLIAKWKYFWQSIIASCAIGFLYWSSQ-----IPAETALLVPFFKEVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++    FVIV T+NAVNLTDGLDGLAI+P ++ + A    AYV+GN+  + YLQ+ ++
Sbjct: 174 LLYLFLGYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGALGIFAYVSGNVNFAEYLQIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL+VV +A++GAG+GFLWFN  PA++FMGD GSLALGA +G IA+  + E++L I+
Sbjct: 234 PLSGELLVVCAAIVGAGLGFLWFNTYPAMVFMGDVGSLALGATLGVIAILVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QVG +K+  KRVF MAPIHHH+E KGW E ++++RFWI+S +F +IG
Sbjct: 294 GGVFVMETLSVMLQVGSYKLRGKRVFRMAPIHHHYELKGWPEPRVIVRFWILSLMFVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|56696077|ref|YP_166431.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ruegeria
           pomeroyi DSS-3]
 gi|61213919|sp|Q5LU74|MRAY_SILPO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|56677814|gb|AAV94480.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ruegeria
           pomeroyi DSS-3]
          Length = 360

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 186/366 (50%), Positives = 253/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   + ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDVWNLFRYITFRAGGAFMTALIFGFLFGRPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA + +  V ++L +TL++ L+GF DDY K
Sbjct: 60  DGPEGHFSKAGTPTMGGLLIVGALLTSTLLWARWDNPFVWMVLFVTLAYALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+SGK+R+ +  IIA++A         S     E +  +  P F+D ++++GL
Sbjct: 120 VSKQNTKGVSGKMRLALGVIIAVIAALW-----ASYNHPAELQNQLALPVFKDTLINLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            ++PFA  VIV +ANAVNLTDGLDGLAI+P MIA+     IAY  G +  + YL V++VP
Sbjct: 175 LYVPFAICVIVGSANAVNLTDGLDGLAIMPAMIAASTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL GAG+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFTAALFGAGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|126741292|ref|ZP_01756970.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           SK209-2-6]
 gi|126717610|gb|EBA14334.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           SK209-2-6]
          Length = 360

 Score =  300 bits (767), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 182/366 (49%), Positives = 246/366 (67%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A+   F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFMTALFFGFIFGKPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ ++LLWA   +  V ++L +T+SF L+GF DDY K
Sbjct: 60  DGPEGHFSKAGTPTMGGLLIVGALLTATLLWARLDNPFVWLVLFVTMSFALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+ GKVR+ +   IA++A         S       +  +  P F+D ++++GL
Sbjct: 120 VSKQNTAGVPGKVRLALGIAIAVIAALW-----ASAYHPEMLQNRLALPVFKDTLINLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PF+  VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 FYVPFSICVIVGAANAVNLTDGLDGLAIMPVMIAASTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHE++L I+G
Sbjct: 235 GSGEILIFTAALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV Y+K T KRVFLMAPIHHH+EKKGW E  IVIRFWII+ I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYYKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIIALILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|114327096|ref|YP_744253.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327922|sp|Q0BV22|MRAY_GRABC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|114315270|gb|ABI61330.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 362

 Score =  299 bits (766), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 184/368 (50%), Positives = 255/368 (69%), Gaps = 8/368 (2%)

Query: 1   MFIQLA-DFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA   +E + + ++ +Y+TFRS AA  +A+++ F  GP +I  L+S+Q   GQP+R
Sbjct: 1   MLYDLAHPLAEQFFLFNLFRYITFRSGAACMTALIVSFLLGPALIRWLKSVQRG-GQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG++IL     S+LLW D  + +V  +LLLTL +G +GF DDY
Sbjct: 60  EDGPERHLLEKKGTPTMGGVLILAATGISTLLWTDLRNGYVWAVLLLTLGYGGIGFADDY 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K++  +  GL G+V+++ + +I ++A   ++     +L      T +  P  +D+++ +
Sbjct: 120 LKLSKRNTKGLPGRVKLIGQAVIGLIAAIWIM-----SLTRDPLSTGLAIPLLKDVLIPL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G  F  F   V +  +NAVNLTDGLDGLAIVP +IA+  F+ IAY+ GN + + YLQ+N 
Sbjct: 175 GFAFPLFGMLVAMGASNAVNLTDGLDGLAIVPTIIAAGVFALIAYLVGNHVFATYLQLNE 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           V G GEL V  SALIGAG+GFLWFN  PA +FMGDTGSLALG  +GG+A++TKHEI+L I
Sbjct: 235 VAGTGELTVFCSALIGAGLGFLWFNAPPARVFMGDTGSLALGGALGGVAIATKHEIVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFVVET+SVI+QV ++K T +RVFLMAP+HHHFEKKGW E+ IVIRFWI+SFI A+ 
Sbjct: 295 VGGLFVVETISVIVQVFWYKRTGRRVFLMAPLHHHFEKKGWPESTIVIRFWIVSFILALA 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLATLKIR 362


>gi|259416131|ref|ZP_05740051.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Silicibacter sp.
           TrichCH4B]
 gi|259347570|gb|EEW59347.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Silicibacter sp.
           TrichCH4B]
          Length = 360

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 190/366 (51%), Positives = 253/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFLTALIFGFVFGKPLINVLRKRQGK-GQPIRN 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K+ TPTMGG++I+  L+ S+L+WA + +  V ++L +TLSFGL+GF DDY K
Sbjct: 60  DGPEAHLAKVGTPTMGGLLIVGALLFSTLVWARWDNPFVWLVLFVTLSFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+ GKVR+L+ F+IAI+A     +         E +  +  P F+D++L++G 
Sbjct: 120 VSKQNTKGVPGKVRLLLGFLIAIVAALWASW-----NHPAELQNQLAMPIFKDVLLNLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            ++PF   VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  S YL V++VP
Sbjct: 175 LYVPFCICVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGIIAYAVGRVDFSEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  SAL G G+GFLW+N  PA +FMGDTGSLALG  +G IA+STKHE++L I+G
Sbjct: 235 GTGEILIFTSALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAISTKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|86137686|ref|ZP_01056263.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           MED193]
 gi|85826021|gb|EAQ46219.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           MED193]
          Length = 360

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 181/366 (49%), Positives = 248/366 (67%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A+L  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFMTALLFGFLFGKPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ ++L+WA   +  V ++L +TLSF L+GF DDY K
Sbjct: 60  DGPEGHFTKAGTPTMGGLLIVGALLTATLIWARLDNPFVWLVLFVTLSFALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+SGKVR+L+  +IA++A      +          +  +  P F+D ++++G 
Sbjct: 120 VSKQNTAGVSGKVRLLLGILIAVIAALCARAFHPEA-----LQNQLALPVFKDTLINLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PF   VIV +ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 FYVPFVICVIVGSANAVNLTDGLDGLAIMPVMIAAGTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHE++  I+G
Sbjct: 235 GTGEILIFAAALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHELVWAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QV YFK T +RVFLMAPIHHH+EKKGW E  IVIRFWII+ I A+IGL
Sbjct: 295 GLFVLEALSVIIQVLYFKRTGRRVFLMAPIHHHYEKKGWAEPTIVIRFWIIALILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|209963949|ref|YP_002296864.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodospirillum
           centenum SW]
 gi|254813249|sp|B6IRG5|MRAY_RHOCS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|209957415|gb|ACI98051.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Rhodospirillum
           centenum SW]
          Length = 361

 Score =  298 bits (764), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 184/366 (50%), Positives = 264/366 (72%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           +F  L   ++ + I ++ +Y+TFR+  A  +A+LI F  GP+VI  L+S+Q   GQP+R 
Sbjct: 2   LFNLLYPLADEFQIFNLFRYITFRTGGAMVTALLISFVIGPRVIRWLKSVQ-GEGQPIRT 60

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL+ +I S+LLW D ++++  I+LL+T+ FGL+GF DD++K
Sbjct: 61  DGPETHLKKKGTPTMGGLMILIAVIVSTLLWVDLANVYTWIVLLVTVGFGLIGFGDDFLK 120

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T  +  GLSG++++     IA +A    +  +          T +  PFF+D+++++G 
Sbjct: 121 LTKRNTKGLSGRLKLAWTIAIAGVAATWYIAVTPH-----PLDTGLAVPFFKDLLVNLGW 175

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFA  V+V  +NAVNLTDGLDGLAIVP+MIA+  F  IAY++GN + + YLQ++ VP
Sbjct: 176 FFIPFAILVMVGASNAVNLTDGLDGLAIVPIMIAAATFGLIAYLSGNAIFAGYLQIHHVP 235

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V   AL+GAG+GFLWFN  PA++FMGDTGSL++G  +G ++V TKHE++L I+G
Sbjct: 236 GTGELAVFCGALVGAGLGFLWFNAPPAMVFMGDTGSLSMGGALGAVSVMTKHELVLAIVG 295

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SV++QV  FK+T KRVF MAPIHHHFEKKGW+E  +VIRFWII+ I A++GL
Sbjct: 296 GLFVLEAVSVMVQVASFKLTGKRVFRMAPIHHHFEKKGWSEPTVVIRFWIIAAILALVGL 355

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 356 STLKLR 361


>gi|99081860|ref|YP_614014.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ruegeria sp.
           TM1040]
 gi|122397750|sp|Q1GF14|MRAY_SILST RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|99038140|gb|ABF64752.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Ruegeria sp.
           TM1040]
          Length = 360

 Score =  298 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 189/366 (51%), Positives = 254/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFLTALIFGFVFGKPLINVLRKRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K+ TPTMGG++I+  L+ S+L+WA + +  V ++L +T+SFGL+GF DDY K
Sbjct: 60  DGPEAHLAKVGTPTMGGLLIVGALLFSTLMWARWDNPFVWLVLFVTMSFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+SGKVR+L+ F+IAI+A     +         E +  +  P F+D++L++G 
Sbjct: 120 VSKQNTSGVSGKVRLLLGFVIAIVAALWASW-----NHPAELQNQLAMPVFKDVLLNLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            ++PF   VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  S YL V++VP
Sbjct: 175 LYVPFCICVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGIIAYAVGRVDFSEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  SAL G G+GFLW+N  PA +FMGDTGSLALG  +G IA+STKHE++L I+G
Sbjct: 235 GTGEILIFTSALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAISTKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T +RVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGRRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|254477502|ref|ZP_05090888.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ruegeria sp.
           R11]
 gi|214031745|gb|EEB72580.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ruegeria sp.
           R11]
          Length = 360

 Score =  298 bits (763), Expect = 8e-79,   Method: Composition-based stats.
 Identities = 186/366 (50%), Positives = 250/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A+L  F FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFLTALLFGFLFGPPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ ++LLWA + +  V ++L +TLSFGL+GF DDY K
Sbjct: 60  DGPEAHLAKAGTPTMGGLLIVGALVTATLLWARWDNPFVWLVLFVTLSFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+ GK+R+ +   IA++A      Y          +  +  P F+D ++++GL
Sbjct: 120 VSKQNTAGVPGKLRLALGITIAVIAALWAAAYHPEA-----LQNRLAMPVFKDTLINLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            ++PF+  VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 LYVPFSICVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGIIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFTAALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|254510269|ref|ZP_05122336.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacteraceae
           bacterium KLH11]
 gi|221533980|gb|EEE36968.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacteraceae
           bacterium KLH11]
          Length = 360

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 181/366 (49%), Positives = 249/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFWNLFRYITFRAGGAFLTALIFGFLFGKPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+L+WA + + +V ++L +TL++  +GF DDY K
Sbjct: 60  DGPEGHLSKAGTPTMGGLLIVGALVTSTLIWARWDNPYVWMVLFVTLAYAGIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+S ++R+ +  +IA+LA         +     + +  +  P F+D ++++GL
Sbjct: 120 VSKQNTKGVSSRMRLALGVLIAVLASLW-----ATLHHPADLQNQMALPVFKDTLINLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            +IPFA  VIV  ANAVNLTDGLDGLAI+P MIA+     IAY  G +  + YL V++VP
Sbjct: 175 LYIPFAVIVIVGAANAVNLTDGLDGLAIMPAMIAASTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+ +  SAL GAG+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L ++G
Sbjct: 235 GTGEIFIFTSALFGAGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAVVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKHTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|163794524|ref|ZP_02188495.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [alpha
           proteobacterium BAL199]
 gi|159180248|gb|EDP64771.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [alpha
           proteobacterium BAL199]
          Length = 362

 Score =  298 bits (762), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 185/368 (50%), Positives = 258/368 (70%), Gaps = 8/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   ++ +   ++ +Y+TFR+  A  +A+LI F  GP +I  L+S Q   GQP+R
Sbjct: 1   MLYNLLVPLADQHQAFNLFRYLTFRTGGATITALLIAFVLGPWLIRWLKSRQRG-GQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG++IL+GL  S+LLWA+ ++ +V  +LL+T+ FG +GF DD+
Sbjct: 60  EDGPEGHLLTKKGTPTMGGLLILIGLSVSTLLWANLANPYVWAVLLVTIGFGAIGFGDDW 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K+T  ++ GL GK+++  +  I   A       + S+ +       +  PFF+D+++ +
Sbjct: 120 LKLTRRNSKGLPGKLKLAFQIAIGTAATL-----AISSTMSEPLTFGLAVPFFKDVLIQL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
             FF+PFA FV+V  +N+VNLTDGLDGLAIVPVMIA   F+ IAY++GN + ++YLQ++ 
Sbjct: 175 SWFFVPFAVFVMVGASNSVNLTDGLDGLAIVPVMIAGSCFALIAYLSGNAVFANYLQIHH 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V   AL+GAG+GFLWFN  PA++FMGDTGSL+LG  +G I+V TKHE++L I
Sbjct: 235 VPGAGELAVFCGALVGAGLGFLWFNAPPAMVFMGDTGSLSLGGALGTISVITKHELVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           IGGLFV+ET+SVI+QV  FK+T KRVF MAP+HHHFEKKGW E  IVIRFWII+ I A++
Sbjct: 295 IGGLFVLETVSVIVQVASFKLTGKRVFRMAPLHHHFEKKGWQEPTIVIRFWIIAIILALV 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLSTLKLR 362


>gi|254470567|ref|ZP_05083971.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudovibrio sp.
           JE062]
 gi|211960878|gb|EEA96074.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudovibrio sp.
           JE062]
          Length = 364

 Score =  297 bits (761), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 213/370 (57%), Positives = 268/370 (72%), Gaps = 10/370 (2%)

Query: 1   MFIQLADFSEYY---IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQP 57
           M   LA+ SE Y      +V KY+TFR+  A  +A+L VF FGP++ID LRS Q   GQP
Sbjct: 1   MLYLLAELSEVYPSLSALNVFKYITFRTGGAIMTALLFVFLFGPRIIDALRSRQGH-GQP 59

Query: 58  VRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           +R      H   K  TPTMGG++IL G+I ++LLWAD  + +  I+L +T+ FGL+GFYD
Sbjct: 60  IREDGPQSHLLTKKGTPTMGGLMILSGMIVATLLWADLRNPYTWIVLGVTVGFGLIGFYD 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY+K+T     G  GK R+ +EF+IA LA  A+    +         TSI FPFF+++ L
Sbjct: 120 DYLKVTKSSHKGFGGKARLGLEFLIAGLAAFAVTLLDSE-----PFSTSIGFPFFKELTL 174

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
           ++GLFFIPFAAFV+V   NAVNLTDGLDGLAIVPVMIA+ AF  +AY+ GN + S+YLQ+
Sbjct: 175 NLGLFFIPFAAFVVVGAGNAVNLTDGLDGLAIVPVMIAAAAFGLVAYLTGNAVFSNYLQI 234

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           + V G GEL VV  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+TKHEI+L
Sbjct: 235 HHVAGTGELAVVCGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGAIAVATKHEIVL 294

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            IIGGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE  GWTE+Q+VIRFWII+ + A
Sbjct: 295 AIIGGLFVLEAVSVIVQVASFKLTGKRVFRMAPIHHHFEHLGWTESQVVIRFWIIAVVLA 354

Query: 357 VIGLLTLKMR 366
           +IGL TLK+R
Sbjct: 355 LIGLATLKLR 364


>gi|89095262|ref|ZP_01168183.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanospirillum
           sp. MED92]
 gi|89080469|gb|EAR59720.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanospirillum
           sp. MED92]
          Length = 360

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADF-SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA+F SEYY    V +Y+T R      +A++I    GP VI+ LRS Q   GQ VR
Sbjct: 1   MLPLLAEFLSEYYSGFAVFQYLTLRGILGVLTALMISLLVGPYVINKLRSNQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW+D S+ +V + L +TL FG VG+ DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGALILVAIAISTLLWSDLSNPYVWVTLGVTLIFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  K + L + +  + A   L   +++       +TS++ PF +D+ +++G
Sbjct: 119 KVVEKNPRGLPAKWKYLWQSVGGLGAAIVLYAIADT-----PAETSLLIPFLKDVSIELG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI F  FVIV ++NAVNLTDGLDGLAI+P ++   A    AY++GN   S YL + +V
Sbjct: 174 IFFIVFTYFVIVGSSNAVNLTDGLDGLAILPTVMVGGALGVFAYLSGNFNFSEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL++   A++GAG+GFLWFN  PA +FMGD G+L+LGA +G IAV  + E++L I+
Sbjct: 234 PGSGELIIFCGAIVGAGLGFLWFNTYPAQVFMGDVGALSLGAALGVIAVIVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV ET+SVI+QV  FK+T +R+F MAP+HHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVAETVSVILQVASFKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVVLVLIG 353

Query: 360 LLTLKMR 366
             +LK+R
Sbjct: 354 FASLKIR 360


>gi|260430916|ref|ZP_05784887.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414744|gb|EEX08003.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 360

 Score =  297 bits (759), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 180/366 (49%), Positives = 248/366 (67%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFLTALIFGFLFGKPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA + + +V ++L +TL++  +GF DDY K
Sbjct: 60  DGPEGHFSKAGTPTMGGLLIVGALVTSTLLWARWDNPYVWMVLFVTLAYAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+SGK+R+ +      + + AL     S       +  +  P F+D ++++G+
Sbjct: 120 VSKQNTKGVSGKMRLAL-----GIIIAALAALWASLHHPEMLQNQLALPIFKDALINLGV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+IPF+  VIV  ANAVNLTDGLDGLAI+P MIA+     IAY  G +  + YL V++VP
Sbjct: 175 FYIPFSIVVIVGAANAVNLTDGLDGLAIMPAMIAASTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  +AL G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFTAALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T +RVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGRRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|260428452|ref|ZP_05782431.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citreicella sp.
           SE45]
 gi|260422944|gb|EEX16195.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citreicella sp.
           SE45]
          Length = 360

 Score =  295 bits (756), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 192/366 (52%), Positives = 252/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   + ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTGLSDGGDLFNLFRYITFRAGGAFLTALVFGFLFGQPLINVLRKRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V ++L +T+S+  +GF DDY K
Sbjct: 60  DGPEGHFVKAGTPTMGGLLIVGALLTSTLLWARLDNAFVWMVLFVTISYAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   +  G+SGKVR+L+ F+IA +A     ++        E    + FP F+D +L++G+
Sbjct: 120 VKKQNTAGVSGKVRLLLGFLIAGIAGAWASYF-----HPAELTGQLAFPVFKDALLNLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PF+  VIV  ANAVNLTDGLDGLAI+PVMIA  A   IAY  G    + YL V++VP
Sbjct: 175 FFVPFSMIVIVGAANAVNLTDGLDGLAIMPVMIAGGALGIIAYAVGRTDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+ +  +ALIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 GTGEIFIFTAALIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|163854032|ref|YP_001642075.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           extorquens PA1]
 gi|163665637|gb|ABY33004.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           extorquens PA1]
          Length = 375

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 197/366 (53%), Positives = 252/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ S      +V +Y+TFR+  A F+A   VF FGP +I  LR  Q   GQP+R 
Sbjct: 16  MLYLLSELSGTLTPLNVFRYITFRTGGALFTAGFFVFWFGPWIISLLRLRQGK-GQPIRE 74

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL G + S LLW +  + +V + L +TL FG +GFYDDY+K
Sbjct: 75  DGPASHLTKRGTPTMGGLMILAGAVVSILLWTNPHNHYVWVTLAVTLGFGAIGFYDDYLK 134

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SG+ R+L+EF IA  A   +  YS +       +  + FP  +D +L++G 
Sbjct: 135 VTKQSHKGFSGRFRLLLEFAIAGAACLMISLYSPAG-----LQNQLAFPVLKDTLLNLGW 189

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PFAAFVIV   NAVN+TDGLDGLAIVPVMIA   F  IAY+ GN++ + YLQVN+V 
Sbjct: 190 FWVPFAAFVIVGAGNAVNITDGLDGLAIVPVMIACATFGIIAYLVGNVIYAGYLQVNYVR 249

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GEL VV  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L I+G
Sbjct: 250 DTGELAVVCGAVIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGSIAVAAKHEIVLAIVG 309

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGW E Q+VIRFWII+ I A++GL
Sbjct: 310 GLFVLEIMSVIIQVVSFKLTGKRVFRMAPIHHHFEQKGWKEPQVVIRFWIIAVILALVGL 369

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 370 ATLKLR 375


>gi|322421365|ref|YP_004200588.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter sp.
           M18]
 gi|320127752|gb|ADW15312.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter sp.
           M18]
          Length = 358

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 236/367 (64%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y + +V KY+TFRS  A  +A+++ F  GP VI  L  LQ    Q +R
Sbjct: 1   MLYHLLYPLASDYKLFNVFKYLTFRSIYAMITALVLSFIVGPWVIRKLEGLQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL+ +I  +LLWAD  ++ + + LL+   +G++GF DDY 
Sbjct: 59  TDGPESHLKKQGTPTMGGVLILVCIIVPTLLWADLKNVFIWLTLLIIAGYGVLGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++A      L +            T + FPFF+ +  ++G
Sbjct: 119 KVVEKNPKGLSPRQKMFWQVLLAGGVGVFLYYLPG-------FSTELYFPFFKRVHPELG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FIPF   VIV ++NAVNLTDGLDGLAI PV I +  +    Y+AGN  LS YLQ+ +V
Sbjct: 172 LLFIPFVTVVIVGSSNAVNLTDGLDGLAIGPVAINAATYLLFCYIAGNARLSGYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAG+GFLW+N  PA +FMGD GSL+LG  +G +AV TK EILL+I+
Sbjct: 232 PGAGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGALGTLAVLTKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGVFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|37527521|ref|NP_930865.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|61214269|sp|Q7N144|MRAY_PHOLL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|36786956|emb|CAE16030.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           (UDP-MurNAc-pentapeptide phosphotransferase)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 360

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKYHSGFNVFSYLTFRAIVSLLTALAIALWMGPRMIAFLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  S+LLW   ++ +V  +L++ + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILLSITISTLLWVRLNNPYVWCVLIVLIGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A+    A+  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVLALGVAFAMYSFGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I    FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 VLYILLTYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 SHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|163746125|ref|ZP_02153484.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Oceanibulbus
           indolifex HEL-45]
 gi|161380870|gb|EDQ05280.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Oceanibulbus
           indolifex HEL-45]
          Length = 360

 Score =  295 bits (755), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 184/366 (50%), Positives = 253/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AFF+A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTLLSDGGDFFNLFRYITFRAGGAFFTALVFGFLFGKPLIEVLRKRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  + ++L +T+SF  +G+ DD+ K
Sbjct: 60  DGPEGHFAKAGTPTMGGLLIVGALLTSTLLWARLDNPFIWLVLFVTMSFAAIGYADDHAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  ++ G+ GKVR+L+ F+IA +A      Y        E +  +  P F+D ++++G+
Sbjct: 120 VSKQNSDGVPGKVRLLLGFLIAGIAGYWAAQY-----HPAELQYQLALPVFKDTLVNLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  VIV +ANAVNLTDGLDGLAI+PVMIA+ A   IAY  G +  + YL V++VP
Sbjct: 175 LFVPFAIIVIVGSANAVNLTDGLDGLAIMPVMIAAGALGVIAYAVGRVDFTDYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + + G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFTAGIFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A++GL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILALLGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|312114847|ref|YP_004012443.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219976|gb|ADP71344.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 361

 Score =  295 bits (755), Expect = 8e-78,   Method: Composition-based stats.
 Identities = 194/367 (52%), Positives = 259/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+ S    + ++ +Y+TFR++ A  +AMLIVF  GP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYLLAELSNQAPLFNLFRYITFRTAGAVVTAMLIVFLLGPSLINSLRVRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL+GL  ++LLWA+  + +V I+L +TLS+GL+GFYDDY+K
Sbjct: 60  DGPKSHFSKKGTPTMGGLMILLGLCVATLLWANPYNPYVWIVLAVTLSYGLIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPF-FRDIILDMG 179
           +T  +  G SG+ R+L+E +IA +A  A++  +  +       TS+  PF    +I    
Sbjct: 120 VTKRNTSGFSGRFRLLLELLIAGIATYAIMVATAPS-----ISTSLTVPFLKDVVITLGP 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVI    NAVNLTDGLDGLAIVPVMIA+  F  IAY+ GN + S YLQ++FV
Sbjct: 175 VLFVCLGVFVIAGAGNAVNLTDGLDGLAIVPVMIAAATFGLIAYLVGNRIFSEYLQIHFV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV  AL+GAG+GFLWFN  PA+IFMGDTGSLALG  +G IAV+ KHEI+L I+
Sbjct: 235 PGAGELAVVCGALLGAGLGFLWFNAPPAMIFMGDTGSLALGGLLGSIAVAVKHEIVLAIV 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ET+SVI+QV  +K+T KRVF MAP+HHHFE+KGW E  +V+RFWII+ I A++G
Sbjct: 295 GGLFVLETVSVIVQVLSYKLTGKRVFRMAPLHHHFEQKGWAEPTVVVRFWIIAVILALVG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|83949454|ref|ZP_00958187.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius
           nubinhibens ISM]
 gi|83837353|gb|EAP76649.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius
           nubinhibens ISM]
          Length = 360

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 190/366 (51%), Positives = 257/366 (70%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   + ++ +Y+TFR+  AF +A+   F FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDLFNLFRYITFRAGGAFLTALFFGFLFGPPLINVLRRRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  ++ ++LLWA   + +V +++++TL FGL+GF DDY K
Sbjct: 60  DGPETHFAKAGTPTMGGLLIVGAMLTATLLWARLDNPYVWVVMMVTLGFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++ G+  G+ GKVR+ I F I+ +A      +          +  +  P F+D++L++G 
Sbjct: 120 VSKGNHKGVPGKVRLAIGFFISAVAAYVATLFHPEA-----LQHQLALPVFKDVLLNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFA  VIV +ANAVNLTDGLDGLAI+PVMIASV+   IAY  G +  + YL V++VP
Sbjct: 175 FFIPFAMIVIVGSANAVNLTDGLDGLAIMPVMIASVSLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++ ++ L+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHEI+L IIG
Sbjct: 235 GTGEILIFVAGLVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW+E QIVIRFWI++ I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWSEPQIVIRFWIVALILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|300021775|ref|YP_003754386.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299523596|gb|ADJ22065.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 360

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 194/366 (53%), Positives = 256/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M  +L +FS+     +V +Y+TFRS  A F+A+L V  FGP +ID LR  Q   GQP+R 
Sbjct: 1   MLYELVNFSDQISALNVFRYITFRSGGAIFTALLFVMMFGPAIIDLLRVKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL G+  S+LLWA  S+ ++ ++L + + +G +GFYDD++K
Sbjct: 60  DGPQSHLLKRGTPTMGGLMILAGVTVSTLLWAQLSNGYIWVVLGVAICYGAIGFYDDFLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R L+E ++A +A   L+             T + FPFF+D+++D+G 
Sbjct: 120 VTKRSTAGFSGKSRFLLEVLVAAVAGYILMKLGPKG-----LDTDLTFPFFKDLVIDLGP 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFI  A  VI    NAVNLTDGLDGLAIVPVMIA+  F  IAY++GN   + YLQ++ +P
Sbjct: 175 FFILMAVLVIAGAGNAVNLTDGLDGLAIVPVMIAAATFGVIAYLSGNAKFAGYLQIHHIP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V+  ALIGAG+GFLWFN  PA+IFMGDTGSLALG  +G IAV+ KHEI+L ++G
Sbjct: 235 GTGELAVICGALIGAGLGFLWFNAPPAMIFMGDTGSLALGGILGAIAVAIKHEIVLAVVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+ETLSV++QV  FK T KRVF MAP+HHH+E+KGW E+ +VIRFWIIS I A+IGL
Sbjct: 295 GLFVLETLSVVIQVMSFKWTGKRVFKMAPLHHHYEQKGWKESTVVIRFWIISVILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|307944897|ref|ZP_07660234.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseibium sp.
           TrichSKD4]
 gi|307771821|gb|EFO31045.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseibium sp.
           TrichSKD4]
          Length = 361

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 211/367 (57%), Positives = 267/367 (72%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L +F+  +   +V +Y+TFR+ A+  +A+  VF FGPK+I  LR  Q   GQP+R 
Sbjct: 1   MFYYLGEFANQFSALNVFRYITFRTGASIMTALFFVFLFGPKIISSLRVRQGH-GQPIRA 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL G + ++LLWAD S+ +V +++ +TL FGL+GFYDDY+
Sbjct: 60  DGPEGHLLTKKGTPTMGGLMILSGALVAALLWADLSNPYVWVVIGVTLGFGLIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G  GK R+ +EF+IA LA      Y+ + L      TSI FPF +D  L++G
Sbjct: 120 KVTKASHKGFGGKARLGLEFLIAALAA-----YAVTVLDNAPFSTSIAFPFLKDFTLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LFFIPFAAFVIV   NAVNLTDGLDGLAIVPVMIA  +F  IAY++GN + + YLQ+++V
Sbjct: 175 LFFIPFAAFVIVGAGNAVNLTDGLDGLAIVPVMIACASFGLIAYLSGNAVFADYLQIHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+TKHEI+L II
Sbjct: 235 PGTGELAVIAGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMIGAIAVATKHEIVLAII 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE  GWTE+QIVIRFWII+ + A+IG
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFRMAPIHHHFEYHGWTESQIVIRFWIIAVVLALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|153009071|ref|YP_001370286.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ochrobactrum
           anthropi ATCC 49188]
 gi|166221337|sp|A6WZQ3|MRAY_OCHA4 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|151560959|gb|ABS14457.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ochrobactrum
           anthropi ATCC 49188]
          Length = 360

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 207/366 (56%), Positives = 273/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMLLTFFAEHMTPLNVFRYITFRTGGAMITSALIVFLFGPSIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++LL+T+ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILVSCLLWANLASVYVWVVLLVTVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA +A   ++             +S+ FPF +  ++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAVAAFVIMRAGQE-----PFSSSLTFPFAKQFVVNLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QVG FK+T KRVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVVEALSVIIQVGSFKLTGKRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|37678795|ref|NP_933404.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           vulnificus YJ016]
 gi|320157426|ref|YP_004189805.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           vulnificus MO6-24/O]
 gi|56749327|sp|Q7MNV4|MRAY_VIBVY RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|37197536|dbj|BAC93375.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Vibrio
           vulnificus YJ016]
 gi|319932738|gb|ADV87602.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           vulnificus MO6-24/O]
          Length = 360

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAILSVLTALGLSLWMGPRLIKRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWA+ S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAISITILLWANLSNPYVWAVLAVLMGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAYGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  S YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFSQYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|328542963|ref|YP_004303072.1| glycosyl transferase, family 4 [polymorphum gilvum SL003B-26A1]
 gi|326412709|gb|ADZ69772.1| Glycosyl transferase, family 4 [Polymorphum gilvum SL003B-26A1]
          Length = 361

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 211/367 (57%), Positives = 266/367 (72%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L + S      +V KY+TFR+  A  +A+L VF FGPK+I  LR  Q   GQP+R 
Sbjct: 1   MFYFLGELSGQISALNVFKYITFRTGGAIMTALLFVFLFGPKIISSLRLRQGK-GQPIRE 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL G+I ++LLWAD +S +V I+L +T+ FGL+GFYDDY+
Sbjct: 60  DGPQSHLLTKKGTPTMGGLMILSGMIVATLLWADLTSPYVWIVLGVTVGFGLIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G  GK R+ +EF IA LA      Y+ + L      TSI FPF +D++L++G
Sbjct: 120 KVTKSSHKGFGGKARLGLEFAIAGLAA-----YAVTLLDSGPFSTSIAFPFLKDLVLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FIPFAAFV+V   NAVNLTDGLDGLAIVPVMIAS +F+ IAY++GN + + YLQ++ V
Sbjct: 175 ILFIPFAAFVVVGAGNAVNLTDGLDGLAIVPVMIASASFAMIAYLSGNAVFAEYLQIHHV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+TKHEI+L II
Sbjct: 235 AGTGELAVLCGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMIGAIAVATKHEIVLAII 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE  GWTE+Q+VIRFWII+ + A+IG
Sbjct: 295 GGLFVLEAVSVIVQVISFKLTGKRVFKMAPIHHHFEHLGWTESQVVIRFWIIAVVLALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|304310315|ref|YP_003809913.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium HdN1]
 gi|301796048|emb|CBL44252.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium HdN1]
          Length = 360

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA    +++   +V +Y+T R+     +A+ I    GPK+I  L   Q   GQ VR
Sbjct: 1   MLVWLAQLLGQHFTFFNVFQYLTLRAILGVLTALGIALWLGPKMIRSLSLHQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLW+D S+ +V ++L++TLSFG VG+ DDY 
Sbjct: 59  DDGPKSHLSKSGTPTMGGALILVAIAIATLLWSDLSNRYVWVVLIITLSFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + ++ I+A   L   ++S      ++T ++ PFF+++ +++G
Sbjct: 119 KVVQKNSRGLPARWKYFWQSLVGIVAAIYLYASASS-----PSETQLLLPFFKNVQVEIG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P ++   A    AYV GN+  + YLQ  ++
Sbjct: 174 VLYIALAYFVIVGTSNAVNLTDGLDGLAILPTILVGAALGVFAYVTGNVKFASYLQFPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL+V+  AL GAG+GFLWFN  PA +FMGD G+LALG  +G +AV T+ EI+L I+
Sbjct: 234 AGTGELIVLCGALFGAGLGFLWFNTYPAQVFMGDVGALALGGTLGALAVITRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T +R+F MAPIHHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVMETVSVILQVASFKLTGRRIFRMAPIHHHFELKGWAEPKVIVRFWIITVVLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|308048065|ref|YP_003911631.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ferrimonas
           balearica DSM 9799]
 gi|307630255|gb|ADN74557.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Ferrimonas
           balearica DSM 9799]
          Length = 359

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 242/367 (65%), Gaps = 9/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +YY   +V  Y+TFR+     +A+      GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQYYTAFNVFSYLTFRAIVGLLTALAFCLWAGPRMIAYLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL G+  S+LLW D  + +V  +L +  +FGL+GF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGLMILAGIFVSTLLWGDLGNHYVLTMLFVIGAFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   +   A+     L             +  +V PF +D++  +G
Sbjct: 119 KVIRKDPKGLIARWKYFWQSAAALTVAITLY------ACTAPEQQVLVVPFLKDVMPQLG 172

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A F IV ++NAVNLTDGLDGLAIVP ++ + AF+ +AY++GN+  + YL + ++
Sbjct: 173 LVYIALAYFTIVGSSNAVNLTDGLDGLAIVPTVMVAAAFALVAYLSGNVNFAQYLHIPYL 232

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELVVV +A++GAG+GFLWFN  PA +FMGD GSLALGA +G +AV T+ EILL+I+
Sbjct: 233 PGAGELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGALAVLTRQEILLVIM 292

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFVVETLSVI+QVG FK+ +KR+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 293 GGLFVVETLSVILQVGSFKLRRKRIFRMAPIHHHYELKGWPEPRVIVRFWIISLCLVLLG 352

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 353 LATLKVR 359


>gi|54310306|ref|YP_131326.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           profundum SS9]
 gi|61214124|sp|Q6LMF3|MRAY_PHOPR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|46914747|emb|CAG21524.1| putative phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Photobacterium profundum SS9]
          Length = 360

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LAD  E  Y    + +Y+TFR+  +  +A+++    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIYWLADLLEPSYPFFRLFEYLTFRAIMSVLTALILSLWMGPRLIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  ++LLW D S+ ++  +L + L +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILAAITITALLWTDLSNPYIWAVLAVMLGYGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVHKNSDGLIARWKYFWQSVIALVIAFALYMHGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +   +FIA+  GN+  + YL + ++
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGMAFIAWATGNVNFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVV+ +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LL+I+
Sbjct: 234 KDTSELVVLCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  +I 
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|27364042|ref|NP_759570.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           vulnificus CMCP6]
 gi|29611802|sp|Q8DEK7|MRAY_VIBVU RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|27360159|gb|AAO09097.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           vulnificus CMCP6]
          Length = 360

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAILSVLTALGLSLWMGPRLIKRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWA+ S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAISITILLWANLSNPYVWAVLAVLMGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALIVAFALYAYGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  S YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFSQYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|323497892|ref|ZP_08102901.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           sinaloensis DSM 21326]
 gi|323316937|gb|EGA69939.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           sinaloensis DSM 21326]
          Length = 360

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GPK+I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGISLWMGPKMIRRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ + LLW+D ++ +V  +L + + +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILTAIVTTVLLWSDLTNPYVWAVLTVLIGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T     + T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGKDT-----SATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  + YL + +V
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFADYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|77361422|ref|YP_340997.1| phospho-N-acetylmuramoyl-pentapeptide transferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|97176896|sp|Q3IG01|MRAY_PSEHT RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|76876333|emb|CAI87555.1| phospho-N-acetylmuramoyl-pentapeptide transferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 360

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 174/367 (47%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +YY   +V  Y+T R+     +A+++    GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLTQYYTGFNVFSYLTLRAILGILTALMMSLYLGPKLIRALQRMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWAD S+ +V   L +  S G+VGF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILAAIFTSTLLWADLSNKYVWATLFVIGSLGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +   + +IA++  CAL F S         +TS+V PFF+D++  +G
Sbjct: 119 KVIRKDPKGLIAKWKYFWQSVIALVVACALFFTSTQAN-----ETSLVVPFFKDVLPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    F +V T+NAVNLTDGLDGLAIVP ++ + A + IAY+ GN+  S+YL + ++
Sbjct: 174 LFYIVITYFALVGTSNAVNLTDGLDGLAIVPTILVAAALAIIAYLTGNVNFSNYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LLII+
Sbjct: 234 PLASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLVRQELLLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  + G
Sbjct: 294 GGVFVMEALSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLAG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|90413037|ref|ZP_01221035.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           profundum 3TCK]
 gi|90326052|gb|EAS42491.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           profundum 3TCK]
          Length = 360

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LAD  E  Y    + +Y+TFR+  +  +A+++    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIYWLADLLEPSYPFFRLFEYLTFRAIMSVLTALILSLWMGPRLIARLQMLQ--IGQIVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  ++LLW D S+ ++  +L + L +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILAAITITALLWTDLSNPYIWAVLAVMLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVHKNSDGLIARWKYFWQSVIALVVAFALYMHGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +   +FIA+  GN+  + YL + ++
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGMAFIAWATGNVNFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVV+ +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LL+I+
Sbjct: 234 KDASELVVLCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  +I 
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|254509140|ref|ZP_05121240.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus 16]
 gi|219547937|gb|EED24962.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus 16]
          Length = 360

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GPK+I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGISLWMGPKMIRRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ + LLW D S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAIVTTVLLWTDLSNPYVWAVLAVLIGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF++I+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGKDT-----AATQLVVPFFKEIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ S  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAAIAWATGNVQFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PQASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|115524117|ref|YP_781028.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris BisA53]
 gi|122296548|sp|Q07PT6|MRAY_RHOP5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|115518064|gb|ABJ06048.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris BisA53]
          Length = 360

 Score =  293 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 196/366 (53%), Positives = 251/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L DF+      +V +Y+TFR+  A  +  L VF FGP +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLVDFASSVPALNVFRYITFRTGGAMVTGALFVFMFGPWIIDNLRLRQGK-GQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL GL+  ++LWA+  + +V I+L +TL FG VGFYDDY+K
Sbjct: 60  DGPQSHLSKKGTPTMGGLMILSGLVVGTVLWANPLNPYVWIVLAVTLGFGFVGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SG+ R+ IE IIA  A  AL+             +S+  PF +D  + +G 
Sbjct: 120 VTKQSDKGFSGRTRLAIETIIAAAACYALMRLGRD-----PLSSSLAVPFLKDTAIYLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+ F  F++V   NAVNLTDGLDGLAIVPVMIA+ +F  ++Y+AGN + + YLQ+N+V 
Sbjct: 175 FFVIFGGFIVVGAGNAVNLTDGLDGLAIVPVMIAAASFGLVSYLAGNAVFADYLQINYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHE +L +IG
Sbjct: 235 GTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGTIAVAVKHEFVLAVIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWIIS + A+ GL
Sbjct: 295 GLFVLEAVSVIVQVASFKLTGKRVFRMAPIHHHFEQKGWTEPQIVIRFWIISVMLALAGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|86358453|ref|YP_470345.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium etli
           CFN 42]
 gi|123511375|sp|Q2K6B8|MRAY_RHIEC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|86282555|gb|ABC91618.1| phospho-N-acetylmuramoyl-pentapeptide-transferase protein
           [Rhizobium etli CFN 42]
          Length = 366

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 218/367 (59%), Positives = 282/367 (76%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + SEY+   ++ +Y+TFR+ AA F++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLIWLVELSEYFKFLNLFRYITFRTGAALFTSALIVFLFGPTIINSLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++G+SLLWAD S+++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGIVGASLLWADLSNVYVVATLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  +  S   G    +SI FPFF+D ++++G
Sbjct: 120 VTKQSHKGFSGKARLGIEFVIAGIAVYFMMRTALASGTAGSTFGSSIAFPFFKDFLINLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+ F  FVIV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN++ ++YLQ+NFV
Sbjct: 180 IMFVVFGGFVIVGAGNAVNLTDGLDGLAIVPVMIAAASFGVIAYLAGNVVFANYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI++ II
Sbjct: 240 PGTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGTIGTVAVATKHEIVMAII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWII+   A++G
Sbjct: 300 GGLFVMETLSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVGLALLG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|254462215|ref|ZP_05075631.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacterales
           bacterium HTCC2083]
 gi|206678804|gb|EDZ43291.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 187/366 (51%), Positives = 245/366 (66%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFLTALIFGFVFGKPLINVLRRRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V I L +T+S+G +GF DDY K
Sbjct: 60  DGPEGHFLKAGTPTMGGLLIVGALLTSTLLWARLDNPFVLICLFVTMSYGAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+SGK+R+L+ F IA +A      Y          +  +  P F+D ++++G 
Sbjct: 120 VSRQTTAGVSGKIRLLLGFAIAAIAGFWAAQYHPEG-----LQNQLALPIFKDTLINLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPF   VIV  AN+VNLTDGLDGLAI+PVMIAS     IAY  G +  + YL V++VP
Sbjct: 175 LFIPFCVIVIVGAANSVNLTDGLDGLAIMPVMIASGTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + + G G+GFLW+N  PA +FMGDTGSLALG  +G IAVSTKHE++L I+G
Sbjct: 235 GTGEILIFTAGIFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVSTKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|239994438|ref|ZP_04714962.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alteromonas
           macleodii ATCC 27126]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LAD+   +    +V  Y+T R+  +  +A+LI    GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLIWLADWLTQFDSGFNVFSYLTLRAILSTLTALLIAILIGPKMIRYLQRMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S LLWAD ++ +V + L + +++G++GF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILAAIVVSGLLWADLTNRYVLVTLTVVVAYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +   + ++A+     L      +   I  +TS++ PFF+++   +G
Sbjct: 119 KVIRKDSKGLIARWKYFWQSVVALGVAFYLY-----SSATISAETSLLVPFFKEVFPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI    F IV T+NAVNLTDGLDGLAIVP ++ + AF+  AYV GN   + YL +  +
Sbjct: 174 AFFIIITYFAIVGTSNAVNLTDGLDGLAIVPTILVAGAFAIFAYVTGNANFAEYLNIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G +AV  + E++LII+
Sbjct: 234 PLTSELVIVCTAMVGAGLGFLWFNTYPAQVFMGDVGSLALGGTLGVLAVLVRQELVLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS I  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|188532899|ref|YP_001906696.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           tasmaniensis Et1/99]
 gi|259907414|ref|YP_002647770.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           pyrifoliae Ep1/96]
 gi|229621762|sp|B2VD87|MRAY_ERWT9 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|188027941|emb|CAO95798.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           tasmaniensis Et1/99]
 gi|224963036|emb|CAX54519.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           pyrifoliae Ep1/96]
 gi|283477247|emb|CAY73158.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Erwinia
           pyrifoliae DSM 12163]
 gi|310765085|gb|ADP10035.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Erwinia sp.
           Ejp617]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVTFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQEM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITVSVLLWAYPSNPYVWCVLFVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   +  IA++    +      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSAIALVVAFVMYMIGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYLLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|260775369|ref|ZP_05884266.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608550|gb|EEX34715.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGISLWMGPRMIRRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ + LLW D S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILTAIVTTVLLWTDLSNPYVWAVLAVLIGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T     + T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGKDT-----SATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + +V
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFANYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|119383340|ref|YP_914396.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Paracoccus
           denitrificans PD1222]
 gi|166221339|sp|A1AZK6|MRAY_PARDP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|119373107|gb|ABL68700.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Paracoccus
           denitrificans PD1222]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 201/366 (54%), Positives = 254/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L + S+     ++ +Y+TFR+  AFF+A+L  F FG  +ID LR  Q  +GQP+R 
Sbjct: 1   MLYWLTNLSDGGDFFNLFRYITFRAGGAFFTALLFGFFFGRPLIDLLRRKQ-KKGQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L   +LLWA   + +V I+LL+TL F  +GF DDY K
Sbjct: 60  DGPENHFSKAGTPTMGGLLILAALTIGTLLWARLDNGYVWIVLLVTLGFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     GLSGKVR+LI      L + A    + + L        +  PFF+D ++++GL
Sbjct: 120 VTKQHHAGLSGKVRLLI-----GLCIAAAAGAAAAWLHPAALSGELALPFFKDALINLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            ++PF   VI+  ANAVNLTDGLDGLAI+PVMIA+ +FS IAY+ GN   ++YL V+FVP
Sbjct: 175 LYVPFTVLVILGAANAVNLTDGLDGLAIMPVMIAAASFSVIAYMVGNANFANYLGVHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V ++ALIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHEI+L I+G
Sbjct: 235 GTGELAVFVAALIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHHFEKKGW E QIVIRFWII+ I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHFEKKGWGEAQIVIRFWIIALILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|50122740|ref|YP_051907.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           atrosepticum SCRI1043]
 gi|227113989|ref|ZP_03827645.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|227327094|ref|ZP_03831118.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
 gi|61214085|sp|Q6D0I0|MRAY_ERWCT RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|49613266|emb|CAG76717.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           atrosepticum SCRI1043]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+  ++ Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLAKLYTGFNVFSYLTFRAIVSLLTALVISLWMGPHMIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +I S L+WA+ S+ +V  +LL+   +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILVAIIVSVLMWANLSNPYVWCVLLVLAGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++    +      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALVVAFTMYSIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVALAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFAGYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|253689956|ref|YP_003019146.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|259509638|sp|C6DEU6|MRAY_PECCP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|251756534|gb|ACT14610.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 360

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+  ++ Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLAKLYTGFNVFSYLTFRAIVSLLTALVISLWMGPHMIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +I S L+WA+ S+ +V  +LL+   +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILVAIIVSVLMWANLSNPYVWCVLLVLAGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++   ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALVVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVALAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFAGYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|149186205|ref|ZP_01864519.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erythrobacter
           sp. SD-21]
 gi|148830236|gb|EDL48673.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erythrobacter
           sp. SD-21]
          Length = 356

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 174/366 (47%), Positives = 244/366 (66%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA++  +  + ++++Y T R+ A   +A++I    GP+ ID LR  Q   GQP+R 
Sbjct: 1   MLYLLAEYFNFEGLFNLVRYQTARAGATLLTALIIGLFIGPRFIDMLRVRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K+ TPTMGG++IL+ L  S +LW D S+  +   L +T  FGL+GF DDY K
Sbjct: 60  DGPQTHLAKVGTPTMGGLMILVSLFISLMLWMDLSNPFIWACLAVTGGFGLIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+SGKVR+L+EF +A +A   ++          +  T +  PF  D  +++G 
Sbjct: 120 VSKASHKGVSGKVRLLLEFAVAGIASYLIV---------SQINTFVYVPFVNDFGIELGP 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            +  FAA VIV   NAVNLTDGLDGLA +PV+IA+  F+ IAY+ G +  S YL + +V 
Sbjct: 171 LYYVFAATVIVGAGNAVNLTDGLDGLATMPVIIAAGTFAVIAYLVGRVDYSEYLGIPYVE 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  +A++GAG+ FLWFN  PA +FMGDTGSLALG  +G IAV+T HEI+L I+G
Sbjct: 231 GAGELAIFCAAIMGAGLAFLWFNAPPAAVFMGDTGSLALGGALGAIAVATHHEIVLAIVG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E LSVI+QV +FK T +RVF MAPIHHHFE+ GW+E+++VIRFWI++ + A++GL
Sbjct: 291 GLFVFEALSVIIQVFWFKRTGRRVFRMAPIHHHFEQLGWSESKVVIRFWIVAIVLALLGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 ATLKLR 356


>gi|320540408|ref|ZP_08040058.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Serratia
           symbiotica str. Tucson]
 gi|320029339|gb|EFW11368.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Serratia
           symbiotica str. Tucson]
          Length = 360

 Score =  293 bits (749), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +YY   +V  Y+TFR+  +  +A+ +    GP+VI  L+ +    GQ VR
Sbjct: 1   MLVWLAEYLVKYYSGFNVFSYLTFRAIVSLLTALFLSLWMGPRVITHLQKM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S L+WA  S+ +V  +LL+ + +G+VGF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGTMILTSITISVLMWAYPSNPYVWCVLLVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++    +      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLVARWKYFWQSVIALVVAFTMYAVGKGT-----PATELVVPFFKDIVPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +RVF MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVIETLSVILQVGSFKLRGQRVFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|190892586|ref|YP_001979128.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium etli
           CIAT 652]
 gi|229621800|sp|B3PTW3|MRAY_RHIE6 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|190697865|gb|ACE91950.1| phospho-N-acetylmuramoyl-pentapeptide-transferase protein
           [Rhizobium etli CIAT 652]
 gi|327194625|gb|EGE61475.1| phospho-N-acetylmuramoyl-pentapeptide-transferase protein
           [Rhizobium etli CNPAF512]
          Length = 366

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 219/367 (59%), Positives = 282/367 (76%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + SEY+   ++ +Y+TFR+ AA F++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLIWLVELSEYFKFLNLFRYITFRTGAALFTSALIVFLFGPTIINSLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++G+SLLWAD S+++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGIVGASLLWADLSNVYVVATLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEFIIA +AV  ++  +  S   G    +SI FPFF+D ++++G
Sbjct: 120 VTKQSHKGFSGKARLGIEFIIAGIAVYFMMRTALASGTAGSTFGSSIAFPFFKDFLINLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+ F  FVIV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN++ ++YLQ+NFV
Sbjct: 180 IMFVVFGGFVIVGAGNAVNLTDGLDGLAIVPVMIAAASFGVIAYLAGNVVFANYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI++ II
Sbjct: 240 PGTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGTIGTVAVATKHEIVMAII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWII+   A++G
Sbjct: 300 GGLFVMETLSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVGLALLG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|261823019|ref|YP_003261125.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           wasabiae WPP163]
 gi|261607032|gb|ACX89518.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pectobacterium
           wasabiae WPP163]
          Length = 360

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+  ++ Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLAKLYTGFNVFSYLTFRAIVSLLTALVISLWMGPHMIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +I S L+WA+ S+ +V  +LL+   +G VGF DDY 
Sbjct: 59  SEGPESHFSKRGTPTMGGVMILVAIIVSVLMWANLSNPYVWCVLLVLAGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++    +      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALVVAFTMYSIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVALAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFAGYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|157369003|ref|YP_001476992.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Serratia
           proteamaculans 568]
 gi|167011849|sp|A8G9S4|MRAY_SERP5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|157320767|gb|ABV39864.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Serratia
           proteamaculans 568]
          Length = 360

 Score =  293 bits (749), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ +    GP+VI  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFLSLWMGPRVIKRLQEM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITVSVLMWAYPSNPYVWCVLFVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++   A+      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALVVAFAMYAVGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|46201831|ref|ZP_00054274.2| COG0472: UDP-N-acetylmuramyl pentapeptide
           phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
           transferase [Magnetospirillum magnetotacticum MS-1]
          Length = 362

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 181/368 (49%), Positives = 256/368 (69%), Gaps = 8/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   ++   + ++ KY+TFR+  A  +A+++ F  GP++I  LR  Q  +GQP+R
Sbjct: 1   MLYNLLYPLADQIPVFNLFKYLTFRTGGAVLTALIVAFLVGPRIIAWLRQWQ-KQGQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG +IL+ L  S+LLWAD  + +V I+LL+TL +GL+GF+DDY
Sbjct: 60  ADGPESHLLTKKGTPTMGGFMILLALGISTLLWADLRNQYVWIVLLVTLGYGLIGFWDDY 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K++  +  G+ GK +++ E  I + A   ++     +L       ++  PFF+ ++L +
Sbjct: 120 LKVSKKNPKGVPGKAKLVAEIAIGLAAAAWVM-----SLQREPLAGALAVPFFKTVLLQL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
             F++PFA F+IV   NAVNLTDGLDGLAIVPVMIAS  F+  +Y+ G+ + ++YLQ+++
Sbjct: 175 SWFYLPFAVFIIVGAGNAVNLTDGLDGLAIVPVMIASAVFAIFSYLVGHAVFANYLQIHY 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           V G GEL V   AL+GAG+GFLWFN  PA++FMGDTGSLALG  +G ++V TKHE++L I
Sbjct: 235 VSGSGELAVFCGALVGAGLGFLWFNAPPAMVFMGDTGSLALGGALGAVSVVTKHELVLGI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+ET+SVI+QV  FK+T KRVF MAP+HHHFEKKGW E  +VIRFWII+ I A+ 
Sbjct: 295 VGGLFVLETVSVIVQVASFKLTGKRVFRMAPLHHHFEKKGWAEPTVVIRFWIIATILALA 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLSTLKLR 362


>gi|323491032|ref|ZP_08096224.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           brasiliensis LMG 20546]
 gi|323314696|gb|EGA67768.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           brasiliensis LMG 20546]
          Length = 360

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGISLWMGPIMIRRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ + LLW D S+ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILTAIVTTVLLWTDLSNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF++I+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGKDT-----AATQLVVPFFKEIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ S  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PQASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|292489360|ref|YP_003532247.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Erwinia amylovora
           CFBP1430]
 gi|292898416|ref|YP_003537785.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           amylovora ATCC 49946]
 gi|291198264|emb|CBJ45370.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           amylovora ATCC 49946]
 gi|291554794|emb|CBA22620.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Erwinia amylovora
           CFBP1430]
 gi|312173525|emb|CBX81779.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Erwinia amylovora
           ATCC BAA-2158]
          Length = 360

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVTFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQEM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITVSVLLWAYPSNPYVWCVLFVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   +  IA++   A+      T       T +V PF +D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSAIALVVAFAMYMIGKGT-----PATELVVPFLKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYLLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|288576011|ref|ZP_05977995.2| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria mucosa
           ATCC 25996]
 gi|288566544|gb|EFC88104.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria mucosa
           ATCC 25996]
          Length = 414

 Score =  292 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 159/366 (43%), Positives = 235/366 (64%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    +V +Y TFR+  A  +A+      GP  I  L   Q   GQ VR 
Sbjct: 55  MFLWLAHFSNWLSGLNVFQYTTFRAVMAALTALAFSLLLGPWTIRKLT--QLKVGQAVRT 112

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S++LW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 113 DGPQTHLIKNGTPTMGGSLILTAITVSTILWGNWANPYIWILLGVLLATGALGFYDDWRK 172

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + ++++   I     IV  F +  +    +
Sbjct: 173 VVYKDPNGVSAKFKMVWQSSVAIIAALALFYLASNSSNNIL----IVPFFKQVALPLGVV 228

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+      IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 229 GFVVLTYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 288

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 289 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 348

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 349 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 408

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 409 STLKIR 414


>gi|288958920|ref|YP_003449261.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Azospirillum
           sp. B510]
 gi|288911228|dbj|BAI72717.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Azospirillum
           sp. B510]
          Length = 361

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 177/367 (48%), Positives = 257/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   ++ +   ++ +Y+TFR+  A  ++++I F F P++I  L+  Q   GQP+R
Sbjct: 1   MLYNLLFGLADIFSPFNLFRYLTFRTGGAVITSLIISFVFFPRLIAWLKHKQ-GEGQPIR 59

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL+ +  S++LWAD ++ ++ I+LL+T+ +GL+GF DDY+
Sbjct: 60  ADGPESHFKKKGTPTMGGLMILIAMTVSTILWADVTNAYIWIVLLVTIGYGLIGFGDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  GLSG+ R+  E  I + A   +++ S            +  PF +D ++ + 
Sbjct: 120 KLTKRNTKGLSGRFRLGWEIAIGLTASALIMWVSAP-----PLSGGVAVPFVKDFLIQLS 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+PF AF++V  +N+VNLTDGLDGLAIVP MIA+  F  I+Y++GN + ++YLQ++ V
Sbjct: 175 WFFVPFGAFIMVGASNSVNLTDGLDGLAIVPTMIAAGCFGLISYLSGNAIFANYLQIHHV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V   AL+GAG+GFLW+N  PA++FMGDTGSL+LG  +G ++V TKHEI+L II
Sbjct: 235 PGSGELAVFCGALVGAGLGFLWYNAPPAMVFMGDTGSLSLGGALGAVSVVTKHEIVLAII 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ET+SVI+QV  FK+T KRVF MAP+HHHFEKKGW E  +VIRFWII+ I A++G
Sbjct: 295 GGLFVLETVSVIVQVASFKLTGKRVFRMAPLHHHFEKKGWAEPTVVIRFWIIASILALVG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|254487802|ref|ZP_05101007.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           GAI101]
 gi|214044671|gb|EEB85309.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           GAI101]
          Length = 360

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 187/366 (51%), Positives = 249/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I  LR  Q   GQP+R 
Sbjct: 1   MLYWLTLLSDGGDFFNLFRYITFRAGGAFLTALVFGFLFGKPLIAVLRRRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V ++L +T+SF  +GF DDY K
Sbjct: 60  DGPEGHFIKAGTPTMGGLLIVGALLTSTLLWARLDNPFVWMVLFVTMSFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++   + G+SGKVR+L+ F IA ++      Y        E +  +  P F+D ++++G 
Sbjct: 120 VSKQTSAGVSGKVRLLLGFAIAGISAYWAAQY-----HPAELQNQLALPVFKDTLINLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPF+  VIV +ANAVNLTDGLDGLAI+PVMIA+ A   IAY  G +  + YL V++VP
Sbjct: 175 LFIPFSIIVIVGSANAVNLTDGLDGLAIMPVMIAAGALGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + + G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFTAGIFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|254500477|ref|ZP_05112628.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Labrenzia
           alexandrii DFL-11]
 gi|222436548|gb|EEE43227.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Labrenzia
           alexandrii DFL-11]
          Length = 360

 Score =  292 bits (747), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 202/366 (55%), Positives = 262/366 (71%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L  F++     +V +Y+TFR+  A  +A+  VF FGPK+I  LR  Q   GQP+R 
Sbjct: 1   MFYFLGQFADQISALNVFRYITFRTGGAIMTALFFVFLFGPKIIASLRIRQGH-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL G + ++LLWAD S+ +V +++ +T+ FG++GFYDDY+K
Sbjct: 60  DGPESHLSKKGTPTMGGLMILSGALVAALLWADLSNPYVWVVIGVTVGFGMIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G  GK R+ +EF+IA  A   +     ++  G      + FPFF+D  L++GL
Sbjct: 120 VTKSSHKGFGGKARLGLEFLIAATAAFTVTVLDTTSFSGA-----LTFPFFKDFTLNLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPFAAFV+V   NAVNLTDGLDGLAIVPVMIA  +F  IAY++GN + ++YLQ++ V 
Sbjct: 175 IFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMIACASFGLIAYLSGNAVFANYLQIHHVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V+  A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+TKHEI+L IIG
Sbjct: 235 GTGELAVICGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMIGAIAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE +GWTE+Q+VIRFWIIS + A+IGL
Sbjct: 295 GLFVLEAVSVIVQVMSFKLTGKRVFRMAPIHHHFEIQGWTESQVVIRFWIISVVLALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|332305222|ref|YP_004433073.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332172551|gb|AEE21805.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 360

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYII-THVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD+ + +     V  Y+T R+  +  +A+LI    GP++I  L+++Q   GQ VR
Sbjct: 1   MLMLLADWLQQFEPSFRVFSYLTLRAILSTLTALLIAVLIGPRMIRWLQTMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S LLWAD ++ +V + L + + +G++GF DDY 
Sbjct: 59  DDGPQSHLAKSGTPTMGGLLILAAIVISVLLWADLTNRYVWVTLSVVVGYGIIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IAI     L             +T+++ PFF+D++  MG
Sbjct: 119 KVVRKDPKGLIARWKYFWQSVIAIGVALYLYASQQD-----PAETALLVPFFKDVMPQMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI    FVIV T+NAVNLTDGLDGLAIVP ++ + AF+  AY  GNI  S YL + ++
Sbjct: 174 LLFILMTYFVIVGTSNAVNLTDGLDGLAIVPTVLVAGAFAIFAYTTGNINFSAYLNIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA++FMGD GSLALG  +G IAV  + EI+L+I+
Sbjct: 234 PLTSELVIVCTAIVGAGLGFLWFNTYPAMVFMGDVGSLALGGTLGVIAVLVRQEIVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS I  ++G
Sbjct: 294 GGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|310814907|ref|YP_003962871.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Ketogulonicigenium vulgare Y25]
 gi|308753642|gb|ADO41571.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Ketogulonicigenium vulgare Y25]
          Length = 360

 Score =  292 bits (747), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 190/366 (51%), Positives = 257/366 (70%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AFF+A+LI F FG  +I+ LR +Q   GQP+R 
Sbjct: 1   MLYWLTALSDGSGPFNLFRYITFRAGGAFFTALLIGFIFGRPLINHLRRVQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+ G++ ++LLWA + +  + ++L +TL +  +GF DDY K
Sbjct: 60  DGPAGHFVKAGTPTMGGLLIIGGVVAATLLWARWDNAFIWVVLFVTLGYAAIGFVDDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     GLSG+VR+L+ F+IA +A     +Y    +        +  PFF+ ++L++G+
Sbjct: 120 VSKQTTAGLSGRVRLLLGFLIAAIAGFWASYYQPDAM-----ANHLAVPFFKSLLLNLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPFAA VIV  ANAVNLTDGLDGLAI+PVMIA+  F  IAY  G    S YL V++VP
Sbjct: 175 LFIPFAAIVIVGAANAVNLTDGLDGLAIMPVMIAAGTFGIIAYFVGRADFSTYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+VV  +ALIGAG+GFLW+N  PA +FMGDTGSLALG  +G IA+  KHE++L ++G
Sbjct: 235 GSAEIVVFCAALIGAGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAIVVKHELVLAVVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SVI+QV YFK T KR+FLMAPIHHHFEKKGW+E+QIVIRFWII+ + A+IGL
Sbjct: 295 GLFVVEAMSVIIQVLYFKRTGKRIFLMAPIHHHFEKKGWSESQIVIRFWIIALVLALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|83942756|ref|ZP_00955217.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sulfitobacter
           sp. EE-36]
 gi|83953995|ref|ZP_00962716.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sulfitobacter
           sp. NAS-14.1]
 gi|83841940|gb|EAP81109.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sulfitobacter
           sp. NAS-14.1]
 gi|83846849|gb|EAP84725.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sulfitobacter
           sp. EE-36]
          Length = 360

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 184/366 (50%), Positives = 247/366 (67%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I  LR  Q   GQP+R 
Sbjct: 1   MLYWLTLLSDGGDFFNLFRYITFRAGGAFLTALVFGFLFGKPLIAVLRKRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V ++LL+T++F  +GF DDY K
Sbjct: 60  DGPEGHFVKAGTPTMGGLLIVGALLTSTLLWARLDNPFVWMVLLVTMAFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+S ++R+L+ FIIA  A      +        E +  +  P F++ ++++G 
Sbjct: 120 VSKQTTAGVSSRMRLLLGFIIAGSAAYWAAQF-----HPAELQNQLALPVFKNTLINLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PF+  VIV  ANAVNLTDGLDGLAI+PVMIA+ A   IAY  G +  + YL V++VP
Sbjct: 175 LFVPFSIIVIVGAANAVNLTDGLDGLAIMPVMIAAGALGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE++V  + + G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILVFTAGIFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|332142427|ref|YP_004428165.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|229621234|sp|B4RWY2|MRAY_ALTMD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|327552449|gb|AEA99167.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 360

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LAD+   +    +V  Y+T R+  +  +A+LI    GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLIWLADWLTQFDSGFNVFSYLTLRAILSTLTALLIAILIGPKMIRYLQRMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S LLWAD ++ +V + L + +++G++GF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILAAIVVSGLLWADLTNRYVLVTLTVVVAYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +   + ++A+     L      +   +  +TS++ PFF+++   +G
Sbjct: 119 KVIRKDSKGLIARWKYFWQSVVALGVAFYLY-----SSATMSAETSLLVPFFKEVFPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI    F IV T+NAVNLTDGLDGLAIVP ++ + AF+  AYV GN   + YL +  +
Sbjct: 174 IFFIIITYFAIVGTSNAVNLTDGLDGLAIVPTILVAGAFAIFAYVTGNANFAEYLNIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G +AV  + E++LII+
Sbjct: 234 PLTSELVIVCTAMVGAGLGFLWFNTYPAQVFMGDVGSLALGGTLGVLAVLVRQELVLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS I  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|148980585|ref|ZP_01816132.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrionales
           bacterium SWAT-3]
 gi|145961168|gb|EDK26484.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrionales
           bacterium SWAT-3]
          Length = 360

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + ++    + +Y++FR+ A+  +A+ +    GP++I+ L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPHFSFFRLFEYLSFRAIASILTALCLSLWMGPRLIERLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I + LLWAD S+ +V  +L++   +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGVMILAAIIITVLLWADLSNPYVWAVLVVLGGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  + YL + ++
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAAGFAVIAWATGNVNFAAYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PYTSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|293392862|ref|ZP_06637180.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Serratia
           odorifera DSM 4582]
 gi|291424721|gb|EFE97932.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Serratia
           odorifera DSM 4582]
          Length = 360

 Score =  292 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAHLQKM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITVSVLMWAYPSNPYVWCVLFVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++   A+      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALIVAFAMYAVGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|261253810|ref|ZP_05946383.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           orientalis CIP 102891]
 gi|260937201|gb|EEX93190.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           orientalis CIP 102891]
          Length = 360

 Score =  292 bits (746), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGISLWMGPIMIRRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ + LLW D S+ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILTAIVTTVLLWTDLSNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSSIALVVAFALYAHGKDT-----AATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ S  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAAIAWATGNVQFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PQASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|260576885|ref|ZP_05844868.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter sp.
           SW2]
 gi|259020922|gb|EEW24235.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter sp.
           SW2]
          Length = 360

 Score =  292 bits (746), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 198/366 (54%), Positives = 255/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L  FS+     ++ +Y+TFR+ AAF ++++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MFYWLTAFSDGGDFFNLFRYITFRAGAAFATSLIFGFIFGLPLINLLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L+ S+LLWA   + +V I+LL+TL+FGL+GF DDY K
Sbjct: 60  DGPASHFAKAGTPTMGGLLILSALLFSTLLWARLDNPYVWIVLLVTLAFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T  +  G+SG++R+L+      L +  L  Y+ S+         +  PFF+D ++++G+
Sbjct: 120 VTKQNTKGVSGRIRMLL-----GLLIAGLAAYAASSFHPEGLTNQLALPFFKDALINLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PF   VIV  ANAVNLTDGLDGLAI+PVMIA+     IAYV GN   + YL V +VP
Sbjct: 175 LFVPFGMIVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGAIAYVVGNFNFTEYLGVYYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL+V  +AL G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHEI+L I+G
Sbjct: 235 GTGELLVFCAALFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVCTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SVI+QV YFK T KRVFLMAPIHHHFEKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEAMSVIIQVLYFKKTGKRVFLMAPIHHHFEKKGWAEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|144897229|emb|CAM74093.1| Glycosyl transferase, family 4 [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 362

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 179/367 (48%), Positives = 256/367 (69%), Gaps = 8/367 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   ++   + ++ KY+TFR+  A  +A+++ F  GP +I  LR  Q  +GQP+R
Sbjct: 1   MLYNLLYPLADEVALFNLFKYLTFRTGGAVLTALVVAFVIGPGLIRWLRQWQ-KQGQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG +IL+ L  ++LLWAD  S +V I+L++TL +GL+GF DD+
Sbjct: 60  ADGPESHLLTKKGTPTMGGFLILIALAVATLLWADLRSHYVWIVLMVTLGYGLLGFLDDF 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K++  +  GL GK+++  +  IA++A   +               ++  PF + +++ +
Sbjct: 120 LKVSKKNPKGLPGKLKLAGQIAIALIAALWVYAIQRE-----PLAGTLAVPFLKSLLIQL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G FF+PFA FVI+  +NAVNLTDGLDGLAIVPVMIA+  F+ I+Y+ G+ + ++YLQ+++
Sbjct: 175 GWFFVPFAVFVIIGASNAVNLTDGLDGLAIVPVMIAAGVFALISYLVGHAVFANYLQIHY 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V   AL+GAG+GFLWFN  PA++FMGDTGSL+LG  +G I+V TKHE++L I
Sbjct: 235 VPGSGELAVFCGALVGAGLGFLWFNAPPAMVFMGDTGSLSLGGALGAISVVTKHELVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+ET+SVI+QV  FK+T KRVF MAP+HHHFEKKGW E  +VIRFWII+ I A++
Sbjct: 295 VGGLFVLETVSVIVQVASFKLTGKRVFRMAPLHHHFEKKGWAEPTVVIRFWIIAGILALV 354

Query: 359 GLLTLKM 365
           GL TLK+
Sbjct: 355 GLSTLKL 361


>gi|254702155|ref|ZP_05163983.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 5 str. 513]
 gi|261752725|ref|ZP_05996434.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 5 str. 513]
 gi|261742478|gb|EEY30404.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 5 str. 513]
          Length = 360

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 204/366 (55%), Positives = 276/366 (75%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR+ Q   GQP+R 
Sbjct: 1   MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRARQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++L++++ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA +A   ++             +S+ FPF + +++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQE-----PFSSSLTFPFVKQLVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|119469211|ref|ZP_01612195.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Alteromonadales
           bacterium TW-7]
 gi|119447463|gb|EAW28731.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Alteromonadales
           bacterium TW-7]
          Length = 360

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 173/367 (47%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   +V  Y+T R+     +A+++    GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLTQYFSGFNVFSYLTLRAILGILTALIMSLYLGPKLIRGLQKMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWAD S+ +V   L +  S G+VGF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILAAIFTSTLLWADLSNKYVWATLFVIGSLGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +   + +IA++   AL F S         +TS+V PFF+D++  +G
Sbjct: 119 KVIRKDPKGLIAKWKYFWQSVIALVVATALYFTSTQA-----AETSLVVPFFKDVLPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    F +V T+NAVNLTDGLDGLAIVP ++ + A + IAY+ GNI  S YL +  +
Sbjct: 174 LFYIVITYFALVGTSNAVNLTDGLDGLAIVPTILVAAALAIIAYLTGNINFSAYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LLII+
Sbjct: 234 PLASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLVRQELLLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  + G
Sbjct: 294 GGVFVMEALSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLAG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|253699154|ref|YP_003020343.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter sp.
           M21]
 gi|259494704|sp|C6DZK3|MRAY_GEOSM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|251774004|gb|ACT16585.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter sp.
           M21]
          Length = 358

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 236/367 (64%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y + +V KY+TFRS  A  +A+L+ F  GP V+  L +LQ    Q +R
Sbjct: 1   MLYHLLYPLAADYKLFNVFKYLTFRSIYAMITALLLAFIVGPWVVRKLEALQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL+ ++  +LLWAD  ++ + + LL+ + +G++GF DDY 
Sbjct: 59  TDGPESHLKKQGTPTMGGVLILVCIVVPTLLWADLKNVFIWLTLLIIVGYGVLGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++A      L +            T +  PFF+ +  ++G
Sbjct: 119 KVVEKNPKGLSPRQKMFWQVLLAAGVGIFLFYLPG-------FSTELYLPFFKRVHPELG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FIPF   VIV  +NAVNLTDGLDGLAI PV I +  +    Y+AGN  LS YLQ+ +V
Sbjct: 172 ILFIPFVTLVIVGASNAVNLTDGLDGLAIGPVAINAGTYLLFCYIAGNARLSGYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAG+GFLW+N  PA +FMGD GSL+LG  +G +AV TK EILL+I+
Sbjct: 232 PGAGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGALGTLAVLTKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGVFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|329895276|ref|ZP_08270918.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium IMCC3088]
 gi|328922398|gb|EGG29741.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium IMCC3088]
          Length = 360

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 232/367 (63%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L+++   +     V  Y+T RS  A  +A+ I    GP  I  L  L+   GQ VR
Sbjct: 1   MLVWLSEYLSQFDTSFRVFGYLTLRSILAAGTALAIALITGPATIRYLHRLK--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S+LLW D  + +V + LL+TL FG+VG+ DDY 
Sbjct: 59  DDGPQTHLVKAGTPTMGGILILSSVALSTLLWGDLENQYVWVTLLVTLGFGIVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +   + ++ + A   L  +S     G++  T +  PF +D I+ +G
Sbjct: 119 KVVERDSRGLPARWKYFWQSVLGLAAAYYLYAFS-----GLDAMTELYVPFLKDWIVPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F I    FVIV  +NAVNLTDGLDGLAI+P ++   A   IAY+ G +  + YL + +V
Sbjct: 174 WFSIVLTYFVIVGGSNAVNLTDGLDGLAILPSVMVGSALGIIAYLTGRVDFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V   A+ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV T+HEI+  I+
Sbjct: 234 PGSGELAVFCGAVAGAGLGFLWFNTYPAQVFMGDVGALALGAALGCVAVITRHEIVFFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T KRVF MAPIHHH+E KGW E ++++RFWII+ +  + G
Sbjct: 294 GGIFVLETVSVIIQVASFKLTGKRVFRMAPIHHHYELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|270263956|ref|ZP_06192224.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Serratia
           odorifera 4Rx13]
 gi|270042149|gb|EFA15245.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Serratia
           odorifera 4Rx13]
          Length = 360

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ +    GP+VI  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFLSLWMGPRVIKRLQEM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITISVLMWAYPSNPYVWGVLFVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++   A+      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALIFAFAMYAVGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FV+V T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LLYVLLAYFVVVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|300722056|ref|YP_003711336.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Xenorhabdus
           nematophila ATCC 19061]
 gi|297628553|emb|CBJ89125.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Xenorhabdus
           nematophila ATCC 19061]
          Length = 360

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   +V  Y+TFR+     +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVQYHTGFNVFSYLTFRAIVGLLTALFIALWMGPTLIAYLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLWA  ++ +V  +L++ + +G+VGF DDY 
Sbjct: 59  DNGPESHFSKRGTPTMGGLLILFSITISILLWARLNNPYVWCVLVVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A+    A+      T       T +V PFF++++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALGVAFAMYSIGKET-----AATQLVVPFFKEVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 SYAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|238918675|ref|YP_002932189.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Edwardsiella
           ictaluri 93-146]
 gi|259496172|sp|C5B9F3|MRAY_EDWI9 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|238868243|gb|ACR67954.1| phospho-N-acetylmuramoyl-pentapeptide-transferase, putative
           [Edwardsiella ictaluri 93-146]
          Length = 360

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +Y+   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVKYFSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIGWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + L +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLLGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA++    +      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSVIALVVAFTMYCIGKDT-----PATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  + FVIV T+NAVNLTDGLDGLAI+P +  +     +A+  GN+  + YL + ++
Sbjct: 174 LLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGMGLVAWATGNVNFAAYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|315125600|ref|YP_004067603.1| phospho-N-acetylmuramoyl-pentapeptide transferase
           [Pseudoalteromonas sp. SM9913]
 gi|315014113|gb|ADT67451.1| phospho-N-acetylmuramoyl-pentapeptide transferase
           [Pseudoalteromonas sp. SM9913]
          Length = 360

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 175/367 (47%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +YY   +V  Y+T R+     +A+++   FGPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLTQYYSGFNVFSYLTLRAILGILTALMMSLYFGPKLIRALQRMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWAD S+ +V   L +  S G+VGF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILGAIFTSTLLWADLSNKYVWATLFVIGSLGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +   + +IA++   AL   S        T+TS+V PFF+D++  +G
Sbjct: 119 KVIRKDPKGLIAKWKYFWQSVIALVVATALYMSSTQA-----TETSLVVPFFKDVLPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    F +V T+NAVNLTDGLDGLAIVP ++ + A + IAY+ GNI  S YL +  +
Sbjct: 174 LFYIVITYFALVGTSNAVNLTDGLDGLAIVPTILVAAALAIIAYLTGNINFSAYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LLII+
Sbjct: 234 PLASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLVRQELLLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  + G
Sbjct: 294 GGVFVMEALSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLAG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|94501899|ref|ZP_01308409.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanobacter sp.
           RED65]
 gi|94425952|gb|EAT10950.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanobacter sp.
           RED65]
          Length = 360

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F + +     V+ Y++ R+  A  +A++I    GP VI  L+  Q   GQ VR
Sbjct: 1   MLLWLAEFLQQFHSGFAVVNYLSLRAILATLTALIIGLWAGPYVIRKLQEKQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+G+  S+LLW D ++ +V I+LL+T+S GLVGF DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGTLILLGIAVSTLLWGDLTNHYVWIVLLVTMSTGLVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + ++  + IIA++A   L   + +       +T+++ PFF+DII+D+G
Sbjct: 119 KVVQKNSRGLPARWKMFWQSIIALVAGIFLYASAAT-----PAETTLIVPFFKDIIIDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I    FVIV T+NAVNLTDGLDGLAI+P ++   A    AY+ GN+  + YL + ++
Sbjct: 174 WFYIVLTYFVIVGTSNAVNLTDGLDGLAILPTVMVGAALGACAYLVGNVNFADYLFLPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GE+ +  +AL+GAGIGFLWFN  PA +FMGD GSLALGA +G +AV  + EILL I+
Sbjct: 234 EGAGEVAIFCAALVGAGIGFLWFNTYPAQVFMGDVGSLALGAALGVMAVIVRQEILLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV ET+SVI+QV  FK+T KR+F MAP+HHHFE KGW E ++++RFWII+    ++G
Sbjct: 294 GGIFVAETVSVILQVASFKLTGKRIFRMAPLHHHFELKGWPEPRVIVRFWIITLFLVLLG 353

Query: 360 LLTLKMR 366
           + TLK+R
Sbjct: 354 MATLKIR 360


>gi|315181133|gb|ADT88047.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio furnissii
           NCTC 11218]
          Length = 360

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGLSLWMGPRLIKRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +I + LLW D S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILASIIVTVLLWTDLSNPYVWAVLAVLMGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  + + T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGHDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F  IA+  GN+  ++YL + ++
Sbjct: 174 LFYIILTYFVIVGTSNAVNLTDGLDGLAILPTVLVAAGFGVIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PYTSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|253988591|ref|YP_003039947.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253780041|emb|CAQ83202.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photorhabdus
           asymbiotica]
          Length = 360

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKYHTGFNVFSYLTFRAIVSLLTALAIALWMGPRMIVFLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLWA  ++ +V  +L++ + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILFSITISVLLWARLNNPYVWCVLIVLIGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + I+A+    A+      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSILALGVAFAMYSVGKGT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  + FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 VLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 SHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|260767160|ref|ZP_05876103.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio furnissii
           CIP 102972]
 gi|260617834|gb|EEX43010.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio furnissii
           CIP 102972]
          Length = 360

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGLSLWMGPRLIKRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +I + LLW D S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILAAIIVTVLLWTDLSNPYVWAVLAVLMGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  + + T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGHDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F  IA+  GN+  ++YL + ++
Sbjct: 174 LFYIILTYFVIVGTSNAVNLTDGLDGLAILPTVLVAAGFGVIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PYTSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|222149139|ref|YP_002550096.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Agrobacterium
           vitis S4]
 gi|254813213|sp|B9JY57|MRAY_AGRVS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|221736124|gb|ACM37087.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Agrobacterium
           vitis S4]
          Length = 366

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 220/367 (59%), Positives = 279/367 (76%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + + +    ++ +Y+TFR+ AA F+A LIVF FGPK+I  L+  Q   GQP+R 
Sbjct: 1   MLIWLVELANHVQFFNLFRYITFRTGAAMFTAALIVFLFGPKIIASLKVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++GSSLLWAD S+++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKSGTPTMGGLMILAGIVGSSLLWADLSNVYVVATLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNST-LLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  +  +   G    TSI FPFF+D +L++G
Sbjct: 120 VTKQSDKGFSGKARLAIEFLIAGIAVFFMMEAAKISAPQGPHLATSIAFPFFKDALLNVG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI F  FVIV+  NAVNLTDGLDGLAIVPVMIAS AF  IAY+AGN + S YLQ+NFV
Sbjct: 180 YFFIVFGGFVIVSAGNAVNLTDGLDGLAIVPVMIASAAFGLIAYLAGNAVFSGYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V++ ++IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI+++II
Sbjct: 240 PGTGELAVILGSVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVMVII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QV ++K TKKRVFLMAPIHHHFEKKGWTE+Q+VIRFWII+   A++G
Sbjct: 300 GGLFVMETLSVIIQVFWYKRTKKRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVGLAMLG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LATLKLR 366


>gi|61213987|sp|Q5ZSA2|MRAY_LEGPH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
          Length = 361

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 169/368 (45%), Positives = 244/368 (66%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y    V +Y+TFRS  A  +A+++    GP +I  LR LQ   GQ VR
Sbjct: 1   MLYWLTQLLQGQYHAFRVFQYLTFRSILASLTALIVGLLCGPLMIRWLRGLQ--IGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  S LLW D     + ++LL+TL+ GLVG+ DDY 
Sbjct: 59  SDGPQTHLSKAGTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL G+ +   + +IA++AV  L + +      +   T +  PFF+ +  D+G
Sbjct: 119 KLVLKNSKGLPGRWKYFWQSVIALVAVSYLYWNA-----SLPVHTQLTVPFFKTVTWDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF   A FVIV ++NAVNLTDGLDGLAI+P+++ + A    AY + N + S+YL + +V
Sbjct: 174 VFFPVLAYFVIVGSSNAVNLTDGLDGLAIMPIVMVAGALGVFAYASSNAVYSNYLGIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  S+++GAG+GFLW+N  PA +FMGD GSLALGA +G +AV  + E++L+I+
Sbjct: 234 PNTGELTIFCSSIVGAGLGFLWYNSYPAQVFMGDVGSLALGAALGIVAVVVRQELVLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ETLSVI+QVGYFK +  KR+F MAP+HHHFE KGW+E ++++RFWII+ +F + 
Sbjct: 294 GGLFVIETLSVILQVGYFKYSGGKRLFRMAPLHHHFELKGWSEPKVIVRFWIITVVFVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|90418197|ref|ZP_01226109.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337869|gb|EAS51520.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 360

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 204/366 (55%), Positives = 270/366 (73%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  F   + + +V +Y+TFR+ AA  +  L+VF FGP VI  LR  Q   GQP+R 
Sbjct: 1   MIAYLGQFGADFPLFNVFRYITFRTGAAMITGFLVVFLFGPVVIANLRVRQGR-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG+++L G + ++LLWAD  +L+V  +LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMMLTGFLTATLLWADLRNLYVWTVLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK+R+ +EF+IA +A   +++         +  TS+ FPF ++I+L++G 
Sbjct: 120 VTKQSDKGFSGKMRLALEFLIAGVAAVLIIYAGT-----GDFATSLAFPFVKEILLNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++ FAAFV+V  ANAVNLTDGLDGLAIVP+MIA+ AF  IAYVAGN+  ++YLQ+++V 
Sbjct: 175 FYVGFAAFVVVGAANAVNLTDGLDGLAIVPIMIAAGAFGLIAYVAGNVNFANYLQIHYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL  +  A+IGAG+GFLWFN  PA IFMGDTGSLALG   G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAPICGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMTGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FK+T +RVFLMAPIHHHFEK GWTE+Q+VIRFWII+F+ A +GL
Sbjct: 295 GLFVIEALSVIIQVGWFKLTGRRVFLMAPIHHHFEKLGWTESQVVIRFWIIAFMLAFVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|262273816|ref|ZP_06051629.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Grimontia
           hollisae CIP 101886]
 gi|262222231|gb|EEY73543.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Grimontia
           hollisae CIP 101886]
          Length = 360

 Score =  291 bits (744), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L+D  +++     +  Y+TFR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLDWLSDVLTQHIPFFRLFDYLTFRAILSVLTALGLSLWMGPRLIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLWAD S+ +V  +L +TL +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILTAITVTVLLWADLSNPYVWAVLFVTLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYMHGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I F  FVIV ++NAVNLTDGLDGLAI+P ++ +  F+FIA+  GN+  + YL + ++
Sbjct: 174 LFYIVFTYFVIVGSSNAVNLTDGLDGLAIMPTVMVASGFAFIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 KDADELVIVCAAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  + G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLAG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|209696055|ref|YP_002263985.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Aliivibrio
           salmonicida LFI1238]
 gi|226700976|sp|B6ELH8|MRAY_ALISL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|208010008|emb|CAQ80331.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Aliivibrio
           salmonicida LFI1238]
          Length = 360

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I L++F E Y+    + +Y++FR+  +  +A+ I    GPK+I  L++LQ   GQ VR
Sbjct: 1   MIIWLSNFLEQYFPFFRLFEYLSFRAILSIITALSISLWMGPKLIRWLQNLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  +  LWAD ++ +V  ++ + L +G VGF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGIMILTAITVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAYGKDT-----AATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P +  +  F+FIA+  GN+  ++YL +  +
Sbjct: 174 LTYILLTYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFAFIAWATGNVQFANYLHIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PQASELVVVCAAIVGAGFGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +I 
Sbjct: 294 GGVFVVETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMLLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|109899823|ref|YP_663078.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Pseudoalteromonas atlantica T6c]
 gi|122971618|sp|Q15Q14|MRAY_PSEA6 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|109702104|gb|ABG42024.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Pseudoalteromonas atlantica T6c]
          Length = 358

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 169/364 (46%), Positives = 242/364 (66%), Gaps = 8/364 (2%)

Query: 4   QLADFSEYYII-THVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPN 62
            LAD+ + +     V  Y+T R+  +  +A+LI    GP++I  L+++Q   GQ VR   
Sbjct: 2   LLADWLQQFEPSFRVFSYLTLRAILSTLTALLIAVLIGPRMIRWLQTMQ--IGQTVRDDG 59

Query: 63  LPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKIT 122
              H  K  TPTMGG++IL  ++ S LLWAD ++ +V + L + + +G++GF DDY K+ 
Sbjct: 60  PQSHLAKSGTPTMGGLLILAAIVVSVLLWADLTNRYVWVTLSVVVGYGIIGFIDDYRKVV 119

Query: 123 TGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFF 182
             D  GL  + +   + +IAI     L             +T+++ PFF+D++  MG+FF
Sbjct: 120 RKDPKGLIARWKYFWQSVIAIGVALYLYASQQD-----PAETALLVPFFKDVMPQMGMFF 174

Query: 183 IPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGV 242
           +    FVIV T+NAVNLTDGLDGLAIVP ++ + AF+  AY  GNI  S YL + ++P  
Sbjct: 175 VVMTYFVIVGTSNAVNLTDGLDGLAIVPTVLVAGAFAIFAYTTGNINFSAYLNIPYLPLT 234

Query: 243 GELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGL 302
            ELV+V +A++GAG+GFLWFN  PA++FMGD GSLALG  +G IAV  + EI+L+I+GG+
Sbjct: 235 SELVIVCTAIVGAGLGFLWFNTYPAMVFMGDVGSLALGGTLGIIAVLVRQEIVLVIMGGV 294

Query: 303 FVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLT 362
           FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS I  ++GL T
Sbjct: 295 FVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIILVLVGLAT 354

Query: 363 LKMR 366
           LK+R
Sbjct: 355 LKLR 358


>gi|77919799|ref|YP_357614.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pelobacter
           carbinolicus DSM 2380]
 gi|97176822|sp|Q3A2G3|MRAY_PELCD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|77545882|gb|ABA89444.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pelobacter
           carbinolicus DSM 2380]
          Length = 358

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 180/367 (49%), Positives = 247/367 (67%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L     E + + ++ +Y+TFR+  A  +A++I F  GP +ID L  LQ   GQ +R
Sbjct: 1   MLYHLLYPLHEQFSVLYIFRYITFRAIYATITALMIAFILGPWLIDKLSRLQ--IGQSIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG +IL+ ++  +LLW D ++++V + LL+T+ FG VGF DDY 
Sbjct: 59  KDGPQSHFKKEGTPTMGGTLILLAIVLPTLLWTDLTNVYVWVTLLVTVGFGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GLS + ++L   +IA  A   L  Y          +T++ FPFF+ +  ++G
Sbjct: 119 KVKLRNSAGLSARQKMLWLMLIAGTAGVMLYSYP-------PFQTTLAFPFFKGLRPELG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+IPFA  VIV  +NAVNLTDGLDGLAI P +IAS  +   AY+AGN  L+ YLQ++ V
Sbjct: 172 LFYIPFAVLVIVGASNAVNLTDGLDGLAIGPTIIASGTYLLFAYLAGNARLAEYLQISSV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A++GAG+GFLWFN  PA +FMGD GSL+LG  +G IAV TK EI+L+I+
Sbjct: 232 QGAGELAVLCGAMVGAGLGFLWFNTYPAQVFMGDVGSLSLGGALGTIAVITKQEIVLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QV  FK+  KR+F MAPIHHHFE KGW E +I++RFWIIS I A++ 
Sbjct: 292 GGIFVVEALSVIVQVSSFKLLGKRIFRMAPIHHHFELKGWAEPKIIVRFWIISIILALVA 351

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 352 LSTLKLR 358


>gi|316933183|ref|YP_004108165.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris DX-1]
 gi|315600897|gb|ADU43432.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris DX-1]
          Length = 361

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 201/367 (54%), Positives = 260/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L D S  +   +V +Y+TFR+  A  +  L VF FGP +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLIDLSSSFPAFNVFRYITFRTGGAMVTGALFVFMFGPWIIDNLRLRQGK-GQPIRT 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL   ++LWA+  + +V I+L +TL FG VGFYDDY+
Sbjct: 60  DGPQSHLVSKKGTPTMGGLMILSGLTVGTVLWANPLNPYVWIVLAVTLGFGFVGFYDDYM 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G+SG+ R+LIEF IA  A  AL++   +        +S+V PFF++++L++G
Sbjct: 120 KVTKQTHAGISGRTRLLIEFTIAGAACFALVWLGRA-----PLSSSLVIPFFKEVMLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+ F AFV+V   NAVNLTDGLDGLAIVPVMIA+ +F  I+Y+AGN + + YLQ+N+V
Sbjct: 175 WAFVAFGAFVVVGAGNAVNLTDGLDGLAIVPVMIAAASFGLISYLAGNAVFAEYLQINYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFKMAPIHHHFEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|154252860|ref|YP_001413684.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Parvibaculum
           lavamentivorans DS-1]
 gi|171769612|sp|A7HVU4|MRAY_PARL1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|154156810|gb|ABS64027.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Parvibaculum
           lavamentivorans DS-1]
          Length = 362

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 191/368 (51%), Positives = 262/368 (71%), Gaps = 8/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   +      +V +Y+TFR+  A  +A+LI F FGP++I  L++ Q   GQP+R
Sbjct: 1   MLYDLLGGMAGDIQALNVFRYITFRTGGATVTALLISFLFGPRIIALLKAKQRR-GQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H  +K  TPTMGG +IL+GL+ S LLWAD+S+ +V I+L +TL FG VGF DDY
Sbjct: 60  EDGPQTHIIQKQGTPTMGGFLILVGLVPSVLLWADWSNRYVWIVLFVTLGFGAVGFADDY 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K++     G+ G+V++  EF+IA++A+ AL+  S+        +T++  PFF+ +++++
Sbjct: 120 LKVSKISPKGVPGRVKLFFEFVIALIAMWALVLVSSE-----PLQTALTVPFFKTLLIEL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G FF  F A VIV ++NAVNLTDGLDGLAIVPVMIA+ +   I Y+ GN + + YLQ++F
Sbjct: 175 GGFFFLFGALVIVGSSNAVNLTDGLDGLAIVPVMIAAASLGLIVYLVGNAVFADYLQIHF 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V   ALIGAG+GFLW+N  PA++FMGDTGSLALG  +G IAV+ KHE++L I
Sbjct: 235 VPGTGELAVFCGALIGAGLGFLWYNAPPAMVFMGDTGSLALGGALGAIAVAAKHELVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           IGGLFV+E +SVI+QV  FK+T KRVF MAP+HHHFE+KGW E  +V+RFWIIS + A+ 
Sbjct: 295 IGGLFVLEAVSVIVQVASFKLTGKRVFRMAPLHHHFEQKGWAEPTVVVRFWIISVVLAMA 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLATLKLR 362


>gi|269137992|ref|YP_003294692.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Edwardsiella
           tarda EIB202]
 gi|267983652|gb|ACY83481.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Edwardsiella
           tarda EIB202]
 gi|304558039|gb|ADM40703.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Edwardsiella
           tarda FL6-60]
          Length = 360

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +Y+   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVKYFSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + L +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLLGYGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA++    +      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSVIALVVAFTMYSIGKDT-----PATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  + FVIV T+NAVNLTDGLDGLAI+P +  +     +A+  GN+  + YL + ++
Sbjct: 174 LLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGMGLVAWATGNVNFAAYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|167622392|ref|YP_001672686.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           halifaxensis HAW-EB4]
 gi|189028768|sp|B0TQN4|MRAY_SHEHH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167352414|gb|ABZ75027.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           halifaxensis HAW-EB4]
          Length = 360

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 249/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVYLAEYLTQFYSGFNVFSYVTFRAILGLMTALMFSLWWGPKMIARLQLMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL G+  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAGVFISVLLWGDLDSRYVWVVLFVLGSFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + L++ + A+L    L   + S       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYLLQSLAALLIAVYLYASAQS-----PGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI    F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  + YL + ++
Sbjct: 174 GFFIVLVYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFASYLHLPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|307132586|ref|YP_003884602.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Dickeya dadantii
           3937]
 gi|306530115|gb|ADN00046.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Dickeya dadantii
           3937]
          Length = 360

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVKFYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I S LLW + ++ +V  +LL+ + +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILASIIISVLLWVNLANPYVWCVLLVLVGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A++   ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALVVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +V F+ +A+  GN+  + YL + ++
Sbjct: 174 VMYIVLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAVGFALVAWATGNMNFASYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLMLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKVR 360


>gi|85373183|ref|YP_457245.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erythrobacter
           litoralis HTCC2594]
 gi|122545207|sp|Q2NCZ3|MRAY_ERYLH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|84786266|gb|ABC62448.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erythrobacter
           litoralis HTCC2594]
          Length = 356

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 177/366 (48%), Positives = 245/366 (66%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   +A++  +    ++++Y TFR+ A   +A++I    GP+ I+ LR  Q   GQP+R 
Sbjct: 1   MLYLIAEWLGFEGALNLIRYQTFRTGATLMTALVIGLIIGPRFINMLRVRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I++ L+ S +LW D  S  V   L +T+ FGL+GF DD  K
Sbjct: 60  DGPQSHLAKRGTPTMGGLMIIVSLVLSLVLWMDLRSPFVWACLAVTVGFGLIGFLDDLDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G+S KVR+L+EF++A +A   ++          +  T +  PF  D  + +G 
Sbjct: 120 VTKNSHRGVSAKVRLLMEFLVAGIASYIIV---------SQINTWLYVPFVSDRAIPLGP 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAA VIV   NAVNLTDGLDGLAI+PV+IA+  F+ IAY+AG +  S YL +  VP
Sbjct: 171 FYYVFAAVVIVGAGNAVNLTDGLDGLAIMPVIIAAGTFAIIAYLAGRVDYSEYLGIPHVP 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  +A++GAG+ FLWFN  PA +FMGDTGSLALG  +G IAV++ HEI+L I+G
Sbjct: 231 GAGELAIFCAAIMGAGLAFLWFNAPPAAVFMGDTGSLALGGALGAIAVASHHEIVLAIVG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E LSVI+QV +FK T KRVF MAPIHHHFE+ GW+E+++VIRFWI+S + A++GL
Sbjct: 291 GLFVFEALSVIIQVFWFKRTGKRVFRMAPIHHHFEQLGWSESKVVIRFWIVSIVLALMGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 ATLKLR 356


>gi|77462653|ref|YP_352157.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|126461546|ref|YP_001042660.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332557535|ref|ZP_08411857.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides WS8N]
 gi|97179561|sp|Q3J4M8|MRAY_RHOS4 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166221347|sp|A3PHS2|MRAY_RHOS1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|77387071|gb|ABA78256.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103210|gb|ABN75888.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332275247|gb|EGJ20562.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides WS8N]
          Length = 360

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 204/366 (55%), Positives = 256/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  FS+   I ++ +Y+TFR+ AAFF+A++  F FG  +ID LR  Q   GQP+R 
Sbjct: 1   MLYLLTAFSDGGDIFNLFRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L+ S+LLWA   + +V I+LL+T++FGL+GF DDY K
Sbjct: 60  DGPTTHFAKAGTPTMGGLLILSALVVSTLLWARLDNPYVWIVLLVTVAFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   +  G+ G+VR LI  +IA LA  A  +         +    +  PFF+D ++++G 
Sbjct: 120 VKKQNTKGVPGRVRFLIGLLIAALAAIAAAWS-----HPPDLTLQLAMPFFKDALINLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PFA  VIV  ANAVNLTDGLDGLAI+PVMIA      IAYV GN  L+ YL V+FVP
Sbjct: 175 FFVPFAMVVIVGAANAVNLTDGLDGLAIMPVMIAGTTLGVIAYVVGNFNLTDYLGVHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL++  SAL+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHEI+L I+G
Sbjct: 235 GTGELLIFSSALVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVCTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E LSVI+QV YFK T +RVFLMAPIHHHFEKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVTEALSVIIQVLYFKRTGRRVFLMAPIHHHFEKKGWAEPQIVIRFWIISLILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|271502045|ref|YP_003335071.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dickeya dadantii
           Ech586]
 gi|270345600|gb|ACZ78365.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dickeya dadantii
           Ech586]
          Length = 360

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I S LLW + ++ +V  +LL+ + +G+VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILASIIISVLLWVNLANPYVWCVLLVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A+    ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALAVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +V F+ +A+  GN+  + YL + ++
Sbjct: 174 VMYIVLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAVGFALVAWATGNMNFASYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLMLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKVR 360


>gi|54298606|ref|YP_124975.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           pneumophila str. Paris]
 gi|148358648|ref|YP_001249855.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Legionella
           pneumophila str. Corby]
 gi|296108262|ref|YP_003619963.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|61213972|sp|Q5X1S3|MRAY_LEGPA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166221322|sp|A5IAV9|MRAY_LEGPC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|53752391|emb|CAH13823.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           pneumophila str. Paris]
 gi|148280421|gb|ABQ54509.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Legionella
           pneumophila str. Corby]
 gi|295650164|gb|ADG26011.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 361

 Score =  290 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 168/368 (45%), Positives = 244/368 (66%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y    V +Y+TFRS  A  +A+++    GP +I  LR LQ   GQ VR
Sbjct: 1   MLYWLTQLLQGQYHAFRVFQYLTFRSILASLTALIVGLLCGPLMIRWLRGLQ--IGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  S LLW D     + ++LL+TL+ GLVG+ DDY 
Sbjct: 59  SDGPQTHLSKAGTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL G+ +   + +IA++AV  L + +      +   T +  PFF+ +  D+G
Sbjct: 119 KLVLKNSKGLPGRWKYFWQSVIALVAVSYLYWNA-----SLPVHTQLTVPFFKTVTWDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF   A FVIV ++NAVNLTDGLDGLAI+P+++ + A    AY + N + S+YL + +V
Sbjct: 174 VFFPVLAYFVIVGSSNAVNLTDGLDGLAIMPIVMVAGALGVFAYASSNAVYSNYLGIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  S+++GAG+GFLW+N  PA +FMGD GSLALGA +G +A+  + E++L+I+
Sbjct: 234 PNTGELTIFCSSIVGAGLGFLWYNSYPAQVFMGDVGSLALGAALGIVAIVVRQELVLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ETLSVI+QVGYFK +  KR+F MAP+HHHFE KGW+E ++++RFWII+ +F + 
Sbjct: 294 GGLFVIETLSVILQVGYFKYSGGKRLFRMAPLHHHFELKGWSEPKVIVRFWIITVVFVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|17986859|ref|NP_539493.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|23502305|ref|NP_698432.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           1330]
 gi|62290327|ref|YP_222120.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 1 str. 9-941]
 gi|82700251|ref|YP_414825.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis biovar Abortus 2308]
 gi|161619382|ref|YP_001593269.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella canis
           ATCC 23365]
 gi|163843690|ref|YP_001628094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           ATCC 23445]
 gi|189024560|ref|YP_001935328.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           S19]
 gi|225852916|ref|YP_002733149.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis ATCC 23457]
 gi|237815834|ref|ZP_04594831.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           str. 2308 A]
 gi|254689628|ref|ZP_05152882.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 6 str. 870]
 gi|254694118|ref|ZP_05155946.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 3 str. Tulya]
 gi|254697770|ref|ZP_05159598.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254704692|ref|ZP_05166520.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 3 str. 686]
 gi|254708106|ref|ZP_05169934.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis M163/99/10]
 gi|254710475|ref|ZP_05172286.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis B2/94]
 gi|254714468|ref|ZP_05176279.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M644/93/1]
 gi|254717366|ref|ZP_05179177.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M13/05/1]
 gi|254730659|ref|ZP_05189237.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 4 str. 292]
 gi|256031969|ref|ZP_05445583.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis M292/94/1]
 gi|256045064|ref|ZP_05447965.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256061491|ref|ZP_05451635.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           neotomae 5K33]
 gi|256113987|ref|ZP_05454770.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|256257878|ref|ZP_05463414.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 9 str. C68]
 gi|256263603|ref|ZP_05466135.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 2 str. 63/9]
 gi|256369850|ref|YP_003107361.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella microti
           CCM 4915]
 gi|260546869|ref|ZP_05822608.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           NCTC 8038]
 gi|260565337|ref|ZP_05835821.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260566061|ref|ZP_05836531.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 4 str. 40]
 gi|260755156|ref|ZP_05867504.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 6
           str. 870]
 gi|260758375|ref|ZP_05870723.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 4
           str. 292]
 gi|260762201|ref|ZP_05874544.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260884169|ref|ZP_05895783.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 9 str. C68]
 gi|261214418|ref|ZP_05928699.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 3
           str. Tulya]
 gi|261219197|ref|ZP_05933478.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M13/05/1]
 gi|261315609|ref|ZP_05954806.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261318047|ref|ZP_05957244.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis B2/94]
 gi|261322258|ref|ZP_05961455.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M644/93/1]
 gi|261325498|ref|ZP_05964695.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           neotomae 5K33]
 gi|261755385|ref|ZP_05999094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 3 str. 686]
 gi|265989078|ref|ZP_06101635.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis M292/94/1]
 gi|265991491|ref|ZP_06104048.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|265995329|ref|ZP_06107886.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|297248714|ref|ZP_06932432.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 5 str. B3196]
 gi|306844333|ref|ZP_07476925.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           BO1]
 gi|54037805|sp|P64256|MRAY_BRUSU RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|54041318|sp|P64255|MRAY_BRUME RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|75496532|sp|Q57C75|MRAY_BRUAB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|97176502|sp|Q2YM68|MRAY_BRUA2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189082220|sp|A9M693|MRAY_BRUC2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189082221|sp|B0CHM3|MRAY_BRUSI RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621242|sp|B2S6Q7|MRAY_BRUA1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|254813225|sp|C0RE73|MRAY_BRUMB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|17982496|gb|AAL51757.1| phospho-n-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|23348282|gb|AAN30347.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           1330]
 gi|62196459|gb|AAX74759.1| MraY, phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616352|emb|CAJ11409.1| Glycosyl transferase, family
           4:Phospho-N-acetylmuramoyl-pentapeptide transferase
           [Brucella melitensis biovar Abortus 2308]
 gi|161336193|gb|ABX62498.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella canis
           ATCC 23365]
 gi|163674413|gb|ABY38524.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           ATCC 23445]
 gi|189020132|gb|ACD72854.1| Glycosyl transferase, family 4 [Brucella abortus S19]
 gi|225641281|gb|ACO01195.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis ATCC 23457]
 gi|237789132|gb|EEP63343.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           str. 2308 A]
 gi|256000013|gb|ACU48412.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella microti
           CCM 4915]
 gi|260095919|gb|EEW79796.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           NCTC 8038]
 gi|260151405|gb|EEW86499.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. 16M]
 gi|260155579|gb|EEW90659.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 4 str. 40]
 gi|260668693|gb|EEX55633.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 4
           str. 292]
 gi|260672633|gb|EEX59454.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260675264|gb|EEX62085.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 6
           str. 870]
 gi|260873697|gb|EEX80766.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 9 str. C68]
 gi|260916025|gb|EEX82886.1| UDP-MurNAc-pentapeptide phosphotransferase [Brucella abortus bv. 3
           str. Tulya]
 gi|260924286|gb|EEX90854.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M13/05/1]
 gi|261294948|gb|EEX98444.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M644/93/1]
 gi|261297270|gb|EEY00767.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis B2/94]
 gi|261301478|gb|EEY04975.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           neotomae 5K33]
 gi|261304635|gb|EEY08132.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis M163/99/10]
 gi|261745138|gb|EEY33064.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella suis
           bv. 3 str. 686]
 gi|262766442|gb|EEZ12231.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 3 str. Ether]
 gi|263002275|gb|EEZ14850.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263093654|gb|EEZ17659.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis bv. 2 str. 63/9]
 gi|264661275|gb|EEZ31536.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           pinnipedialis M292/94/1]
 gi|297175883|gb|EFH35230.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella abortus
           bv. 5 str. B3196]
 gi|306275405|gb|EFM57146.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           BO1]
 gi|326409458|gb|ADZ66523.1| Glycosyl transferase, family 4 [Brucella melitensis M28]
 gi|326539164|gb|ADZ87379.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella
           melitensis M5-90]
          Length = 360

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 204/366 (55%), Positives = 275/366 (75%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++L++++ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA +A   ++             +S+ FPF + +++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQE-----PFSSSLTFPFVKQLVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|86148537|ref|ZP_01066824.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp.
           MED222]
 gi|218708483|ref|YP_002416104.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           splendidus LGP32]
 gi|254813264|sp|B7VJ00|MRAY_VIBSL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|85833683|gb|EAQ51854.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp.
           MED222]
 gi|218321502|emb|CAV17454.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           splendidus LGP32]
          Length = 360

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + ++    + +Y++FR+ A+  +A+ +    GP++I+ L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPHFSFFRLFEYLSFRAIASILTALCLSLWMGPRLIERLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I + L+WAD S+ +V  +L++   +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGVMILAAIIITVLMWADLSNPYVWAVLVVLAGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  + + T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGHDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  + YL + ++
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAAGFAVIAWATGNVNFASYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PYTSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|212712754|ref|ZP_03320882.1| hypothetical protein PROVALCAL_03851 [Providencia alcalifaciens DSM
           30120]
 gi|212684670|gb|EEB44198.1| hypothetical protein PROVALCAL_03851 [Providencia alcalifaciens DSM
           30120]
          Length = 360

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+     +   +V  Y+TFR+     +A++I    GP +I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAELLVHKFSAFNVFSYLTFRAIVGLLTALIIALWMGPHLIAYLQKMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA   + +V  +LL+ + +G+VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGILILFSICMSVLLWARLDNPYVWCVLLVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A++   ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALVVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + F+
Sbjct: 174 VLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFANYLHIPFL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|294085904|ref|YP_003552664.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665479|gb|ADE40580.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 362

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 181/368 (49%), Positives = 250/368 (67%), Gaps = 8/368 (2%)

Query: 1   MF-IQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   +  Y   ++ +Y+TFR+  A  +A+ +   FGP  I  L++ Q   GQP+R
Sbjct: 1   MLPDLLVPLAGEYQFFNLFRYITFRTGGATVTALFLSLLFGPVFIRWLKANQ-KEGQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   KI TPTMGG++IL     S+LLW   S+ ++  +L + L FG +G  DD+
Sbjct: 60  DDGPQSHLITKIGTPTMGGLLILAAFAISALLWTPLSNPYMWPVLSVALVFGAIGSVDDW 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K+      G+SG++++ ++ I+A  A    +  S S     E +  I  PF +D I+ +
Sbjct: 120 LKLRRRSHQGMSGRMKMGLQLIVAFFATLVFVQLSPS-----EVRYGISVPFMKDTIIAL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           GLF++PFA  VIV  +NAVNLTDGLDGLAIVPVMI +  F+ IAY+AGN+  ++YLQ+N+
Sbjct: 175 GLFYVPFAMLVIVGASNAVNLTDGLDGLAIVPVMIVAGCFTLIAYLAGNVNFANYLQINY 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V+  ALIGAG+GFLWFN  PA +FMGDTGSLALG  +G I+V+T+HE++L I
Sbjct: 235 VPGTGELAVMCGALIGAGLGFLWFNAPPARVFMGDTGSLALGGALGAISVATRHELVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
            GGLFV+ET SVI+QV  FK+T KR+FLMAP+HHHFEKKGW E+ IVIRFWII+F+  ++
Sbjct: 295 AGGLFVLETASVILQVASFKLTGKRIFLMAPLHHHFEKKGWAESTIVIRFWIIAFMLGIV 354

Query: 359 GLLTLKMR 366
            L +LK+R
Sbjct: 355 ALSSLKLR 362


>gi|90423694|ref|YP_532064.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris BisB18]
 gi|122476440|sp|Q216E1|MRAY_RHOPB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|90105708|gb|ABD87745.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris BisB18]
          Length = 361

 Score =  290 bits (742), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 197/367 (53%), Positives = 258/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L DF+      +V +Y+TFR+  A  +  L VF  GP +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLIDFASTIPAFNVFRYITFRTGGAMVTGALFVFLCGPWIIDNLRLRQGK-GQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG+++L GL+  ++LWA+  + +V I+L +TL FG VGFYDDY+K
Sbjct: 60  DGPQSHLSKKGTPTMGGLMVLSGLVVGTVLWANPLNPYVWIVLAVTLGFGFVGFYDDYLK 119

Query: 121 ITTGDAG-GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           +T   +  G +G+ R+LIE +IA  A  AL+             +S+V PFF+D+ +++G
Sbjct: 120 VTKQSSQNGFAGRWRLLIEAVIAAAACYALVRLGRD-----PLSSSLVIPFFKDVAINLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F AF++V   NAVNLTDGLDGLAIVPVMIA+ +F  I+Y+AGN + + YLQ+N+V
Sbjct: 175 WFFVGFGAFIVVGAGNAVNLTDGLDGLAIVPVMIAAASFGLISYLAGNAVFADYLQINYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGTGELSVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFKMAPIHHHFEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|146276740|ref|YP_001166899.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166221348|sp|A4WQD0|MRAY_RHOS5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|145554981|gb|ABP69594.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 360

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 204/366 (55%), Positives = 257/366 (70%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  FS+   I ++ +Y+TFR+ AAFF+A++  F FG  +ID LR  Q   GQP+R 
Sbjct: 1   MLYTLTAFSDGGDIFNLFRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L+ S+LLWA   + +V I+LL+T++FGL+GF DDY K
Sbjct: 60  DGPATHFAKAGTPTMGGLLILSSLVVSTLLWARLDNPYVWIVLLVTVAFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   +  G+SG+VR +I  +IA LA  A  +         +    +  PFF+D ++++G 
Sbjct: 120 VKKQNTKGVSGRVRFVIGLVIAALAATAAAWS-----HPPDLTLQLAMPFFKDALVNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PFA  VIV  ANAVNLTDGLDGLAI+PVMIA      IAYV GN  L+ YL V+FVP
Sbjct: 175 FFVPFAMVVIVGAANAVNLTDGLDGLAIMPVMIAGTTLGVIAYVVGNFNLTDYLGVHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL++  SAL+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHEI+L I+G
Sbjct: 235 GTGELLIFTSALVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVCTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E LSVI+QV YFK T +RVFLMAPIHHHFEKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVTEALSVIIQVLYFKRTGRRVFLMAPIHHHFEKKGWAEPQIVIRFWIISLILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|84686332|ref|ZP_01014226.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665515|gb|EAQ11991.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacterales
           bacterium HTCC2654]
          Length = 362

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 201/368 (54%), Positives = 257/368 (69%), Gaps = 8/368 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+ S+     ++ +Y+TFR+ AAFF+A++  F FG  +I+ L+  Q   GQP+R 
Sbjct: 1   MLYWLAELSDGGDFFNLFRYITFRAGAAFFTALIFGFLFGRPLINLLKRRQ-KNGQPIRA 59

Query: 61  PNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG +IL  +  S+LLWA   +  V ++L +TLS+GL+GF DDY 
Sbjct: 60  DGPEGHVLTKAGTPTMGGALILGAITVSTLLWARLDNGFVLVVLGVTLSYGLIGFADDYS 119

Query: 120 KITTGDAG-GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           KI   D   GLSGK+R+ +E +IA+ A      Y   TL   E    + FP F+D++L++
Sbjct: 120 KIAKNDNYSGLSGKLRLTLEGVIALAAS-----YVIMTLHPAELTGQLAFPVFKDLLLNL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           GLFF+P AAFV+V  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++
Sbjct: 175 GLFFLPVAAFVMVGAANAVNLTDGLDGLAIMPVMIAAGTLGAIAYAVGRVDFTEYLDVHY 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL+V  + LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAVS KHE++L I
Sbjct: 235 VPGTGELLVFAAGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVSMKHELVLGI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFVVE LSVI+QV YFK T KRVFLMAPIHHHFEK+GW E QIVIRFWIIS I A++
Sbjct: 295 VGGLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHFEKRGWAEPQIVIRFWIISLILALV 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLATLKLR 362


>gi|28897231|ref|NP_796836.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|153839038|ref|ZP_01991705.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus AQ3810]
 gi|260366059|ref|ZP_05778525.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus K5030]
 gi|260878314|ref|ZP_05890669.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus AN-5034]
 gi|260896403|ref|ZP_05904899.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus Peru-466]
 gi|260899192|ref|ZP_05907587.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus AQ4037]
 gi|31076759|sp|Q87SG7|MRAY_VIBPA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|28805440|dbj|BAC58720.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149747466|gb|EDM58414.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus AQ3810]
 gi|308087559|gb|EFO37254.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus Peru-466]
 gi|308093164|gb|EFO42859.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus AN-5034]
 gi|308107126|gb|EFO44666.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus AQ4037]
 gi|308111363|gb|EFO48903.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus K5030]
 gi|328471996|gb|EGF42873.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           parahaemolyticus 10329]
          Length = 360

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y     + +Y++FR+  +  +A+ +    GP +I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYLSFFRLFEYLSFRAILSVLTALGLSLWMGPIMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D S+ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAISITILLWTDLSNPYVWAVLTVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA +   AL  Y   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSLIAFVVAFALYAYGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  S YL + ++
Sbjct: 174 LMYIILTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFSEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|197116886|ref|YP_002137313.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           bemidjiensis Bem]
 gi|226700985|sp|B5EBP8|MRAY_GEOBB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|197086246|gb|ACH37517.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Geobacter
           bemidjiensis Bem]
          Length = 358

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 236/367 (64%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y + +V KY+TFRS  A  +A+L+ F  GP V+  L +LQ    Q +R
Sbjct: 1   MLYHLLYPLASDYKLFNVFKYLTFRSIYAMITALLLAFIVGPWVVRKLEALQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL+ ++  +LLWAD  ++ + + LL+ + +G++GF DDY 
Sbjct: 59  TDGPESHLKKQGTPTMGGVLILVCIVLPTLLWADLKNVFIWLTLLIIVGYGVLGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++A      L +            T +  PFF+ +  ++G
Sbjct: 119 KVVEKNPKGLSPRQKMFWQMLLAAGVGIFLFYLPG-------FSTELYLPFFKRVHPELG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FIPF   VIV  +NAVNLTDGLDGLAI PV I +  +    Y+AGN  LS YLQ+ +V
Sbjct: 172 ILFIPFVMLVIVGASNAVNLTDGLDGLAIGPVAINAATYLLFCYIAGNAKLSGYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAG+GFLW+N  PA +FMGD GSL+LG  +G +AV TK EILL+I+
Sbjct: 232 PGAGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGALGTLAVLTKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGVFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|209550177|ref|YP_002282094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|226700990|sp|B5ZWJ7|MRAY_RHILW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|209535933|gb|ACI55868.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 366

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 218/367 (59%), Positives = 283/367 (77%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + SEY+   ++ +Y+TFR+ AA F++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLIWLVELSEYFKFLNLFRYITFRTGAALFTSALIVFLFGPTIINSLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++G+SLLWAD S+++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGIVGASLLWADLSNVYVVATLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  +  S + G    +SI FPFF+D ++++G
Sbjct: 120 VTKQSHMGFSGKARLGIEFVIAGIAVYFMMRTALASGVAGSTFGSSIAFPFFKDFMINIG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+ F  FVIV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN++ ++YLQ+NFV
Sbjct: 180 IMFVVFGGFVIVGAGNAVNLTDGLDGLAIVPVMIAAASFGVIAYLAGNVVFANYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI++ II
Sbjct: 240 PGTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGTIGTVAVATKHEIVMAII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWII+   A++G
Sbjct: 300 GGLFVMETLSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVGLAMLG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|163760793|ref|ZP_02167873.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hoeflea
           phototrophica DFL-43]
 gi|162282115|gb|EDQ32406.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hoeflea
           phototrophica DFL-43]
          Length = 367

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 220/368 (59%), Positives = 279/368 (75%), Gaps = 3/368 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L D ++     ++ +Y+TFR+ AA F++ LIVF FGP++I  LR  Q   GQP+R 
Sbjct: 1   MLIWLVDLADQIQFFNLFRYITFRTGAAMFTSALIVFLFGPRIIASLRVRQGR-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL G++GSSLLWAD SS++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFLKAGTPTMGGLMILAGIVGSSLLWADLSSVYVVTTLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLF--YSNSTLLGIETKTSIVFPFFRDIILDM 178
           +T     G SGK R+ +EFIIA +AV  ++    + S   G E  +S+ FPFF+D++LD+
Sbjct: 120 VTKQSDKGFSGKARLGLEFIIAGIAVFFIMQASMAASNASGAEFGSSVAFPFFKDLLLDL 179

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G FFI F AFVIV+  NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN + ++YLQ++F
Sbjct: 180 GWFFIVFGAFVIVSAGNAVNLTDGLDGLAIVPVMIAAASFGAIAYLAGNAVFANYLQIHF 239

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V++ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI++ I
Sbjct: 240 VPGTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVMAI 299

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           IGGLFV+E LSVI+QV  FK+T KRVFLMAPIHHHFEKKGWTE+Q+V+RFWIIS   A+I
Sbjct: 300 IGGLFVIEALSVIIQVASFKLTGKRVFLMAPIHHHFEKKGWTESQVVVRFWIISVGLAMI 359

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 360 GLATLKLR 367


>gi|254719465|ref|ZP_05181276.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           83/13]
 gi|265984471|ref|ZP_06097206.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           83/13]
 gi|306839244|ref|ZP_07472061.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp. NF
           2653]
 gi|264663063|gb|EEZ33324.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           83/13]
 gi|306405791|gb|EFM62053.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp. NF
           2653]
          Length = 360

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 203/366 (55%), Positives = 274/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++L++++ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +      G SGK R+ IEF+IA +A   ++             +S+ FPF + +++++  
Sbjct: 120 VMKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQE-----PFSSSLTFPFVKQLVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|84394437|ref|ZP_00993153.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           splendidus 12B01]
 gi|84374936|gb|EAP91867.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           splendidus 12B01]
          Length = 360

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + +     + +Y++FR+ A+  +A+ +    GP++I+ L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPHLSFFRLFEYLSFRAIASILTALCLSLWMGPRLIERLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I + L+WAD S+ +V  +L++   +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGVMILAAIIITVLMWADLSNPYVWAVLVVLAGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  + + T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGHDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  + YL + ++
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAAGFAVIAWATGNVNFAAYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PYTSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|255263126|ref|ZP_05342468.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thalassiobium
           sp. R2A62]
 gi|255105461|gb|EET48135.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thalassiobium
           sp. R2A62]
          Length = 360

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 188/366 (51%), Positives = 244/366 (66%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A+L  F FG  +I  LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFITALLFGFVFGRPLIMALRRRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L  S+LLWA   +  V ++L +TLSF  +GF DDY K
Sbjct: 60  DGPEGHFEKAGTPTMGGLLIVGALTTSTLLWARLDNPFVWMVLFVTLSFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+SGK+R+ +  +IA +A      Y          +  + FP F+D ++++G 
Sbjct: 120 VSKQNTAGVSGKIRLGLGLLIAGIAGFWAAQYHPEG-----LQNQLAFPIFKDTLINLGY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  VIV +ANAVNLTDGLDGLAI+PVMIAS A   IAY  G    + YL V++V 
Sbjct: 175 LFVPFAILVIVGSANAVNLTDGLDGLAIMPVMIASGALGVIAYAVGRTDFTEYLDVHYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++    +IG G+GFLW+N  PA +FMGDTGSLALG  +GGIAV TKHEI+L I+G
Sbjct: 235 GTGEILIFTMGIIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGGIAVVTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           G+FV E LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GVFVAEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|119773492|ref|YP_926232.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           amazonensis SB2B]
 gi|166221354|sp|A1S2F6|MRAY_SHEAM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|119765992|gb|ABL98562.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           amazonensis SB2B]
          Length = 360

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 249/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+  A  +A++    +GPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYTGFNVFSYVTFRAILALLTALMFSLWWGPKLIERLQVLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL G+    LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAGIFIGVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + + + + A++    L + +         +T +V PFF+DI+  +G
Sbjct: 119 KVVRKDPKGLIARWKYIFQSLAALVVAFYLFYSTKH-----PGETQLVVPFFKDILPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI    F IV  +NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 LMFIVLTYFTIVGASNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|251788247|ref|YP_003002968.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dickeya zeae
           Ech1591]
 gi|247536868|gb|ACT05489.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dickeya zeae
           Ech1591]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVKFYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I S LLW + ++ +V  +LL+ + +G+VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILASIIISVLLWVNLANPYVWCVLLVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A+    ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALAVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +V F+ +A+  GN+  + YL + ++
Sbjct: 174 VMYIVLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAVGFALVAWATGNMNFASYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLMLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKVR 360


>gi|126172651|ref|YP_001048800.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS155]
 gi|160873535|ref|YP_001552851.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS195]
 gi|217971630|ref|YP_002356381.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS223]
 gi|304411646|ref|ZP_07393258.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS183]
 gi|307306302|ref|ZP_07586047.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica BA175]
 gi|166221355|sp|A3CZL8|MRAY_SHEB5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189028767|sp|A9KY26|MRAY_SHEB9 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|254813253|sp|B8E695|MRAY_SHEB2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|125995856|gb|ABN59931.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS155]
 gi|160859057|gb|ABX47591.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS195]
 gi|217496765|gb|ACK44958.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS223]
 gi|304349834|gb|EFM14240.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS183]
 gi|306911175|gb|EFN41602.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica BA175]
 gi|315265765|gb|ADT92618.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS678]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 247/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   ++   +V  YVTFR+     +A++    FGPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALVFSLWFGPKLIERLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A+L    L   + +       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALLIAFFLYATAAN-----PGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G+   ++YL +  +
Sbjct: 174 AVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHAQFANYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|268591758|ref|ZP_06125979.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Providencia
           rettgeri DSM 1131]
 gi|291312719|gb|EFE53172.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Providencia
           rettgeri DSM 1131]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+     + + +V  Y+TFR+     +A+ I    GP +I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEMLVHKFSVLNVFSYLTFRAIVGLLTALAIALWMGPHLIAYLQKMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA   + +V  +LL+ + +G+VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGLLILFSITVSTLLWARLDNPYVWCVLLVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA++   ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVIALIVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I    FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + F+
Sbjct: 174 MLYILLTYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFASYLHIPFL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|192292417|ref|YP_001993022.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris TIE-1]
 gi|229621824|sp|B3QFN4|MRAY_RHOPT RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|192286166|gb|ACF02547.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris TIE-1]
          Length = 361

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 202/367 (55%), Positives = 261/367 (71%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L D S  +   +V +Y+TFR+  A  +  L VF FGP +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLIDLSSSFPAFNVFRYITFRTGGAMVTGALFVFMFGPWIIDNLRLRQGK-GQPIRT 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL   ++LWA+  + +V I+L +TL FG VGFYDDY+
Sbjct: 60  DGPQSHLMTKKGTPTMGGLMILSGLTVGTVLWANPLNPYVWIVLAVTLGFGFVGFYDDYM 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G+SG+ R+LIEFIIA  A  AL++   +        +S+V PFF++++L++G
Sbjct: 120 KVTKQTHAGISGRTRLLIEFIIAGAACFALVWLGRA-----PLSSSLVIPFFKEVMLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+ F AFV+V   NAVNLTDGLDGLAIVPVMIA+ +F  I+Y+AGN + + YLQ+N+V
Sbjct: 175 WAFVVFGAFVVVGAGNAVNLTDGLDGLAIVPVMIAAASFGLISYLAGNAVFAEYLQINYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFKMAPIHHHFEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|54295454|ref|YP_127869.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Legionella
           pneumophila str. Lens]
 gi|61213969|sp|Q5WTI4|MRAY_LEGPL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|53755286|emb|CAH16780.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           pneumophila str. Lens]
          Length = 361

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 169/368 (45%), Positives = 244/368 (66%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y    V +Y+TFRS  A  +A+++    GP +I  LR LQ   GQ VR
Sbjct: 1   MLYWLTQLLQGQYHAFRVFQYLTFRSILASLTALIVGLLCGPLMIRWLRGLQ--IGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  S LLW D     + ++LL+TL+ GLVG+ DDY 
Sbjct: 59  SDGPQTHLSKAGTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL G+ +   + +IA++AV  L + +      +   T +  PFF+ +  D+G
Sbjct: 119 KLVLKNSKGLPGRWKYFWQSVIALVAVSYLYWNA-----SLPVHTQLTAPFFKTVTWDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF   A FVIV ++NAVNLTDGLDGLAI+P+++ + A    AY + N + S+YL + +V
Sbjct: 174 IFFPVLAYFVIVGSSNAVNLTDGLDGLAIMPIVMVAGALGVFAYASSNAVYSNYLGIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  S+++GAG+GFLW+N  PA +FMGD GSLALGA +G +AV  + E++L+I+
Sbjct: 234 PNTGELTIFCSSIVGAGLGFLWYNSYPAQVFMGDVGSLALGAALGIVAVVVRQELVLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ETLSVI+QVGYFK +  KR+F MAP+HHHFE KGW+E ++++RFWII+ +F + 
Sbjct: 294 GGLFVIETLSVILQVGYFKYSGGKRLFRMAPLHHHFELKGWSEPKVIVRFWIITVVFVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|294635006|ref|ZP_06713523.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Edwardsiella
           tarda ATCC 23685]
 gi|291091605|gb|EFE24166.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Edwardsiella
           tarda ATCC 23685]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +Y+   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVKYFSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLIGYGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA++    +      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSVIALVVAFTMYSIGKDT-----PATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  + FVIV T+NAVNLTDGLDGLAI+P +  +     +A+  GN+  + YL + ++
Sbjct: 174 LLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGMGLVAWATGNVNFAAYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RYAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|157373548|ref|YP_001472148.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           sediminis HAW-EB3]
 gi|189028771|sp|A8FQ97|MRAY_SHESH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|157315922|gb|ABV35020.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           sediminis HAW-EB3]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 174/367 (47%), Positives = 254/367 (69%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYSGFNVFSYVTFRAILGLLTALIFSLWWGPKMIERLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL G+  S LLW D +S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGILILAGVFISVLLWGDLASRYVWVVLFVLASFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K + +++ + A++    L   ++     +  +T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIAKWKYILQSLAALVIAFYLYASAD-----LVGETQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 GFFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHLPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGVIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|116253051|ref|YP_768889.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|241205560|ref|YP_002976656.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|166221346|sp|Q1ME30|MRAY_RHIL3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|115257699|emb|CAK08797.1| putative phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|240859450|gb|ACS57117.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 366

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 217/367 (59%), Positives = 283/367 (77%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + SEY+   ++ +Y+TFR+ AA F++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLIWLVELSEYFKFLNLFRYITFRTGAALFTSALIVFLFGPTIINSLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++G+SLLWAD S+++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGIVGASLLWADLSNVYVVATLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  +  S + G    +SI FPFF+D ++++G
Sbjct: 120 VTKQSHMGFSGKARLGIEFVIAGIAVYFMMRTALASGIAGSTFGSSIAFPFFKDFMINIG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+ F  FVIV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN++ ++YLQ+NFV
Sbjct: 180 IMFVVFGGFVIVGAGNAVNLTDGLDGLAIVPVMIAAASFGVIAYLAGNVVFANYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI++ II
Sbjct: 240 PGTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGTIGTVAVATKHEIVMAII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWI++   A++G
Sbjct: 300 GGLFVIETLSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAVGLAMLG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|127514384|ref|YP_001095581.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           loihica PV-4]
 gi|166221357|sp|A3QIM4|MRAY_SHELP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|126639679|gb|ABO25322.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           loihica PV-4]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 252/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +AM+    +GPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYTGFNVFSYVTFRAILGLLTAMVFSLWWGPKMIERLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL G+  S LLW D  S +V ++L +  +FGL+GF DDY 
Sbjct: 59  NEGPESHFAKRGTPTMGGLLILAGVFISVLLWGDLGSRYVWVMLFVLGAFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A+     L   +     G E +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALAIAFYLYASA-----GSEGETQLVLPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 AFFILLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|152998949|ref|YP_001364630.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS185]
 gi|166221356|sp|A6WIC8|MRAY_SHEB8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|151363567|gb|ABS06567.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           baltica OS185]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   ++   +V  YVTFR+     +A++    FGPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALVFSLWFGPKLIERLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A+L    L   + +       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALLIAFFLYATAAN-----PGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI  A F IV  +NAVNLTDGLDGLAI+P ++ + AF+ IAY++G+   ++YL +  +
Sbjct: 174 AVFIVLAYFTIVGASNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHAQFANYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGTIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|332991937|gb|AEF01992.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alteromonas sp.
           SN2]
          Length = 360

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LAD+   +    +V  Y+T R+  +  +A+LI    GPK+I  L+++Q   GQ VR
Sbjct: 1   MLIWLADWLTQFDTGFNVFSYLTLRAILSTLTALLIAILIGPKMIRYLQTMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S LLWAD S+ +V + L + +S+G++GF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILAAIVVSVLLWADLSNRYVLVTLAVVVSYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +   + ++AI     L      +   +  +TS++ PFF+++   +G
Sbjct: 119 KVIRKDSKGLIARWKYFWQSVVAIGVAFFLY-----SSATLSAETSLLIPFFKEVFPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI    F IV T+NAVNLTDGLDGLAIVP ++ + AF+  AYV GN  L+ YL +  +
Sbjct: 174 AFFIIITYFAIVGTSNAVNLTDGLDGLAIVPTILVAGAFAIFAYVTGNANLADYLNIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G +AV  + EI+LII+
Sbjct: 234 PLTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGTLGVLAVLVRQEIVLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS I  ++G
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|114570631|ref|YP_757311.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Maricaulis maris
           MCS10]
 gi|122315580|sp|Q0AMW4|MRAY_MARMM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|114341093|gb|ABI66373.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Maricaulis maris
           MCS10]
          Length = 367

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 184/368 (50%), Positives = 254/368 (69%), Gaps = 3/368 (0%)

Query: 1   MFIQLA-DFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    ++ + + ++ +Y+TFR+  A  +AMLI F FG  +I  LR  Q   GQP+R
Sbjct: 1   MLYLLFAPLADDFQLANLFRYITFRTGGALMTAMLIAFVFGKPMIGWLRRKQGK-GQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
              +  H   K  TPTMGG +IL+G++  +LLWAD ++ +V I++ +T  FG++GF DDY
Sbjct: 60  AEGIERHVVEKAGTPTMGGFLILLGVMVGTLLWADLTNAYVWIVIFVTAGFGVIGFIDDY 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K+T     G  G+ +++ EF IA++AV      + S  +    +TSI  PFF+D+++++
Sbjct: 120 LKVTKQTTAGFGGRFKLVGEFAIALIAVVWATHTARSLGVEPGIETSIAVPFFKDLMINI 179

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G  F  F   VIV + NAVN+TDGLDGLAIVPVMIA+  F  IAYV G +  + YLQV++
Sbjct: 180 GPLFFVFGCVVIVGSGNAVNMTDGLDGLAIVPVMIAAATFGVIAYVVGRVDFAEYLQVHY 239

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
             G GE+++   ALIGAGIGFLW+N  PA++FMGDTGSL+LG  +G IAV+ KHE++L I
Sbjct: 240 TAGAGEILIFCGALIGAGIGFLWWNAPPAMVFMGDTGSLSLGGALGTIAVAIKHELVLAI 299

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+E +SV++QV  FK+  KRVF MAPIHHHFEKKGW E  IVIRFWII+ I A+I
Sbjct: 300 VGGLFVLELVSVMVQVASFKLFGKRVFRMAPIHHHFEKKGWAEPTIVIRFWIIAVILALI 359

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 360 GLATLKLR 367


>gi|329118768|ref|ZP_08247466.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327465115|gb|EGF11402.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 407

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 159/367 (43%), Positives = 230/367 (62%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ L  FS      ++ +Y TFR+  A  +A+      GP  I  L +L+   GQ VR 
Sbjct: 48  MFVWLYRFSGSLSALNIFQYTTFRAVMAALTALAFSLLLGPWAIRKLTALK--VGQAVRT 105

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S +LW  + + +V I+L + L+ G +GFYDD+ K
Sbjct: 106 DGPQTHLIKNGTPTMGGSLILTAIAVSVILWGRWENPYVWILLGVLLATGALGFYDDWRK 165

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPF-FRDIILDMG 179
           +   D  G+S K +I+ +  +A+ A   LL+  ++        ++++ PF     +   G
Sbjct: 166 VVYKDPNGVSAKFKIVWQTAVALAAGGLLLWSLDAH-----LYSNLLIPFLKNYYLPIGG 220

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F      VIV T+NAVNLTDGLDGLA  PV++ +   +  AY++G+   + YL + FV
Sbjct: 221 IGFAVLTYLVIVGTSNAVNLTDGLDGLAAFPVVLVAGGLAVFAYISGHYGFAGYLNMPFV 280

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GE+ V  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G  AV  + EI+L I+
Sbjct: 281 KGAGEVAVFCAAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTAAVIVRQEIVLFIM 340

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IG
Sbjct: 341 GGLFVVEAVSVMLQVGWYKRTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIG 400

Query: 360 LLTLKMR 366
           L +LK+R
Sbjct: 401 LSSLKIR 407


>gi|284008377|emb|CBA74782.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Arsenophonus
           nasoniae]
          Length = 360

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   ++  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKYFSGFNLFSYLTFRAITSLLTALVIALWMGPHLIFYLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S +LWA  ++ +V  +L++ L +G++GF DDY 
Sbjct: 59  DEGPESHFSKRGTPTMGGVLILSSIVISVMLWARLNNPYVWCVLVVLLGYGVIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +A GL  + +   + ++A+     L      T +     T +V PFF+D++  +G
Sbjct: 119 KVVRKNAKGLIARWKYFWQSLLALGVAFVLYSTGKDTAV-----TQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P +  S  F+ +A+  GN   ++YL++ ++
Sbjct: 174 LFYILLTYFVIVGTSNAVNLTDGLDGLAIMPTVFISAGFALVAWATGNFNFANYLKIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 NHAGELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKVR 360


>gi|149190165|ref|ZP_01868441.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio shilonii
           AK1]
 gi|148836054|gb|EDL53015.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio shilonii
           AK1]
          Length = 360

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GPK+I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGLSLWMGPKMIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLW+D S+ +V  +L++ L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILFAITLTVLLWSDLSNPYVWAVLVVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA+    AL  +   T       T +V PFF+D++  MG
Sbjct: 119 KVVRKNTDGLIARWKYFWQSVIALFVAFALYAHGQDT-----AATQLVVPFFKDVMPQMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I F  FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LFYIVFTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PYTSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|242238097|ref|YP_002986278.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dickeya dadantii
           Ech703]
 gi|242130154|gb|ACS84456.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dickeya dadantii
           Ech703]
          Length = 360

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   + Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVKIYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLIAWLQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S LLW + S+ +V  +LL+ L +G+VGF DDY 
Sbjct: 59  SEGPESHFSKRGTPTMGGVMILASIVISVLLWVNLSNPYVWCVLLVLLGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A++   ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSLLALVVAFSMYAIGKGT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYIVLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKVR 360


>gi|39936595|ref|NP_948871.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris CGA009]
 gi|61214139|sp|Q6N408|MRAY_RHOPA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|39650451|emb|CAE28974.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris CGA009]
          Length = 361

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 202/367 (55%), Positives = 260/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L D S  +   +V +Y+TFR+  A  +  L VF FGP +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLIDLSSSFPAFNVFRYITFRTGGAMVTGALFVFMFGPWIIDNLRLRQGK-GQPIRT 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL   +LLWA+  + +V I+L +TL FG VGFYDDY+
Sbjct: 60  DGPQSHLMTKKGTPTMGGLMILSGLTVGTLLWANPLNPYVWIVLAVTLGFGFVGFYDDYM 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G+SG+ R+LIEF IA  A  AL++   +        +S+V PFF++++L++G
Sbjct: 120 KVTKQTHAGISGRTRLLIEFTIAGAACFALVWLGRA-----PLSSSLVIPFFKEVMLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+ F AFV+V   NAVNLTDGLDGLAIVPVMIA+ +F  I+Y+AGN + + YLQ+N+V
Sbjct: 175 WAFVVFGAFVVVGAGNAVNLTDGLDGLAIVPVMIAAASFGLISYLAGNAVFAEYLQINYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFKMAPIHHHFEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|227822654|ref|YP_002826626.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           fredii NGR234]
 gi|254813248|sp|C3MEN2|MRAY_RHISN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|227341655|gb|ACP25873.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           fredii NGR234]
          Length = 366

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 216/367 (58%), Positives = 281/367 (76%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + ++++   ++ +Y+TFR+ AA F++ LIVF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLIWLVELADHFQFFNLFRYITFRTGAALFTSALIVFLFGPAIISSLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++GS+LLWAD SS++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGIVGSALLWADLSSIYVVSTLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNS-TLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  + S    G    +S+ FPFF+D++L++G
Sbjct: 120 VTKQSDKGFSGKARLGIEFVIAAIAVFFMMQAAQSAGSAGSTFGSSVTFPFFKDLMLNLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F  FVIV   NAVNLTDGLDGLAIVPVMIAS AF  IAY+AGN + ++YLQ++FV
Sbjct: 180 YFFVLFGGFVIVGAGNAVNLTDGLDGLAIVPVMIASAAFGLIAYLAGNAVFANYLQIHFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V++ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI+++II
Sbjct: 240 PGTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVMVII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QV +FK T +RVFLMAPIHHHFEKKGWTE+Q+VIRFWII+ I A++G
Sbjct: 300 GGLFVIETLSVIIQVFWFKRTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVILAMVG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|91228511|ref|ZP_01262433.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           alginolyticus 12G01]
 gi|254230421|ref|ZP_04923801.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp. Ex25]
 gi|262395262|ref|YP_003287116.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp. Ex25]
 gi|269967388|ref|ZP_06181448.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           alginolyticus 40B]
 gi|91187945|gb|EAS74255.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           alginolyticus 12G01]
 gi|151937054|gb|EDN55932.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp. Ex25]
 gi|262338856|gb|ACY52651.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp. Ex25]
 gi|269827976|gb|EEZ82250.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           alginolyticus 40B]
          Length = 360

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y     + +Y++FR+  +  +A+ +    GP +I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYLSFFRLFEYLSFRAILSVLTALGLSLWMGPIMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D S+ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAISITILLWTDLSNPYVWAVLTVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA +   AL  Y   T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSLIAFVVAFALYAYGKDT-----AATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  S YL + ++
Sbjct: 174 LMYIILTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFSEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|114763026|ref|ZP_01442456.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pelagibaca
           bermudensis HTCC2601]
 gi|114544350|gb|EAU47358.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius sp.
           HTCC2601]
          Length = 360

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 191/366 (52%), Positives = 252/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L + S+   + ++ +Y+TFR+  AF +A++  F FG  +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLTELSDGGDLFNLFRYITFRAGGAFLTALIFGFIFGRPLIDVLRKRQGK-GQPIRN 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V ++L +T+ +  +GF DDY K
Sbjct: 60  DGPEGHFVKAGTPTMGGLLIVGALLTSTLLWARLDNPFVWMVLFVTMGYAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   +  G+SGK+R+L+ F+IA LA     ++        E    + FP F++ +LD+G+
Sbjct: 120 VAKQNTAGVSGKIRLLLGFLIAGLAAGWAAWH-----HPAELTGELAFPVFKNALLDLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PFA  VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G    + YL V++VP
Sbjct: 175 FFVPFAMIVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGIIAYAVGRTDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 GTGEILIFCAGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVFYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|148559364|ref|YP_001259327.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ovis
           ATCC 25840]
 gi|166219010|sp|A5VRI0|MRAY_BRUO2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|148370621|gb|ABQ60600.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ovis
           ATCC 25840]
          Length = 360

 Score =  289 bits (739), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 203/366 (55%), Positives = 274/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++L++++ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA +A   ++             +S+ FPF + +++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQE-----PFSSSLTFPFVKQLVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFI FAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFILFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|86749114|ref|YP_485610.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris HaA2]
 gi|123292784|sp|Q2IYL1|MRAY_RHOP2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|86572142|gb|ABD06699.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris HaA2]
          Length = 361

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 202/367 (55%), Positives = 259/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L DFS  +   +V +Y+TFR+  A  +  L VF  GP +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLIDFSSSFPAFNVFRYITFRTGGAVVTGALFVFLCGPWIIDNLRLRQGK-GQPIRA 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL   ++LWA+  + +V I+L +TL FG VGFYDDY+
Sbjct: 60  DGPQSHLVTKRGTPTMGGLMILSGLTVGTVLWANPLNPYVWIVLAVTLGFGFVGFYDDYM 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G+SG+ R+LIEF IA  A  AL++            +S+V PFF++++L++G
Sbjct: 120 KVTKQTHAGISGRTRLLIEFAIAGAACFALVWLGR-----GSLSSSLVIPFFKEVVLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +F+ F AFVIV   NAVNLTDGLDGLAIVPVMIA+ +F  I+Y+ GN + + YLQ+N+V
Sbjct: 175 WYFVIFGAFVIVGAGNAVNLTDGLDGLAIVPVMIAAASFGMISYLVGNAVFAEYLQINYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ I A+ G
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFRMAPIHHHFEQKGWTEPQIVIRFWIIAVILALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|85058424|ref|YP_454126.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sodalis
           glossinidius str. 'morsitans']
 gi|97179635|sp|Q2NVV4|MRAY_SODGM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|84778944|dbj|BAE73721.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Sodalis
           glossinidius str. 'morsitans']
          Length = 360

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   ++Y   +V  Y+TFR+  +  +A+ +    GP++I  L+ LQ    Q VR
Sbjct: 1   MLVWLAEHLVQFYSGFNVFSYLTFRAIVSLLTALFLSLWMGPRLIAWLQKLQIA--QVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLVGYGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA+     +      T       T +  PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIVRWKYFWQSVIALAVAFTMFAVGKDT-----PATQLAVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L+++  A FVIV T+NAVNLTDGLDGLAI+P +  +   + +A+  GN+  + YL + +V
Sbjct: 174 LWYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGLALVAWATGNMNFAGYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RFAGELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|221638510|ref|YP_002524772.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides KD131]
 gi|254813251|sp|B9KNJ3|MRAY_RHOSK RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|221159291|gb|ACM00271.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           sphaeroides KD131]
          Length = 360

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 203/366 (55%), Positives = 255/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  FS+   I ++ +Y+TFR+ AAFF+A++  F FG  +ID LR  Q   GQP+R 
Sbjct: 1   MLYLLTAFSDGGDIFNLFRYLTFRAGAAFFTALIFGFLFGRPLIDFLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L+ S+LLWA   + +V I+LL+T++FGL+GF DDY K
Sbjct: 60  DGPTTHFAKAGTPTMGGLLILSALVVSTLLWARLDNPYVWIVLLVTVAFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   +  G+ G+VR LI  +IA LA  A  +         +    +  PFF+D ++++G 
Sbjct: 120 VKKQNTKGVPGRVRFLIGLLIAALAAIAAAWS-----HPPDLTLQLAMPFFKDALINLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PFA  VIV  ANAVNLTDGLDGLAI+PVMIA      IAYV GN  L+ YL V+FVP
Sbjct: 175 FFVPFAMVVIVGAANAVNLTDGLDGLAIMPVMIAGTTLGVIAYVVGNFNLTDYLGVHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL++  SAL+G G+GFLW+N  PA +FMGDTGSLAL   +G IAV TKHEI+L I+G
Sbjct: 235 GTGELLIFSSALVGGGLGFLWYNAPPAAVFMGDTGSLALSGALGAIAVCTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E LSVI+QV YFK T +RVFLMAPIHHHFEKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVTEALSVIIQVLYFKRTGRRVFLMAPIHHHFEKKGWAEPQIVIRFWIISLILALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|218532975|ref|YP_002423791.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           chloromethanicum CM4]
 gi|240141486|ref|YP_002965966.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           extorquens AM1]
 gi|254564000|ref|YP_003071095.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           extorquens DM4]
 gi|254813242|sp|B7KU72|MRAY_METC4 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|218525278|gb|ACK85863.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           chloromethanicum CM4]
 gi|240011463|gb|ACS42689.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           extorquens AM1]
 gi|254271278|emb|CAX27290.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           extorquens DM4]
          Length = 360

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 197/366 (53%), Positives = 252/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ S      +V +Y+TFR+  A F+A   VF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLYLLSELSGTLTPLNVFRYITFRTGGALFTAGFFVFWFGPWIISLLRLRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL G + S LLW +  + +V + L +TL FG +GFYDDY+K
Sbjct: 60  DGPASHLTKRGTPTMGGLMILAGAVVSILLWTNPHNHYVWVTLAVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SG+ R+L+EF IA  A   +  YS +       +  + FP  +D +L++G 
Sbjct: 120 VTKQSHKGFSGRFRLLLEFAIAGAACLMISLYSPAG-----LQNQLAFPVLKDTLLNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PFAAFVIV   NAVN+TDGLDGLAIVPVMIA   F  IAY+ GN++ + YLQVN+V 
Sbjct: 175 FWVPFAAFVIVGAGNAVNITDGLDGLAIVPVMIACATFGIIAYLVGNVIYAGYLQVNYVR 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GEL VV  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L I+G
Sbjct: 235 DTGELAVVCGAVIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGSIAVAAKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGW E Q+VIRFWII+ I A++GL
Sbjct: 295 GLFVLEIMSVIIQVVSFKLTGKRVFRMAPIHHHFEQKGWKEPQVVIRFWIIAVILALVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|332531946|ref|ZP_08407830.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038573|gb|EGI75016.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 360

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 175/367 (47%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   HV  Y+T R+     +A+++    GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLTQYFSGFHVFSYLTLRAILGILTALIMSLYLGPKLIRGLQRMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWAD S+ +V   L +  S G+VGF DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGLLILAAIFTSTLLWADLSNKYVWATLFVIGSLGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +   + +IA++   AL F S        ++TS+V PFF+D++  +G
Sbjct: 119 KVIRKDPKGLIAKWKYFWQSVIALVVATALYFTSAQA-----SETSLVVPFFKDVLPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    F IV T+NAVNLTDGLDGLAIVP+++ + A + IAY+ GNI  S YL +  +
Sbjct: 174 LFYIVLTYFAIVGTSNAVNLTDGLDGLAIVPIILVAAALAIIAYLTGNINFSAYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LLII+
Sbjct: 234 PLASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLVRQELLLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  + G
Sbjct: 294 GGVFVMEALSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISVVLVLAG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|294677020|ref|YP_003577635.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           capsulatus SB 1003]
 gi|294475840|gb|ADE85228.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacter
           capsulatus SB 1003]
          Length = 360

 Score =  288 bits (738), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 194/366 (53%), Positives = 252/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+ S+     ++ +Y+TFR+  AFF+A++  F FG  +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLANLSDGGDFFNLFRYITFRAGGAFFTALIFGFLFGRPLIDMLRRKQGK-GQPIRN 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L+ ++LLWA   + +V I+L +T  +  +GF DDY K
Sbjct: 60  DGPATHFAKAGTPTMGGLLILSALLFATLLWARLDNGYVWIVLGVTYGYAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T  +  G+SG+ R+ +      LA+ AL     + +   E    +  P F+D+++++G+
Sbjct: 120 VTKQNVKGVSGRTRMAL-----GLALAALAAVFAALMHPPELTNMLALPVFKDVLINLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PFA FVIV  ANAVNLTDGLDGLAI+PVMIA+     IAYV G    + YL VNFVP
Sbjct: 175 FFVPFAMFVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGGIAYVVGRADFTQYLGVNFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V  +ALIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHE++L ++G
Sbjct: 235 GTGELFVFTAALIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVCTKHELVLGVVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHHFEKKGW E QIVIRFWI+S + A+IGL
Sbjct: 295 GLFVVEALSVIIQVAYFKATGKRVFLMAPIHHHFEKKGWAEPQIVIRFWIVSLVLALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKIR 360


>gi|239832312|ref|ZP_04680641.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ochrobactrum
           intermedium LMG 3301]
 gi|239824579|gb|EEQ96147.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ochrobactrum
           intermedium LMG 3301]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 207/366 (56%), Positives = 272/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMLLTFFAEHMTPLNVFRYITFRTGGAMITSALIVFLFGPSIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S +LWA+ SS++V ++LL+T+ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILVSCMLWANLSSVYVWVVLLVTVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA  A   ++             +S+ FPF +  ++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAAAAFIIMRAGQE-----PFSSSLTFPFAKQFVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QVG FK+T KRVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVVEALSVIIQVGSFKLTGKRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|89074173|ref|ZP_01160672.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           sp. SKA34]
 gi|89050109|gb|EAR55635.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           sp. SKA34]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA+ F        + +Y+TFR+  +  +A+L     GP++I  L+ LQ   GQ VR
Sbjct: 1   MIYWLAEQFQSTLPFFRLFEYLTFRAIMSILTALLFSLWMGPRMIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D S+ +V  +L++ L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAITFTVLLWCDLSNPYVWAVLVVMLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAYGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P ++ S   +FIA+  GN   + YL + ++
Sbjct: 174 LFYIVMTYFVIVGTSNAVNLTDGLDGLAIMPTVMVSAGLAFIAWATGNFNYAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV++ +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LL+I+
Sbjct: 234 KDAGELVILCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  +I 
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|78221630|ref|YP_383377.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           metallireducens GS-15]
 gi|97176677|sp|Q39YM2|MRAY_GEOMG RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|78192885|gb|ABB30652.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           metallireducens GS-15]
          Length = 358

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 178/367 (48%), Positives = 240/367 (65%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  + I +V KY+TFR+  A  +A+L+ F  GP VI  L +LQ    Q +R
Sbjct: 1   MLYHLLYPLASDFRIFNVFKYLTFRTIYAVITALLVSFILGPWVIRKLEALQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL  ++  +LLWAD ++ +V   L + + +GL+GF DDY 
Sbjct: 59  TDGPESHLKKSGTPTMGGILILASIVIPTLLWADLTNRYVWTTLFVIVGYGLIGFTDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + +IA +AVC L+F  N         T + FPFF+ +  D+ 
Sbjct: 119 KVVEKNPKGLSPRQKMAGQLLIAGMAVCFLVFVVN-------MSTELAFPFFKRLHPDLS 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+IPFA  VIV  +NAVNLTDGLDGLAI PV I +  +    Y+AGN  LS YLQ  +V
Sbjct: 172 WFYIPFAMLVIVGASNAVNLTDGLDGLAIGPVAINAATYLLFTYIAGNAKLSSYLQTPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAGIGFLW+N  PA +FMGD GSL+LG  +G +AV TK EILL+I+
Sbjct: 232 PGAGELAVLCGAMVGAGIGFLWYNAYPAEVFMGDVGSLSLGGGLGTLAVITKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGVFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLK+R
Sbjct: 352 ISTLKLR 358


>gi|294852760|ref|ZP_06793433.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           NVSL 07-0026]
 gi|294821349|gb|EFG38348.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           NVSL 07-0026]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 203/366 (55%), Positives = 274/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++L++++ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA +A   ++             +S+ FPF + +++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQE-----PFSSSLTFPFVKQLVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FV 
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVS 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FKMT +RVFLMAPIHHHFEKKGWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|225627885|ref|ZP_03785921.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           str. Cudo]
 gi|256160168|ref|ZP_05457862.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M490/95/1]
 gi|256255374|ref|ZP_05460910.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           B1/94]
 gi|260169106|ref|ZP_05755917.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           F5/99]
 gi|261222576|ref|ZP_05936857.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           B1/94]
 gi|261758613|ref|ZP_06002322.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           F5/99]
 gi|265998541|ref|ZP_06111098.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M490/95/1]
 gi|225617048|gb|EEH14094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           str. Cudo]
 gi|260921160|gb|EEX87813.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           B1/94]
 gi|261738597|gb|EEY26593.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella sp.
           F5/99]
 gi|262553165|gb|EEZ08999.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brucella ceti
           M490/95/1]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 203/366 (55%), Positives = 274/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L  F+E+    +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLMFLTHFAEHVTPFNVFRYITFRTGGAMITSALIVFLFGPTIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I+ G++ S LLWA+ +S++V ++L++++ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIMTGILASCLLWANLASVYVWVVLMVSVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ IEF+IA +A   ++             +S+ FPF + +++++  
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAAFTIMRAGQE-----PFSSSLTFPFVKQLVINLSW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFV+V   NAVNLTDGLDGLAIVPVM+A+ +F FIAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMVAAASFGFIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FKMT +RVFLMAPIHHHFEK GWTE+Q+VIRFWI++ I A+IGL
Sbjct: 295 GLFVMEALSVIIQVGFFKMTGRRVFLMAPIHHHFEKNGWTESQVVIRFWIVAIILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|123441029|ref|YP_001005018.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|166221377|sp|A1JJJ0|MRAY_YERE8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|122087990|emb|CAL10778.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLIAYLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + IIA+ A  A+      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSIIALAAAFAMYSIGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNVNFAAYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|59712811|ref|YP_205587.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio fischeri
           ES114]
 gi|71648710|sp|Q5E2P7|MRAY_VIBF1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|59480912|gb|AAW86699.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Vibrio fischeri
           ES114]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I L++F E Y+    + +Y++FR+  +  +A+ I    GPK+I  L++LQ   GQ VR
Sbjct: 1   MIIWLSNFLEQYFPFFRLFEYLSFRAILSIITALTISLWMGPKLIAWLQNLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  +  LWAD ++ +V  ++ + L +G VGF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGIMILTAITVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF++++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSSIALVVAFALYAYGKDT-----AATQLVVPFFKEVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P +  +  F+FIA+  GN+  ++YL +  +
Sbjct: 174 LAYILLTYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFAFIAWATGNVQFANYLHIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PLASELVVVCAAIVGAGFGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +I 
Sbjct: 294 GGVFVVETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMLLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|317493282|ref|ZP_07951704.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918675|gb|EFV40012.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ +    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFLSLWIGPRMIARLQKM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + L +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILTSITISVLMWAYPSNPYVWCVLFVLLGYGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA++   A+      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTKGLIARWKYFWQSVIALVVSFAMYSIGKGT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  + FVIV T+NAVNLTDGLDGLAI+P +  +     +A+  GN+  + YL + ++
Sbjct: 174 LLYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGMGLVAWATGNMNFAAYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|261345647|ref|ZP_05973291.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Providencia
           rustigianii DSM 4541]
 gi|282566129|gb|EFB71664.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Providencia
           rustigianii DSM 4541]
          Length = 360

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+     + + +V  Y+TFR+  +  +A++I    GP +I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAELLVHKFSVFNVFSYLTFRAIVSLLTALIIALWMGPHLIAYLQKMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA   + +V  +LL+ + +G+VGF DDY 
Sbjct: 59  SEGPESHFSKRGTPTMGGILILFSICVSVLLWARLENPYVWCVLLVLVGYGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A++   ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALVVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ IA+  GN+  + YL + F+
Sbjct: 174 LLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALIAWATGNVNFASYLHIPFL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|254428785|ref|ZP_05042492.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alcanivorax sp.
           DG881]
 gi|196194954|gb|EDX89913.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alcanivorax sp.
           DG881]
          Length = 360

 Score =  288 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+    V++Y+T R   +  +A+ I F  GP +I  L+  Q   GQ +R
Sbjct: 1   MLLWLAEYLAQYHSGFLVVQYITLRGILSVLTALFIAFWVGPIMIRKLQEKQ--VGQAIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ S+LLW D  +  V I L +   FG VG+ DD+ 
Sbjct: 59  DDGPKSHLSKAGTPTMGGALILVAIVISTLLWGDLENRFVWITLGVLFIFGAVGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + + L   + A+ A CAL F + S       +T ++ PFF+ + ++MG
Sbjct: 119 KVVEKNPRGLPARWKYLWLSVGALGAGCALFFTAQS-----PVETQLIVPFFKSVAINMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I    FVI  T+NAVNLTDGLDGLAI+P ++   A    AY  G+   + YLQ+ +V
Sbjct: 174 WFYIVLTYFVINGTSNAVNLTDGLDGLAIMPTVLVGGALGIFAYAGGHTEFATYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GELV++ +AL GAG+GFLWFN  PA +FMGD G+L+LGA +G +AV  + EI+L I+
Sbjct: 234 AGAGELVIISAALCGAGLGFLWFNAYPAQVFMGDVGALSLGAVLGVMAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QVG +K+T +R+F MAPIHHHFE KGW E +I++RFWII+ I  ++G
Sbjct: 294 GGVFVMETVSVMLQVGSYKLTGRRIFRMAPIHHHFELKGWPEPKIIVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|52842823|ref|YP_096622.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629934|gb|AAU28675.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 372

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 169/368 (45%), Positives = 244/368 (66%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y    V +Y+TFRS  A  +A+++    GP +I  LR LQ   GQ VR
Sbjct: 12  MLYWLTQLLQGQYHAFRVFQYLTFRSILASLTALIVGLLCGPLMIRWLRGLQ--IGQMVR 69

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  S LLW D     + ++LL+TL+ GLVG+ DDY 
Sbjct: 70  SDGPQTHLSKAGTPTMGGVLILLAITVSCLLWCDLRQTSLWLVLLVTLANGLVGWVDDYR 129

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL G+ +   + +IA++AV  L + +      +   T +  PFF+ +  D+G
Sbjct: 130 KLVLKNSKGLPGRWKYFWQSVIALVAVSYLYWNA-----SLPVHTQLTVPFFKTVTWDLG 184

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF   A FVIV ++NAVNLTDGLDGLAI+P+++ + A    AY + N + S+YL + +V
Sbjct: 185 VFFPVLAYFVIVGSSNAVNLTDGLDGLAIMPIVMVAGALGVFAYASSNAVYSNYLGIPYV 244

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  S+++GAG+GFLW+N  PA +FMGD GSLALGA +G +AV  + E++L+I+
Sbjct: 245 PNTGELTIFCSSIVGAGLGFLWYNSYPAQVFMGDVGSLALGAALGIVAVVVRQELVLLIM 304

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ETLSVI+QVGYFK +  KR+F MAP+HHHFE KGW+E ++++RFWII+ +F + 
Sbjct: 305 GGLFVIETLSVILQVGYFKYSGGKRLFRMAPLHHHFELKGWSEPKVIVRFWIITVVFVLC 364

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 365 GLATLKLR 372


>gi|197335417|ref|YP_002157000.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio fischeri
           MJ11]
 gi|226701001|sp|B5FB38|MRAY_VIBFM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|197316907|gb|ACH66354.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio fischeri
           MJ11]
          Length = 360

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I L++F E Y+    + +Y++FR+  +  +A+ I    GPK+I  L++LQ   GQ VR
Sbjct: 1   MIIWLSNFLEQYFPFFRLFEYLSFRAILSIITALTISLWMGPKLIAWLQNLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  +  LWAD ++ +V  ++ + L +G VGF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGIMILTAISVTVFLWADLTNPYVWAVMFVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF++++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSSIALVVAFALYAYGKDT-----AATQLVVPFFKEVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P +  +  F+FIA+  GN+  ++YL +  +
Sbjct: 174 LAYILLTYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFAFIAWATGNVQFANYLHIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PLASELVVVCAAIVGAGFGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +I 
Sbjct: 294 GGVFVVETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMLLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|120597218|ref|YP_961792.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           W3-18-1]
 gi|146291591|ref|YP_001182015.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           putrefaciens CN-32]
 gi|166221358|sp|A4Y2N3|MRAY_SHEPC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166221360|sp|A1REZ3|MRAY_SHESW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|120557311|gb|ABM23238.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           W3-18-1]
 gi|145563281|gb|ABP74216.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           putrefaciens CN-32]
 gi|319424765|gb|ADV52839.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           putrefaciens 200]
          Length = 360

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 248/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   +Y   +V  YVTFR+     +A++    +GPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTRFYTGFNVFSYVTFRAILGLLTALIFSLWWGPKLIERLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFVLGSFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A+L    L   + +       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALLIAFFLYATAAN-----PGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL +  +
Sbjct: 174 GVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|330446840|ref|ZP_08310491.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491031|dbj|GAA04988.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 360

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA+ F        + +Y+TFR+  +  +A+L     GP++I  L+ LQ   GQ VR
Sbjct: 1   MIYWLAEQFQSTIPFFRLFEYLTFRAIMSILTALLFSLWMGPRLIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D ++ +V  +L++ L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAITFTVLLWCDLTNPYVWAVLIVMLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAYGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P ++ S   +FIA+  GN   + YL + ++
Sbjct: 174 LFYIVMTYFVIVGTSNAVNLTDGLDGLAIMPTVMVSAGLAFIAWATGNFNYAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LL+I+
Sbjct: 234 KDAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  +I 
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|322834423|ref|YP_004214450.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rahnella sp.
           Y9602]
 gi|321169624|gb|ADW75323.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rahnella sp.
           Y9602]
          Length = 360

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ +    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFLSLWIGPRMIARLQKM--SFGQIVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + L +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILASITISVLMWAYPSNPYVWCVLFVLLGYGVVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA+ A   +      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALAAAFTMYAIGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  + FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LMYILLSYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|254362464|ref|ZP_04978572.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mannheimia
           haemolytica PHL213]
 gi|153094056|gb|EDN74968.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mannheimia
           haemolytica PHL213]
          Length = 360

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    Y    +V+ Y+TFR+  A  +AM I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAELLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPKVIRRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  +  S+LLWAD  + +V   L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGVMILAAIGVSTLLWADLRNSYVWFTLFVLFGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI+  +  GL  + +      IA++AV  +      T       T +V PFF+D++  +G
Sbjct: 119 KISRKNTDGLIARWKYFWLSAIALVAVFGMYAVGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + F+
Sbjct: 174 LFYIVLSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+++
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGVIAVLVRQELLLVVM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW+E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWSEPRVIVRFWIITLMLVLVG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|153835404|ref|ZP_01988071.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio harveyi
           HY01]
 gi|269960238|ref|ZP_06174613.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio harveyi
           1DA3]
 gi|148868060|gb|EDL67235.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio harveyi
           HY01]
 gi|269835045|gb|EEZ89129.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio harveyi
           1DA3]
          Length = 360

 Score =  288 bits (737), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y     + +Y++FR+  +  +A+ +    GP +I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYLSFFRLFEYLSFRAILSVLTALGLSLWMGPIMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D S+ +V  +L + L +G +GF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAISITILLWTDLSNPYVWAVLTVLLGYGAIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA +   AL  Y   T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSLIAFVVAFALYAYGKDT-----AATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  S YL + ++
Sbjct: 174 LMYIILTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFSEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|118590895|ref|ZP_01548295.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stappia
           aggregata IAM 12614]
 gi|118436417|gb|EAV43058.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stappia
           aggregata IAM 12614]
          Length = 361

 Score =  288 bits (737), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 203/367 (55%), Positives = 263/367 (71%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L  F++     +V +Y+TFR+  A  +A+  VF FGPK+I  LR  Q   GQP+R 
Sbjct: 1   MFYFLGLFADQISALNVFRYITFRTGGAIMTALFFVFLFGPKIISSLRIRQGH-GQPIRA 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL G + ++LLW+D S+ +V +++ +TL FG +GFYDDY+
Sbjct: 60  DGPESHLLSKKGTPTMGGLMILSGALVAALLWSDLSNPYVWVVIGVTLGFGSIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G  GK R+ +EF+IA  A  A+    +S     E   +I FPF +D+ L++G
Sbjct: 120 KVTKSSHKGFGGKARLGLEFLIAGSAAFAVTLLDSS-----EYSEAITFPFIKDLTLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LFFIPFAAFV+V   NAVNLTDGLDGLAIVPVMIA  +F  +AY++GN + + YLQ++ V
Sbjct: 175 LFFIPFAAFVMVGAGNAVNLTDGLDGLAIVPVMIACASFGLVAYLSGNAVFASYLQIHHV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+TKHEI+L II
Sbjct: 235 AGTGELAVICGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMIGAIAVATKHEIVLAII 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  +K+T KRVF MAPIHHHFE +GWTE+Q+VIRFWIIS + A+IG
Sbjct: 295 GGLFVLEAVSVIVQVFSYKLTGKRVFRMAPIHHHFELQGWTESQVVIRFWIISVVLALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|126726616|ref|ZP_01742456.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacterales
           bacterium HTCC2150]
 gi|126703945|gb|EBA03038.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodobacterales
           bacterium HTCC2150]
          Length = 361

 Score =  288 bits (737), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 191/367 (52%), Positives = 255/367 (69%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AFF+A++  F FG  +I+ L+  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDAFNLFRYITFRAGGAFFTALIFGFMFGQPLINLLKRKQ-KNGQPIRE 59

Query: 61  PNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL  ++  +LLWA + + +V I L +T SFG +GF DDY 
Sbjct: 60  DGPESHILAKAGTPTMGGVLILGSVLVGTLLWARWDTPYVWITLFVTFSFGAIGFIDDYR 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+  +VR+L+ F+IA +A         +       +  +  P F+D +++ G
Sbjct: 120 KVTQNNVAGVPARVRLLLGFLIAGIAAYC-----ATLAHPEALQYKVALPVFKDALINFG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+PF  FVIV +AN+VNLTDGLDGLAI+PVMIA+VA   IAY  G +  S YL++++V
Sbjct: 175 WFFLPFTMFVIVGSANSVNLTDGLDGLAIMPVMIAAVALGVIAYAVGRVDFSEYLELHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V ++AL+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L II
Sbjct: 235 PGTGELLVFVAALVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLGII 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFVVE LSVI+QV YFK T KRVFLMAPIHHHFEK+GW E+QIVIRFWII+ I A+IG
Sbjct: 295 GGLFVVEALSVIIQVLYFKSTGKRVFLMAPIHHHFEKRGWAESQIVIRFWIIALILALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKVR 361


>gi|90580225|ref|ZP_01236032.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio angustum
           S14]
 gi|90438527|gb|EAS63711.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio angustum
           S14]
          Length = 360

 Score =  288 bits (737), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA+ F        + +Y+TFR+  +  +A+L     GP++I  L+ LQ   GQ VR
Sbjct: 1   MIYWLAEQFQSTLPFFRLFEYLTFRAIMSILTALLFSLWMGPRMIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D S+ +V  +L++ L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAITFTVLLWCDLSNPYVWAVLVVMLGYGTVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  Y   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAYGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P ++ S   +FIA+  GN   + YL + ++
Sbjct: 174 LFYIVMTYFVIVGTSNAVNLTDGLDGLAIMPTVMVSAGLAFIAWATGNFNYAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV++ +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LL+I+
Sbjct: 234 KNAGELVILCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  +I 
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|85703612|ref|ZP_01034716.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius sp.
           217]
 gi|85672540|gb|EAQ27397.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius sp.
           217]
          Length = 360

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 188/366 (51%), Positives = 255/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  +S+     ++ +Y+TFR+  AF +A++  F FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLYWLTIWSDGGDFFNLFRYITFRAGGAFMTALIFGFLFGPPLILVLRKRQGK-GQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   + +V ++L +T++FGL+GF DDY K
Sbjct: 60  DGPEGHFSKAGTPTMGGLLIVGALLTSTLLWARLDNPYVWLVLFVTVAFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+S K R+ + F+IA +A      +        E +  +  P F+D++++MG 
Sbjct: 120 VSKQNVKGVSSKARLGLGFVIAFIAAYWAGLH-----HPTELQYQLALPVFKDVLVNMGF 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPFA FVIV  ANAVNLTDGLDGLAI+PVMIAS A   IAY  G +  + YL +++VP
Sbjct: 175 LFIPFAMFVIVGAANAVNLTDGLDGLAIMPVMIASAALGVIAYTVGRVDFTDYLGLHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++ ++ L+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L I+G
Sbjct: 235 GTGEILIFVAGLVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLGIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWII+ I A++GL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIIALILAMVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|330501921|ref|YP_004378790.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           mendocina NK-01]
 gi|328916207|gb|AEB57038.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           mendocina NK-01]
          Length = 360

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLTLRGILGVLTALALSLWLGPWMIRTLQVRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++L +TL+FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKKGTPTMGGALILTAIAVSTLLWADLSNRYVWVVLAVTLAFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S       +T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLAAAAFLYLTAQS-----PVETTLILPLLKDVAIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV T+NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 VGFVVLTYFVIVGTSNAVNLTDGLDGLAILPTVMVGGALGIFCYLSGNVNFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V  +AL+GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGSGELIVFCAALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVIIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|332160409|ref|YP_004296986.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318607130|emb|CBY28628.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325664639|gb|ADZ41283.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859322|emb|CBX69669.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           enterocolitica W22703]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLIAYLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + IIA+ A  A+      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTKGLIARWKYFWQSIIALAAAFAMYSIGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNVNFAAYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|91977863|ref|YP_570522.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris BisB5]
 gi|123748895|sp|Q133W8|MRAY_RHOPS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|91684319|gb|ABE40621.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rhodopseudomonas
           palustris BisB5]
          Length = 361

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 202/367 (55%), Positives = 259/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L D S      +V +Y+TFR+  A  +  L VF  GP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLIDLSSSIPAFNVFRYITFRTGGAVVTGALFVFLCGPWIINNLRLRQGK-GQPIRS 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL   ++LWA+  + +V I+L +TL FG VGFYDDY+
Sbjct: 60  DGPQSHLVTKKGTPTMGGLMILSGLTVGTVLWANPVNPYVWIVLAVTLGFGFVGFYDDYM 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G+SG+ R+LIEF IA  A  AL++   S+L        +V PFF++++L++G
Sbjct: 120 KVTKQTHAGISGRTRLLIEFAIAGAACFALVWLGRSSLSSS-----LVIPFFKEVVLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +F+ F AFVIV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN + + YLQ+N+V
Sbjct: 175 WYFVIFGAFVIVGAGNAVNLTDGLDGLAIVPVMIAAASFGLIAYLAGNAVFADYLQINYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFRMAPIHHHFEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|261493187|ref|ZP_05989716.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496957|ref|ZP_05993324.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261307393|gb|EEY08729.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261311150|gb|EEY12324.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    Y    +V+ Y+TFR+  A  +AM I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAELLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPKVIRRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  +  S+LLWAD  + +V   L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGVMILAAIGVSTLLWADLRNSYVWFTLFVLFGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI+  +  GL  + +      IA++AV  +      T       T +V PFF+D++  +G
Sbjct: 119 KISRKNTDGLIARWKYFWLSAIALVAVFGMYAVGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + F+
Sbjct: 174 LFYIVLSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+++
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGVIAVLVRQELLLVVM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLVG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|162420692|ref|YP_001607298.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Angola]
 gi|229621811|sp|A9R127|MRAY_YERPG RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|162353507|gb|ABX87455.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Angola]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + IIA+ A   +      T     + T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTKGLIARWKYFWQSIIALAAAFTMYSIGKDT-----SATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFAAYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|183599904|ref|ZP_02961397.1| hypothetical protein PROSTU_03425 [Providencia stuartii ATCC 25827]
 gi|188022179|gb|EDU60219.1| hypothetical protein PROSTU_03425 [Providencia stuartii ATCC 25827]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    ++ + +V  Y+TFR+     +A+ I    GP++I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEILVHHFSVFNVFSYLTFRAIVGLLTALAIALWMGPRLITYLQKMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA   + +V  +LL+ + +GLVGF DDY+
Sbjct: 59  DVGPESHFSKRGTPTMGGILILFSISISVLLWARLDNPYVWCVLLVLVGYGLVGFADDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +IA++   ++    N T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNSRGLIARWKYFWQSVIALIVAFSMYAVGNET-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + F+
Sbjct: 174 MLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFASYLHIPFL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|89067943|ref|ZP_01155387.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanicola
           granulosus HTCC2516]
 gi|89046541|gb|EAR52597.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanicola
           granulosus HTCC2516]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 191/366 (52%), Positives = 249/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFLTALVFGFQFGPPLINVLRKHQGK-GQPIRT 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+     S+LLWA   +  V ++L +TL+F  +GF DDY K
Sbjct: 60  DGPEGHFVKAGTPTMGGLLIVGACATSTLLWARLDNPFVLMVLFVTLAFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  GLSGK R+ + F+IA +A         + +   E    + FP F+D++L+M L
Sbjct: 120 VSKQNTAGLSGKARLGLGFLIAAIAGVWF-----AQVHPEELSYQLAFPIFKDMLLNMSL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  VIV  ANAVNLTDGLDGLAI+PVMIA+  F  IAY  G    + YL V++VP
Sbjct: 175 LFVPFAMIVIVGAANAVNLTDGLDGLAIMPVMIAAGTFGIIAYAVGRTDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GE+++    LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHE++L+IIG
Sbjct: 235 DTGEILIFTMGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHELVLVIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW+E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIVQVLYFKRTGKRVFLMAPIHHHYEKKGWSEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|254515244|ref|ZP_05127305.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium NOR5-3]
 gi|219677487|gb|EED33852.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium NOR5-3]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y     V +Y+T R   A  +A+LI    GP +I  L   Q   GQ VR
Sbjct: 1   MLMLLAEYFAQYESGFRVFQYLTLRGILAAGTALLISLLVGPVMIRRLNYHQ--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD S+ +V + LL+T +FG VG+ DDY 
Sbjct: 59  SDGPQTHLGKSGTPTMGGALILIAIAISTLLWADLSNAYVWVALLVTAAFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + + L + +  + A   L   ++S        T +  PFF+D+ + MG
Sbjct: 119 KVVERNPRGLPARWKYLWQSVAGLAAALFLYVTADS-----PVTTQLYIPFFKDVAIGMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+  + FVIV  +NAVNLTDGLDGLAI+P ++   A   IAY+ GN+  + YLQ+ +V
Sbjct: 174 AFFVVLSYFVIVGASNAVNLTDGLDGLAILPTVLVGTALGLIAYLTGNVNFADYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V   ++ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV T+HEI+  I+
Sbjct: 234 PGSGELSVFCGSIAGAGLGFLWFNTYPAQVFMGDVGALALGAALGTVAVITRHEIVFFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T +R+F MAPIHHH+E KGW E ++++RFWII+ +  + G
Sbjct: 294 GGIFVLETVSVILQVASFKLTGRRLFRMAPIHHHYELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|157147489|ref|YP_001454808.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citrobacter
           koseri ATCC BAA-895]
 gi|166220371|sp|A8ALK9|MRAY_CITK8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|157084694|gb|ABV14372.1| hypothetical protein CKO_03288 [Citrobacter koseri ATCC BAA-895]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVVSVLLWAYPSNPYVWCVLVVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|110680537|ref|YP_683544.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter
           denitrificans OCh 114]
 gi|109456653|gb|ABG32858.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Roseobacter
           denitrificans OCh 114]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 183/366 (50%), Positives = 246/366 (67%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTLLSDGGDFFNLFRYITFRAGGAFLTALIFGFLFGRPLINVLRRRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V I+L +T+SF ++GF DDY K
Sbjct: 60  DGPEGHFAKAGTPTMGGLLIVGALLTSTLLWARLDNPFVWIVLFVTMSFAIIGFMDDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+ GKVR+L+  +IA +A      Y          +  +  P F+D ++++  
Sbjct: 120 VSKQTTAGVPGKVRLLLGLVIAAIASYWAAQYHPEA-----LQNRLALPVFKDTLINLSY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PF+  VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 FFVPFSVIVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGVIAYAVGRVDFTDYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + + G G+GFLW+N  PA +FMGDTGSLALG  +G IAVSTKHEI+L I+G
Sbjct: 235 GTGEILIFTAGIFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVSTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QV YFK T KRVFLMAPIHHH+E+KGW E+ IVIRFWIIS I A+IGL
Sbjct: 295 GLFVIEALSVIIQVLYFKKTGKRVFLMAPIHHHYEQKGWAESTIVIRFWIISLILAIIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|85707763|ref|ZP_01038829.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erythrobacter
           sp. NAP1]
 gi|85689297|gb|EAQ29300.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erythrobacter
           sp. NAP1]
          Length = 356

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 178/366 (48%), Positives = 244/366 (66%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA++  +    ++++Y TFR  A   +A++I    GP+ I+ LR  Q   GQP+R 
Sbjct: 1   MLYLLAEWLGFEGPLNLVRYQTFRFGATLMTALIIGMIIGPRFINMLRVRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG+++L+ L  S LLW D  S  V   L +T+ FG++GF DDY K
Sbjct: 60  DGPQSHLAKRGTPTMGGLMVLVALTLSLLLWMDPRSPFVWACLAVTMGFGIIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     GLSGKVR+L+EFI+A +A   ++          +  T +  PFF D+ + +G 
Sbjct: 120 VTKASHAGLSGKVRLLMEFIVAGIASYIIV---------SQISTDLYIPFFSDVQIPLGP 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            +  FAA  IV   NAVNLTDGLDGLAI+PV+IA+  F+ IAY+ G    + YL + +V 
Sbjct: 171 AYYVFAAVFIVGFGNAVNLTDGLDGLAIMPVIIAAGTFAIIAYLVGRTDFTQYLGIPYVE 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  +A++GAG+ FLWFN  PA +FMGDTGSLALG  +G IAV+  HE++L+I+G
Sbjct: 231 GAGELAIFCAAIMGAGLAFLWFNAPPAAVFMGDTGSLALGGALGAIAVAAHHEVVLLIVG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVET SVI+QV +FK T KRVF MAPIHHHFE+ GW+E+++VIRFWII+ + A++GL
Sbjct: 291 GLFVVETASVIIQVFWFKRTGKRVFRMAPIHHHFEQLGWSESKVVIRFWIIAIVLALVGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 STLKLR 356


>gi|22127503|ref|NP_670926.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           KIM 10]
 gi|45443364|ref|NP_994903.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51595035|ref|YP_069226.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108809540|ref|YP_653456.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Antiqua]
 gi|108810583|ref|YP_646350.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Nepal516]
 gi|145600345|ref|YP_001164421.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Pestoides F]
 gi|150260413|ref|ZP_01917141.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           CA88-4125]
 gi|153948222|ref|YP_001402347.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|165928195|ref|ZP_02224027.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165937812|ref|ZP_02226373.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166009021|ref|ZP_02229919.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166211910|ref|ZP_02237945.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167401230|ref|ZP_02306730.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421974|ref|ZP_02313727.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167426461|ref|ZP_02318214.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167469521|ref|ZP_02334225.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           FV-1]
 gi|170025736|ref|YP_001722241.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186894041|ref|YP_001871153.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|218927748|ref|YP_002345623.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           CO92]
 gi|229837057|ref|ZP_04457222.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           Pestoides A]
 gi|229840440|ref|ZP_04460599.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229843018|ref|ZP_04463168.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229900775|ref|ZP_04515899.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           Nepal516]
 gi|270487855|ref|ZP_06204929.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           KIM D27]
 gi|294502640|ref|YP_003566702.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           Z176003]
 gi|22095893|sp|Q8ZIF2|MRAY_YERPE RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|61214043|sp|Q66EK8|MRAY_YERPS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|122382613|sp|Q1C211|MRAY_YERPA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|122385284|sp|Q1CMN0|MRAY_YERPN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166221378|sp|A4TQ86|MRAY_YERPP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167011850|sp|A7FM69|MRAY_YERP3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621810|sp|B2K4E3|MRAY_YERPB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621812|sp|B1JK84|MRAY_YERPY RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|21960601|gb|AAM87177.1|AE013965_4 putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Yersinia pestis KIM 10]
 gi|45438233|gb|AAS63780.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51588317|emb|CAH19925.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774231|gb|ABG16750.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Nepal516]
 gi|108781453|gb|ABG15511.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Antiqua]
 gi|115346359|emb|CAL19231.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Yersinia pestis
           CO92]
 gi|145212041|gb|ABP41448.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           Pestoides F]
 gi|149289821|gb|EDM39898.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           CA88-4125]
 gi|152959717|gb|ABS47178.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis IP 31758]
 gi|165914224|gb|EDR32840.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165919806|gb|EDR37107.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165992360|gb|EDR44661.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166206656|gb|EDR51136.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960111|gb|EDR56132.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167049255|gb|EDR60663.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167054559|gb|EDR64367.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169752270|gb|ACA69788.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis YPIII]
 gi|186697067|gb|ACC87696.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia
           pseudotuberculosis PB1/+]
 gi|229682114|gb|EEO78206.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           Nepal516]
 gi|229689894|gb|EEO81953.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229696806|gb|EEO86853.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           biovar Orientalis str. PEXU2]
 gi|229706000|gb|EEO92009.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           Pestoides A]
 gi|262360670|gb|ACY57391.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           D106004]
 gi|262364617|gb|ACY61174.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           D182038]
 gi|270336359|gb|EFA47136.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Yersinia pestis
           KIM D27]
 gi|294353099|gb|ADE63440.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia pestis
           Z176003]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + IIA+ A   +      T     + T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTKGLIARWKYFWQSIIALAAAFTMYSIGKDT-----SATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFAAYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|88858799|ref|ZP_01133440.1| phospho-N-acetylmuramoyl-pentapeptide transferase
           [Pseudoalteromonas tunicata D2]
 gi|88819025|gb|EAR28839.1| phospho-N-acetylmuramoyl-pentapeptide transferase
           [Pseudoalteromonas tunicata D2]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 174/367 (47%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +YY   +V  Y+TFRS     +A+LI   FGPKVI  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLTQYYSGFNVFSYLTFRSILGILTALLISLYFGPKVIRYLQDMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S+LLWAD S+ +V + L +  S G+VGF DDY 
Sbjct: 59  TDGPESHLVKSGTPTMGGILILASIFSSTLLWADLSNKYVLVTLFVIGSLGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +   + +IA+     L      +   +  +TS+V PFF++++  +G
Sbjct: 119 KVVRKDSKGLIARWKYFWQSVIALATGIFLY-----STATLSAETSLVVPFFKELLPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + A +FIAYV GNI  + YL +  +
Sbjct: 174 IFFIVMSYFVIVGTSNAVNLTDGLDGLAIVPTILVAGALAFIAYVTGNINYAAYLHLPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V + ++GAG+GFLWFN  PA +FMGD GSLALG  +G IA+  + E++LII+
Sbjct: 234 PLASELVIVCTTIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAILVRQELVLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E +SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  + G
Sbjct: 294 GGVFVMEAVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISVVLVLAG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|87199152|ref|YP_496409.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|97176810|sp|Q2G998|MRAY_NOVAD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|87134833|gb|ABD25575.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 354

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 174/366 (47%), Positives = 237/366 (64%), Gaps = 12/366 (3%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA +  +   +++++Y TFR+ A   +A++I    GP+ I+ LR  Q   GQP+R 
Sbjct: 1   MLYLLAQWLHFEGFSNLIRYQTFRAGATLLTALVIGLIIGPRFINMLRVRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L  S LLW D +S  V    ++TL FGL+GF DDY K
Sbjct: 60  DGPQSHLAKRGTPTMGGLMIVTALTLSLLLWMDVTSRLVWACAVVTLGFGLIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G+  KVR+  EF++A  A    +            +T++  P F ++ + +G 
Sbjct: 120 VTKYAHKGVPAKVRLAGEFVVAAFAAWLAV-----------GETNLYVPVFSNLYVPLGP 168

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FA FVIV   NAVNLTDGLDGLAI+PV+IA+  F+ IAY+AG    + YL +  V 
Sbjct: 169 FYYLFAIFVIVGAGNAVNLTDGLDGLAIMPVIIAAGTFAIIAYLAGRYDFATYLGIPHVK 228

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  +A++GAG+ FLWFN  PA +FMGDTGSLALG  +G IAV+  HEI+L I+G
Sbjct: 229 GAGELAIFCAAMMGAGLAFLWFNAPPAAVFMGDTGSLALGGALGVIAVAAHHEIVLAIVG 288

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  +K T KRVF MAPIHHHFE+ GW E+ +VIRFWI+S + A+IGL
Sbjct: 289 GLFVMEAVSVIVQVAVYKRTGKRVFRMAPIHHHFEQLGWKESTVVIRFWIVSIVLALIGL 348

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 349 ATLKVR 354


>gi|261338919|ref|ZP_05966777.1| hypothetical protein ENTCAN_05117 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318744|gb|EFC57682.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter
           cancerogenus ATCC 35316]
 gi|295098591|emb|CBK87681.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
          Length = 360

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L + + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVVSVLLWAYPSNPYVWCVLTVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|114564957|ref|YP_752471.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           frigidimarina NCIMB 400]
 gi|122298411|sp|Q07WI2|MRAY_SHEFN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|114336250|gb|ABI73632.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           frigidimarina NCIMB 400]
          Length = 360

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 173/367 (47%), Positives = 250/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GP +I  L++LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYSGFNVFSYVTFRAILGLLTALVFSLWWGPILIKHLQTLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL G+  S LLW D S+ +V + L +  SFG++GF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGILILAGIFISVLLWGDLSNRYVLVTLFVLASFGVIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +  ++ I A++       YS+ST++G   +T +V PFF+DI+  +G
Sbjct: 119 KVVKKDSKGLIARWKYALQSIAALVVAV--YLYSSSTMVG---ETQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI  A F IV  +NAVNLTDGLDGLAI+P ++ + AF+ IAY++G+   + YL +  +
Sbjct: 174 FMFILLAYFTIVGASNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHAQFASYLHLPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IA+  + EILL+I+
Sbjct: 234 PLAGELVIVCTAMVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGVIAILVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|331006868|ref|ZP_08330121.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium IMCC1989]
 gi|330419319|gb|EGG93732.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium IMCC1989]
          Length = 360

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+LI F FGP +I  L  LQ   GQ VR
Sbjct: 1   MLVWLAEYLQQFHSGFGVFQYLTLRGILGVLTALLISFIFGPWMISRLNILQ--VGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW+D S+ +V ++L++T  FG VGF DDY 
Sbjct: 59  DDGPESHLIKAGTPTMGGTLILIAIFTSALLWSDLSNRYVWVVLIVTGVFGAVGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +  + A   L  Y+++       +T ++ PFF+ + +D+G
Sbjct: 119 KVVEKNTRGLPARWKYFWQSVAGLGAAIYLYQYAST-----PAETELIIPFFKSVSIDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I     VIV  +NAVNLTDGLDGLAI+P ++   A   IAY+AGN+  S YL + ++
Sbjct: 174 LAYILLTYLVIVGASNAVNLTDGLDGLAIMPTVMVGGALGIIAYLAGNVQFSSYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL+V  +AL GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  +HEI+L I+
Sbjct: 234 AGAGELLVFCAALGGAGLGFLWFNTYPAQVFMGDVGALALGAALGVIAVIVRHEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET SVI+QV  +K+T KRVF MAPIHHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVMETASVIIQVASYKLTGKRVFKMAPIHHHFELKGWPEPRVIVRFWIITVMLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|88799426|ref|ZP_01115003.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Reinekea sp.
           MED297]
 gi|88777736|gb|EAR08934.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Reinekea sp.
           MED297]
          Length = 360

 Score =  287 bits (735), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           MF+ L  F         VL+Y+T R+     +A+ +   FGP +I  L+  Q   GQ VR
Sbjct: 1   MFVWLTPFLVQLDAGFGVLQYLTLRAIFGVLTALGVSLIFGPGLIRLLKHHQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +I S+LLW+D S+ +V I +++T  FG +G+ DDY 
Sbjct: 59  NDGPQSHLTKAGTPTMGGALILISVIVSALLWSDLSNRYVWITIIVTAGFGCIGWIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GLS K +   + +I + A  AL   +         +T++  PFF+DI L +G
Sbjct: 119 KVVQRNSKGLSAKAKYFWQSVIGLFAAVALYLSA-----VTPAETTLFVPFFKDIALSLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+  A FVIV T+NAVNLTDGLDGLAI+P ++   A    AYV GN + S YLQ+ +V
Sbjct: 174 VLFVALAYFVIVGTSNAVNLTDGLDGLAILPTVLVGGALGVFAYVTGNAVYSDYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL+V  +AL+GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + E++L I+
Sbjct: 234 AGTGELIVFCAALVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGVIAVIVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV ET+SVI+QV  +K+T +R+F MAP+HHH+E KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVAETVSVILQVASYKLTGRRIFRMAPLHHHYELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|296284501|ref|ZP_06862499.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citromicrobium
           bathyomarinum JL354]
          Length = 356

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 183/366 (50%), Positives = 247/366 (67%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  +A++ E+  + ++ +Y TFR+ AA  +A+ I    GPK+I  LR  Q   GQP+R 
Sbjct: 1   MFYLIAEWFEFEGLFNLFRYQTFRAGAAILTALFIGLLIGPKLIAVLRVRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K+ TPTMGG++IL+ L+ S LLW D SS  V   L +T+ FG +GF DDY K
Sbjct: 60  DGPKTHLAKVGTPTMGGLMILIALVLSLLLWMDLSSPFVWACLAVTIGFGAIGFMDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G+SGKVR+L+EFI+A +A   ++          +  T +  PF  D  + +G 
Sbjct: 120 VTKNSHKGVSGKVRLLMEFIVAGIAAYIIV---------SQINTWLYVPFVSDQAIPLGP 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAA VIV   NAVNLTDGLDGLAI+PV+IA+  F+ IAY+AG    S YL + +V 
Sbjct: 171 FYYVFAAIVIVGAGNAVNLTDGLDGLAIMPVIIAAGTFALIAYLAGRADFSSYLGIPYVE 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  + ++GAG+ FLWFN  PA +FMGDTGSLALG  +G IAV++ HEI+L I+G
Sbjct: 231 GAGELAIFCACIMGAGLAFLWFNAPPANVFMGDTGSLALGGALGAIAVASHHEIVLAIVG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E LSVI+QV +FK T KR+F MAP+HHHFE+ GW+E ++VIRFWII+ + A+IGL
Sbjct: 291 GLFVFEALSVIIQVFWFKRTGKRIFRMAPVHHHFEQLGWSETKVVIRFWIIAIVLALIGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 STLKLR 356


>gi|296101250|ref|YP_003611396.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295055709|gb|ADF60447.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 360

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L + + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVVSVLLWAYPSNPYVWCVLTVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|71279404|ref|YP_271116.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Colwellia
           psychrerythraea 34H]
 gi|97176634|sp|Q47VQ6|MRAY_COLP3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|71145144|gb|AAZ25617.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Colwellia
           psychrerythraea 34H]
          Length = 360

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 248/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L ++  ++Y   +V  Y+TFR+  +  +A+ I   FGPK+I  L+ +Q   GQ VR
Sbjct: 1   MLLWLGEYLTQFYSAFNVFSYLTFRAIISTLTALFISLYFGPKLIRYLQKMQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S LLWAD S+++V ++L + +SFG+VGF DDY 
Sbjct: 59  DDGPESHLSKSGTPTMGGLLILASIVISVLLWADLSNIYVWVVLFVIVSFGIVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   DA GL  + +   + +I +     L F +         +T+++ PF ++++  +G
Sbjct: 119 KVIRKDANGLIARWKYFWQTVIGLSTALFLYFIAQ-----GPNETALLVPFVKELLPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F++  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+  AYV G++  S YL +  +
Sbjct: 174 IFYVVMSYFVIVGTSNAVNLTDGLDGLAIVPTIMVAGAFALFAYVTGHVNFSAYLNIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IA+  + E++L I+
Sbjct: 234 ALTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGVIAILVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +KM  +R+F MAPIHHH+E KGW E ++++RFWIIS I  +IG
Sbjct: 294 GGVFVMETVSVILQVGSYKMRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|89055255|ref|YP_510706.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Jannaschia sp.
           CCS1]
 gi|122498268|sp|Q28NN1|MRAY_JANSC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|88864804|gb|ABD55681.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Jannaschia sp.
           CCS1]
          Length = 359

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 187/366 (51%), Positives = 249/366 (68%), Gaps = 7/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L + S+   + ++ +Y+TFR+  AFF+A++  F FG  +I+ LR  +   GQP+R 
Sbjct: 1   MLYWLNELSDGGDVFNLFRYITFRAGGAFFTALIFGFIFGQPLINALRR-KYKDGQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L  ++LLWA   + +V ++L +T  FGL+GF DD+ K
Sbjct: 60  VGP-AHETKAGTPTMGGLLILAALSLATLLWARLDNPYVWLVLGVTWCFGLIGFADDWAK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++   + G+SGKVR+ I F++A  A     +         E    +  P F+D++L+MG 
Sbjct: 119 VSRNSSAGVSGKVRLAIGFVVAFGAALIAAWV-----HPEELSNQLAMPVFKDVLLNMGW 173

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            ++PF   VIV +ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 174 MYVPFVMIVIVGSANAVNLTDGLDGLAIMPVMIAAGTLGVIAYAVGRVDFTDYLDVHYVP 233

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL++  + LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHEI+L I+G
Sbjct: 234 GTGELLIFTAGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVCTKHEIVLAIVG 293

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E +SVI+QV YFK T KRVFLMAPIHHHFEKKGW E Q+VIRFWIIS I A+IGL
Sbjct: 294 GLFVAEAVSVIVQVLYFKATGKRVFLMAPIHHHFEKKGWAEPQVVIRFWIISLILALIGL 353

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 354 ATLKLR 359


>gi|291616269|ref|YP_003519011.1| MraY [Pantoea ananatis LMG 20103]
 gi|291151299|gb|ADD75883.1| MraY [Pantoea ananatis LMG 20103]
 gi|327392721|dbj|BAK10143.1| phospho-N-acetylmuramoyl-pentapeptide-transferase MraY [Pantoea
           ananatis AJ13355]
          Length = 360

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVAFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L++ + FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITLSVLMWAYPSNPYVWCVLVVLVGFGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +I++    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVISLGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYIVLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|304392259|ref|ZP_07374201.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ahrensia sp.
           R2A130]
 gi|303296488|gb|EFL90846.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Ahrensia sp.
           R2A130]
          Length = 371

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 206/372 (55%), Positives = 277/372 (74%), Gaps = 7/372 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L+ F +   + +V +Y+TFR+  A  ++M+I F FGP +I  LR +Q  +GQP+R 
Sbjct: 1   MLHYLSGFGDSLPLFNVFRYITFRTGGALITSMMITFLFGPMIIRALRGVQ-KKGQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG IIL+G++G+S+LWAD SS+ V  +LL+TL FG +GFYDDY+K
Sbjct: 60  DGPATHFKKAGTPTMGGFIILIGIVGASMLWADLSSVLVWTVLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSN------STLLGIETKTSIVFPFFRDI 174
           +T     G SGK+R+L+EFIIA LA  A++ +++      +    ++  +++ FPFF+ +
Sbjct: 120 VTKATDKGFSGKMRLLLEFIIAALACTAIMLFADKVANVQAVGNDLDLSSALTFPFFKTL 179

Query: 175 ILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYL 234
           +L +G FF+ F AFVIV+  NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN + + YL
Sbjct: 180 VLQLGWFFVIFGAFVIVSAGNAVNLTDGLDGLAIVPVMIAAASFGVIAYLAGNAIFADYL 239

Query: 235 QVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEI 294
           Q++ V G GEL ++  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+TKHEI
Sbjct: 240 QIHHVRGTGELAIICGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMLGTIAVATKHEI 299

Query: 295 LLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFI 354
           +L IIGGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+ GWTE+Q+VIRFWIIS +
Sbjct: 300 VLAIIGGLFVMEAMSVIIQVASFKLTGKRVFKMAPIHHHFEQLGWTESQVVIRFWIISIV 359

Query: 355 FAVIGLLTLKMR 366
           FA++GL TLK+R
Sbjct: 360 FALMGLATLKLR 371


>gi|146305954|ref|YP_001186419.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           mendocina ymp]
 gi|167011847|sp|A4XQS1|MRAY_PSEMY RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|145574155|gb|ABP83687.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           mendocina ymp]
          Length = 360

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLTLRGILGVLTALALSLWLGPWMIRTLQVRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++L +TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKKGTPTMGGALILTAIAVSTLLWADLSNRYVWVVLAVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S       +T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLAAAIFLYMTAQS-----PVETTLILPLLKDVSIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++ + A +   Y++GN+  + YL + +V
Sbjct: 174 IGFVVLTYFVIVGSSNAVNLTDGLDGLAILPTVMVAGALAVFCYLSGNVNFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V  +AL+GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + E++L I+
Sbjct: 234 PGAGELIVFCAALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEVVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVIIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|254451387|ref|ZP_05064824.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Octadecabacter
           antarcticus 238]
 gi|198265793|gb|EDY90063.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Octadecabacter
           antarcticus 238]
          Length = 360

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 187/366 (51%), Positives = 254/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   + ++ +Y+TFR+  AF +A++  F FGP +I  LR+ Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDVFNLFRYITFRAGGAFLTALIFGFVFGPSLIRVLRARQGK-GQPIRN 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  + ++L +T+SF L+GF DDY K
Sbjct: 60  DGPESHFAKAGTPTMGGLLIVGALLTSTLLWARLDNPFIWMVLFVTMSFALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++   + G+SG++R+++ F IA +A      Y       +E +  +  P F+D ++++G+
Sbjct: 120 VSKQSSAGVSGRLRLILGFAIAGVAAYWAAQY-----HPVELQNQLALPIFKDTLINLGV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPF+  VIV  ANAVN+TDGLDGLAI+PVMIA+ AF+ IAY  G    +  L +++VP
Sbjct: 175 LFIPFSMIVIVGAANAVNMTDGLDGLAIMPVMIAAGAFAIIAYFVGRTDFTAELGLHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  + LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 GTGELAIFAAGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWI+S I AVIGL
Sbjct: 295 GLFVVEAMSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIVSLILAVIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|152968672|ref|YP_001333781.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238893067|ref|YP_002917801.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae NTUH-K2044]
 gi|262044869|ref|ZP_06017912.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|330012010|ref|ZP_08307227.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella sp.
           MS 92-3]
 gi|166221319|sp|A6T4N0|MRAY_KLEP7 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|150953521|gb|ABR75551.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|238545383|dbj|BAH61734.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037838|gb|EEW39066.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|328533999|gb|EGF60651.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella sp.
           MS 92-3]
          Length = 360

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKLA--FGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA  S+ +V  +L + + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAITVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|299131928|ref|ZP_07025123.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Afipia sp.
           1NLS2]
 gi|298592065|gb|EFI52265.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Afipia sp.
           1NLS2]
          Length = 361

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 195/367 (53%), Positives = 260/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L D +      +V +Y+TFR+  A  +  L VF FGP +ID LR L + +GQP+R 
Sbjct: 1   MFYWLTDLAGTIPGINVFRYITFRTGGAMVTGALFVFMFGPWIIDHLR-LAQGKGQPIRA 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
              P H   K  TPTMGG++IL GL+ ++LLWA+  + +V ++L++TL FG VGFYDDY+
Sbjct: 60  DGPPTHLVTKKGTPTMGGLMILSGLVVATLLWANLRNPYVWVVLMVTLGFGFVGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G SGK R+ +E +IA+LA  A+++ +  + +     T +  PF +D  +++G
Sbjct: 120 KVTKQTHAGFSGKSRLAVEGLIALLACAAIVWSARDSAV-----TQLGIPFVKDFAINLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F++ F  F+IV   NAVNLTDGLDGLAIVPVMIA+ +F  I+Y+ GN + S YLQ+ +V
Sbjct: 175 WFYVIFGGFIIVGAGNAVNLTDGLDGLAIVPVMIAAASFGMISYLVGNAVFSEYLQIRYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMIGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV E LSVI+QV  FK+T KR+F MAPIHHH+E+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVFEALSVIVQVASFKLTGKRIFRMAPIHHHYEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|227356427|ref|ZP_03840815.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Proteus
           mirabilis ATCC 29906]
 gi|227163537|gb|EEI48458.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Proteus
           mirabilis ATCC 29906]
          Length = 360

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   +V  Y+TFR+     +A++I    GP +I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLVKYHTFFNVFSYLTFRAIVGLLTALIIALWMGPHLIAWLQKMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S+LLWA   + +V  +LL+ + +G++GF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILFSIAVSTLLWARLDNPYVWCVLLVLIGYGIIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A+ A  ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALAAAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL++ ++
Sbjct: 174 MLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFASYLKIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 MHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|206581062|ref|YP_002240441.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae 342]
 gi|288937141|ref|YP_003441200.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           variicola At-22]
 gi|290512564|ref|ZP_06551930.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella sp.
           1_1_55]
 gi|226700987|sp|B5Y1V0|MRAY_KLEP3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|206570120|gb|ACI11896.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           pneumoniae 342]
 gi|288891850|gb|ADC60168.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella
           variicola At-22]
 gi|289774905|gb|EFD82907.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Klebsiella sp.
           1_1_55]
          Length = 360

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S LLWA  S+ +V  +L + + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAITVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LLYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|156973218|ref|YP_001444125.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio harveyi
           ATCC BAA-1116]
 gi|166221376|sp|A7MWL2|MRAY_VIBHB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|156524812|gb|ABU69898.1| hypothetical protein VIBHAR_00899 [Vibrio harveyi ATCC BAA-1116]
          Length = 360

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y     + +Y++FR+  +  +A+ +    GP +I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYLSFFRLFEYLSFRAILSVLTALGLSLWMGPIMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLW D S+ +V  +L + L +G +GF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAISITILLWTDLSNPYVWAVLTVLLGYGAIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IA +   AL  Y   T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSLIAFVVAFALYAYGKDT-----AATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  S YL + ++
Sbjct: 174 LMYIILTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFSEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E++L+I+
Sbjct: 234 PHASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQELILVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISMVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|83312944|ref|YP_423208.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Magnetospirillum
           magneticum AMB-1]
 gi|97176738|sp|Q2W0H6|MRAY_MAGMM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|82947785|dbj|BAE52649.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase
           [Magnetospirillum magneticum AMB-1]
          Length = 362

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 183/368 (49%), Positives = 256/368 (69%), Gaps = 8/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   ++   + ++ KY+TFR+  A  +A+++ F  GP++I  LR  Q  +GQP+R
Sbjct: 1   MLYNLLYPLADQVPLFNLFKYLTFRTGGAVLTALIVAFLVGPRIIAWLRQWQ-KQGQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG +IL+ L  S+LLWAD  + +V I+LL+TL +GL+GF+DDY
Sbjct: 60  ADGPESHLLTKKGTPTMGGFMILLALSVSTLLWADLRNQYVWIVLLVTLGYGLIGFWDDY 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K++  +  G+ GK +++ E  IA+ A   +      +L       ++  PFF+ ++L +
Sbjct: 120 LKVSKKNPKGVPGKAKLVAEIAIALAAAAWVW-----SLQREPLAGALAVPFFKTVLLQL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
             F++PFA F+IV   NAVNLTDGLDGLAIVPVMIAS  F+  +Y+ G+ + ++YLQ+++
Sbjct: 175 SWFYLPFAVFIIVGAGNAVNLTDGLDGLAIVPVMIASGVFAIFSYLVGHAVFANYLQIHY 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           V G GEL V   AL+GAG+GFLWFN  PA++FMGDTGSLALG  +G I+V TKHE++L I
Sbjct: 235 VSGSGELAVFCGALVGAGLGFLWFNAPPAMVFMGDTGSLALGGALGAISVVTKHELVLGI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+ET+SVI+QV  FK+T KRVF MAP+HHHFEKKGW E  +VIRFWII+ I A+ 
Sbjct: 295 VGGLFVLETVSVIVQVASFKLTGKRVFRMAPLHHHFEKKGWAEPTVVIRFWIIATILALA 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLATLKLR 362


>gi|270159081|ref|ZP_06187737.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           longbeachae D-4968]
 gi|289166083|ref|YP_003456221.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           longbeachae NSW150]
 gi|269987420|gb|EEZ93675.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           longbeachae D-4968]
 gi|288859256|emb|CBJ13190.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Legionella
           longbeachae NSW150]
          Length = 361

 Score =  287 bits (733), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 162/368 (44%), Positives = 241/368 (65%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y    V +Y+TFRS  A  +A+++    GP +I  LR LQ   GQ VR
Sbjct: 1   MLYWLTQLFQGQYHALRVFQYLTFRSILASLTALIVGLVCGPIMIRWLRGLQ--IGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++I++ +  S LLW D     + ++LL+TL  G+VG+ DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGVLIVLAVTVSCLLWGDLQQPSLWLVLLVTLGNGVVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + ++A++AV  L  +++     +   T +  PFF+ + + +G
Sbjct: 119 KLVLKNSKGLPARWKYFWQSVVALIAVIYLYMHAD-----LPVHTQLTVPFFKSLTIGLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF     FVIV ++NAVNLTDGLDGLAI+P+++ + A    AY + N + + YL + +V
Sbjct: 174 IFFPVLGYFVIVGSSNAVNLTDGLDGLAIMPIVMVAGALGIFAYASSNAVYAPYLGIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  S+++GAG+GFLW+N  PA +FMGD GSLALGA +G +AV  + E++L+++
Sbjct: 234 PNTGELTIFCSSIVGAGLGFLWYNSYPAQVFMGDVGSLALGAALGIVAVVIREELVLLMM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ET+SVI+QVGYFK T  KR+F MAP+HHHFE KGW+E +I++RFWII+ +F + 
Sbjct: 294 GGLFVIETISVILQVGYFKYTHGKRLFRMAPLHHHFELKGWSEPKIIVRFWIITVVFVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|146310297|ref|YP_001175371.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter sp.
           638]
 gi|167011843|sp|A4W6J0|MRAY_ENT38 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|145317173|gb|ABP59320.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter sp.
           638]
          Length = 360

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L + + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVVSVLLWAYPSNPYVWCVLTVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|329298856|ref|ZP_08256192.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Plautia stali
           symbiont]
          Length = 360

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVAFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L++ + FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITVSVLMWAYPSNPYVWCVLVVLVGFGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +I++    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVISLGVAFALFIAGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYMVLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G +AV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTLAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|126735376|ref|ZP_01751122.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           CCS2]
 gi|126715931|gb|EBA12796.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseobacter sp.
           CCS2]
          Length = 360

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 188/366 (51%), Positives = 249/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A+L  F FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDFFNLFRYITFRAGGAFMTALLFGFIFGPPLINVLRRKQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L  S+LLWA   +  + ++L +TLSF  +GF DDY K
Sbjct: 60  DGPEGHFVKAGTPTMGGLLIVGALTFSTLLWARLDNPFIWMVLFVTLSFAAIGFADDYSK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+SGKVRIL+      + + A+  Y  +     +    +  P F+D ++++G+
Sbjct: 120 VSKQNTAGVSGKVRILL-----GILIAAIAGYWAAAYHPDDLSNQLALPIFKDTLINLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  VIV  ANAVNLTDGLDGLAI+PVMIA+  F  IAY  G +  + YL V++VP
Sbjct: 175 LFVPFAVIVIVGAANAVNLTDGLDGLAIMPVMIAAGTFGIIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GE+++  + LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 QTGEILIFAAGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWIIS I A+IGL
Sbjct: 295 GLFVLEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIISLILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|326388915|ref|ZP_08210497.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206515|gb|EGD57350.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 354

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 183/366 (50%), Positives = 246/366 (67%), Gaps = 12/366 (3%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA +  +  +T++++Y +FRS AA  +A++I    GP+ I+ LR  Q   GQP+R 
Sbjct: 1   MLYILAQWLHFEGLTNLIRYQSFRSGAALMTALVIGLVIGPRFINMLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I++ L  + LLW D  S +V   L +TL FGL+GF DDY K
Sbjct: 60  DGPQSHLAKRGTPTMGGLMIVIALSVALLLWMDLGSRYVWACLTVTLGFGLIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G+  K+R+L EFI+A +AV             + T+T++  P F ++ + MG 
Sbjct: 120 VTKYAHKGVPAKLRLLGEFIVAGVAVA-----------LVTTETNLYVPVFSNLYIPMGP 168

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAAFVIV   NAVNLTDGLDGLAI+PV+IAS  F+ IAY+AG    +HYL +  VP
Sbjct: 169 FYYVFAAFVIVGAGNAVNLTDGLDGLAIMPVIIASGTFAIIAYLAGRADYAHYLGIPHVP 228

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GEL +  +A++GAG+ FLWFN  PA +FMGDTGSLALG  +G IAVS  HE++L I+G
Sbjct: 229 KAGELAIFCAAVMGAGLAFLWFNAPPAAVFMGDTGSLALGGTLGVIAVSVHHEVVLAIVG 288

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  +K T KRVF MAPIHHHFE+ GW E+ +VIRFWIIS + A++GL
Sbjct: 289 GLFVMEAVSVIVQVFVYKRTGKRVFRMAPIHHHFEQLGWKESTVVIRFWIISIVLALLGL 348

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 349 ATLKVR 354


>gi|110833456|ref|YP_692315.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Alcanivorax
           borkumensis SK2]
 gi|122959635|sp|Q0VS05|MRAY_ALCBS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|110646567|emb|CAL16043.1| Phospho-N-acetylmuramoyl-pentapeptide-transferas e [Alcanivorax
           borkumensis SK2]
          Length = 360

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+    V++Y+T R   +  +A+ I F  GP +I  L+  Q   GQ +R
Sbjct: 1   MLLWLAEYLAQYHSGFLVVQYITLRGILSVLTALFIAFWVGPIMIRMLQEKQ--VGQAIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ S+LLW D  +  V I L +   FG VG+ DD+ 
Sbjct: 59  DDGPKSHLSKAGTPTMGGALILVAIVISTLLWGDLENRFVWITLGVLFVFGAVGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + + L   + A+ A CAL F + S       +T ++ PFF+ + ++MG
Sbjct: 119 KVVEKNPRGLPARWKYLWLSVGALGAGCALFFTAQS-----PVETQLIVPFFKSVAINMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I    FVI  T+NAVNLTDGLDGLAI+P ++   A    AY  G+   + YLQ+ +V
Sbjct: 174 WFYIVLTYFVINGTSNAVNLTDGLDGLAIMPTVLVGGALGIFAYAGGHAEFATYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GELV++ +AL GAG+GFLWFN  PA +FMGD G+L+LGA +G +AV  + EI+L I+
Sbjct: 234 AGAGELVIISAALCGAGLGFLWFNAYPAQVFMGDVGALSLGAVLGVMAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QVG FK+T +R+F MAPIHHHFE KGW E +I++RFWII+ I  ++G
Sbjct: 294 GGVFVMETVSVMLQVGSFKLTGRRIFRMAPIHHHFELKGWPEPKIIVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|319782845|ref|YP_004142321.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317168733|gb|ADV12271.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 360

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 213/366 (58%), Positives = 278/366 (75%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L DF++   + +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MFTLLVDFADKVSVFNVFRYITFRTGGALITSALIVFIFGPTIINSLRLRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G+IGSSLLWA+ SS++V ++LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILSGIIGSSLLWANLSSIYVWVVLLVTLGFGSIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EF+IA +A   ++    +        +S+ FPF ++ I+++G 
Sbjct: 120 VTKQSHLGFSGKARLALEFVIAGIAAWVIMHNGQA-----PFSSSLTFPFAKEFIVNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPF+ FVIV   NAVNLTDGLDGLAIVP+MIA+ +F  IAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFSCFVIVGAGNAVNLTDGLDGLAIVPIMIAAASFGVIAYLSGNAVFAEYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLA+G  IG +AV+TKHEI+L+I+G
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLAMGGLIGTVAVATKHEIVLVIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QVGYFKMT KRVFLMAPIHHHFEK GWTE+Q+VIRFWII+ I A++GL
Sbjct: 295 GLFVVEILSVIIQVGYFKMTGKRVFLMAPIHHHFEKLGWTESQVVIRFWIIAVILALVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|317046894|ref|YP_004114542.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pantoea sp.
           At-9b]
 gi|316948511|gb|ADU67986.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pantoea sp.
           At-9b]
          Length = 360

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+     Y   +V  Y+TFR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVALYSGFNVFSYLTFRAIVSLLTALFLSLWMGPRLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L++ + FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILTSITVSVLMWAYPSNPYVWCVLVVLVGFGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +I++    AL      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVISLGVAFALYLAGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|197285920|ref|YP_002151792.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Proteus
           mirabilis HI4320]
 gi|226700989|sp|B4F114|MRAY_PROMH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|194683407|emb|CAR44152.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Proteus
           mirabilis HI4320]
          Length = 360

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +Y+   +V  Y+TFR+     +A++I    GP +I  L+ +Q   GQ VR
Sbjct: 1   MLVWLAEYLVKYHTFFNVFSYLTFRAIVGLLTALIIALWMGPHLIAWLQKMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S+LLWA   + +V  +LL+ + +G++GF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILFSIAVSTLLWARLDNPYVWCVLLVLIGYGIIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + ++A+    ++      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTRGLIARWKYFWQSVLALAVAFSMYAIGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL++ ++
Sbjct: 174 MLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFASYLKIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 MHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|283783874|ref|YP_003363739.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Citrobacter
           rodentium ICC168]
 gi|282947328|emb|CBG86873.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Citrobacter
           rodentium ICC168]
          Length = 360

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|300112940|ref|YP_003759515.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           watsonii C-113]
 gi|299538877|gb|ADJ27194.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           watsonii C-113]
          Length = 358

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 161/367 (43%), Positives = 244/367 (66%), Gaps = 10/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD+   +    HV +Y+T R+     +A++I F  GP +I  L+    F GQPVR
Sbjct: 1   MLLYLADYLARFNSGFHVFQYLTLRAILGVLTALVISFVVGPPMIRRLK----FVGQPVR 56

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ ++ LWAD S+ ++ ++L++TL FG VGF DDY 
Sbjct: 57  SNGPTTHLCKAGTPTMGGALILVAIVTATALWADLSNRYIWVVLVVTLLFGGVGFVDDYK 116

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +IA+     L F ++        +T ++ PFF+DI +++G
Sbjct: 117 KLIARNSQGLPSRYKYFWQSMIALSVALFLYFTASVA-----AETELIVPFFKDIAVNLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +++    FV+V ++NAVNLTDGLDGLA++P ++   A    AY  G+   + YL + ++
Sbjct: 172 GYYVLLTYFVVVGSSNAVNLTDGLDGLAVLPTVLVGGALGIFAYATGHSGFAQYLGIPYI 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGELVV   AL+GAG+GFLWFN  PA +FMGD G+L+LGA +G +AV  + E++L I+
Sbjct: 232 PGVGELVVFCGALVGAGLGFLWFNAYPAQVFMGDIGALSLGAALGILAVLVRQELVLFIM 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVET+SV++QV  +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 292 GGVFVVETVSVMLQVASYKLTGRRIFRMAPLHHHFEIKGWPEPRVIVRFWIITVILVLIG 351

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 352 LATLKIR 358


>gi|283835149|ref|ZP_06354890.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citrobacter
           youngae ATCC 29220]
 gi|291069449|gb|EFE07558.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citrobacter
           youngae ATCC 29220]
          Length = 360

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|218780974|ref|YP_002432292.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Desulfatibacillum alkenivorans AK-01]
 gi|226709935|sp|B8FBS1|MRAY_DESAA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|218762358|gb|ACL04824.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Desulfatibacillum alkenivorans AK-01]
          Length = 360

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 161/369 (43%), Positives = 237/369 (64%), Gaps = 12/369 (3%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    ++Y  + +V +Y+TFR+  A  +A++I F  GP +I  L  +Q   GQ +R
Sbjct: 1   MLYHLLTPLAKYMTVFNVFRYITFRTIYASLTALVISFVLGPWLIRKLGEMQ--VGQHIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++I+  ++ S+LLWAD ++ +V I L +T  FGL+GF DDY+
Sbjct: 59  EDGPQTHLKKAGTPTMGGVLIMSAVMFSTLLWADLTNAYVWIALGVTFGFGLIGFVDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRD-IILDM 178
                 + GLS + +  ++ ++A +A   L++       G+   T++  PFF++      
Sbjct: 119 MQVKKRSKGLSARGKFCLQVVVAGIAGTVLVY-------GLNGDTTVNIPFFKNLNPDLT 171

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              ++ FA  V+V  +NAVNLTDGLDGLAIVPV IA+  +   AYVA +   + YL +  
Sbjct: 172 RPGYVLFAILVMVGASNAVNLTDGLDGLAIVPVAIAAGTYMIFAYVASHYDFATYLSIRH 231

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VP  GE+ V   AL+GAG+GFLW+N  PA IFMGD GSL LG  +G +A+ TK E+ L+I
Sbjct: 232 VPQSGEMSVFCGALVGAGLGFLWYNAYPAQIFMGDVGSLPLGGALGVVAILTKQELALVI 291

Query: 299 IGGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           +GGLFV+E +SVI+QV +FK+T  KR+F MAPIHHHFE KGW E ++++RFWII+ + A+
Sbjct: 292 VGGLFVMEAVSVILQVSFFKITKGKRIFKMAPIHHHFELKGWPEPKVIVRFWIIAIMLAL 351

Query: 358 IGLLTLKMR 366
           + + TLK+R
Sbjct: 352 LSVSTLKLR 360


>gi|163732136|ref|ZP_02139582.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Roseobacter
           litoralis Och 149]
 gi|161394434|gb|EDQ18757.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Roseobacter
           litoralis Och 149]
          Length = 360

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 182/366 (49%), Positives = 246/366 (67%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTLLSDGGDFFNLFRYITFRAGGAFLTALIFGFLFGRPLINVLRRRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V I+L +T+SF ++GF DDY K
Sbjct: 60  DGPQGHFAKAGTPTMGGLLIVGALLTSTLLWARLDNPFVWIVLFVTISFAIIGFMDDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+ G+VR+L+  +IA +A      Y          +  +  P F+D ++++  
Sbjct: 120 VSKQTTAGVPGRVRLLLGLVIAAIASYWAAQYHPEA-----LQNRLALPVFKDTLINLSY 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FF+PF+  VIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 FFVPFSVIVIVGAANAVNLTDGLDGLAIMPVMIAAGTLGVIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + + G G+GFLW+N  PA +FMGDTGSLALG  +G IAVSTKHEI+L I+G
Sbjct: 235 GTGEILIFTAGIFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVSTKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QV YFK T KRVFLMAPIHHH+E+KGW E+ IVIRFWIIS I A+IGL
Sbjct: 295 GLFVIEALSVIIQVLYFKSTGKRVFLMAPIHHHYEQKGWAESTIVIRFWIISLILAIIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|254441239|ref|ZP_05054732.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Octadecabacter
           antarcticus 307]
 gi|198251317|gb|EDY75632.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Octadecabacter
           antarcticus 307]
          Length = 360

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 186/366 (50%), Positives = 250/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   I ++ +Y+TFR+  AF +A++  F FGP +I  LR+ Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDIFNLFRYITFRAGGAFLTALIFGFVFGPSLIRVLRARQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  + ++L +T+SF L+GF DDY K
Sbjct: 60  DGPESHFAKAGTPTMGGLLIVGALLTSTLLWARLDNPFIWMVLFVTMSFALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+SG++R+++ F+IA +A      Y        E +  +  P F+D ++++G+
Sbjct: 120 VSKQTTAGVSGRLRLILGFVIAGIAAYWAAQY-----HPAELQNQLALPVFKDTLINLGV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPF+  VIV  ANAVNLTDGLDGLAI+PVMIA+  F+ IAY  G    +  L +++V 
Sbjct: 175 LFIPFSMIVIVGAANAVNLTDGLDGLAIMPVMIAAGTFAIIAYFVGRTDFTAELGLHYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +  + LIG G+GFLW N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 GTGELAIFAAGLIGGGLGFLWHNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV E +SVI+QV YFK T KRVFLMAPIHHH+EKKGW+E QIVIRFWI+S I AVIGL
Sbjct: 295 GLFVFEAMSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWSEPQIVIRFWIVSLILAVIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|330828042|ref|YP_004390994.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Aeromonas
           veronii B565]
 gi|328803178|gb|AEB48377.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Aeromonas
           veronii B565]
          Length = 360

 Score =  286 bits (731), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 154/367 (41%), Positives = 235/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    ++   +V  Y+TFR+  +  + + +    GP++I  L+ L+   GQ +R
Sbjct: 1   MLVWLAELLTPHFTFFNVFSYLTFRAILSIITGLGVALWMGPRLIRRLQILK--FGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++I+  +  S LLW    + +V ++L +  ++G +GF DDY+
Sbjct: 59  NDGPESHLSKRGTPTMGGLMIIAAIFTSVLLWCRLDNPYVWLVLFVLGAYGAIGFADDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  +A+     L   +       E +T +V PF +D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAVALAVAVFLYATATH-----EGQTQLVVPFLKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  + YL + +V
Sbjct: 174 LMFIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGFALIAWATGNVNFASYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PYTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+   R+F MAPIHHH+EKKGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGVRIFRMAPIHHHYEKKGWPEPRVIVRFWIITLVLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|126729248|ref|ZP_01745062.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sagittula
           stellata E-37]
 gi|126710238|gb|EBA09290.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sagittula
           stellata E-37]
          Length = 360

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 189/366 (51%), Positives = 251/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+ S+   + ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLAELSDGGDLFNLFRYITFRAGGAFLTALVFGFLFGLPLINVLRKRQGK-GQPIRT 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   +  V I+L +T++F  +GF DDY K
Sbjct: 60  DGPEGHFVKAGTPTMGGLLIIGALVTSTLLWARLDNPFVWIVLFVTMAFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  ++ G+ GKVR+L+ F+IA +A      Y        E    +  P F+D +++M  
Sbjct: 120 VSKQNSAGVPGKVRLLLGFLIAGIAGFWAAAY-----HPTELSYQLALPIFKDTLINMSF 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPFA FVIV  ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++VP
Sbjct: 175 LFIPFAMFVIVGAANAVNLTDGLDGLAIMPVMIATSTLGIIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + ++G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 GTGEILIFAAGVVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLGIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIISLILAIIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|320016918|gb|ADW00490.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 360

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEYLVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILIGYGIVGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + IIA+ A   +      T     + T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTKGLIARWKYFWQSIIALAAAFTMYSIGKDT-----SATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L ++  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LLYVLLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVNFAAYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+F VETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFAVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|238786720|ref|ZP_04630521.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           frederiksenii ATCC 33641]
 gi|238725088|gb|EEQ16727.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           frederiksenii ATCC 33641]
          Length = 356

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 166/359 (46%), Positives = 235/359 (65%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
             ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR      H 
Sbjct: 5   LVKFYSGFNVFSYLTFRAIVSLLTALVISLWMGPHLISYLQKLQ--IGQVVRNDGPESHF 62

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY K+   D  
Sbjct: 63  SKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILVGYGIVGFIDDYRKVVRKDTK 122

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +   + +IA+ A  A+      T       T +V PFF+DI+  +GL +I  A 
Sbjct: 123 GLIARWKYFWQSVIALAAAFAMYSIGKDT-----PATELVVPFFKDIMPQLGLLYILLAY 177

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
           FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++   GELV+
Sbjct: 178 FVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNVNFAAYLHIPYLRHAGELVI 237

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
           V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+GG+FVVET
Sbjct: 238 VCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVET 297

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IGL TLK+R
Sbjct: 298 LSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR 356


>gi|308185656|ref|YP_003929787.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Pantoea vagans
           C9-1]
 gi|308056166|gb|ADO08338.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Pantoea vagans
           C9-1]
          Length = 360

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVAFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L + + FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITISVLMWAYPSNPYVWCVLFVLVGFGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +I++     L      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVISLGVAFGLYAAGKDT-----PATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|159045010|ref|YP_001533804.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dinoroseobacter
           shibae DFL 12]
 gi|189082227|sp|A8LSB0|MRAY_DINSH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|157912770|gb|ABV94203.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dinoroseobacter
           shibae DFL 12]
          Length = 361

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 186/367 (50%), Positives = 246/367 (67%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+     ++ +Y+TFR+  AFF+A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MLYWLTSISDGGDAFNLFRYITFRAGGAFFTALIFGFIFGRPLINLLRKRQ-RFGQPIRE 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL  L  ++LLWA + + +V ++L +T+SFGL+GF DD+ 
Sbjct: 60  DGPESHLETKQGTPTMGGLLILSALTLATLLWARWDNGYVWLVLFVTVSFGLIGFMDDFQ 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G+SG+VR     +     +  +       L        +  P F+D ++++ 
Sbjct: 120 KVTKNSHAGVSGRVR-----LAMGFGIAGIAGAGALLLHPEPLAGQLALPVFKDTLINLS 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FIPF   VI  +ANAVNLTDGLDGLAI+PVMIA+     IAY  G +  + YL V++V
Sbjct: 175 ILFIPFCMIVIAGSANAVNLTDGLDGLAIMPVMIAAGTLGVIAYAVGRVDFTSYLDVHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+ V  SALIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L+++
Sbjct: 235 PGTGEIFVFTSALIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLVVV 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QV YFK T KRVFLMAPIHHHFEKKGW E+QIVIRFWIIS I A+IG
Sbjct: 295 GGIFVVEALSVIIQVAYFKKTGKRVFLMAPIHHHFEKKGWQESQIVIRFWIISLILALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKVR 361


>gi|16763515|ref|NP_459130.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|167989998|ref|ZP_02571098.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168464323|ref|ZP_02698226.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197261960|ref|ZP_03162034.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198244846|ref|YP_002214077.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205351464|ref|YP_002225265.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|207855639|ref|YP_002242290.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|22095894|sp|Q8ZRU5|MRAY_SALTY RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700992|sp|B5FI69|MRAY_SALDC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700993|sp|B5R2M1|MRAY_SALEP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700994|sp|B5RH61|MRAY_SALG2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|16418624|gb|AAL19089.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|195632663|gb|EDX51117.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197240215|gb|EDY22835.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197939362|gb|ACH76695.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205271245|emb|CAR36033.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 287/91]
 gi|205331566|gb|EDZ18330.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|206707442|emb|CAR31715.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Enteritidis str.
           P125109]
 gi|261245358|emb|CBG23147.1| UDP-MurNAc-pentapeptide phosphotransferase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267991803|gb|ACY86688.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           14028S]
 gi|301156753|emb|CBW16228.1| Phospho-N-acetylmuramoyl-pentapeptide-transfera se [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           SL1344]
 gi|312911094|dbj|BAJ35068.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321222300|gb|EFX47372.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323128445|gb|ADX15875.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. 4/74]
 gi|326621821|gb|EGE28166.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
 gi|326626491|gb|EGE32834.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
 gi|332987078|gb|AEF06061.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Typhimurium str. UK-1]
          Length = 360

 Score =  285 bits (730), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|27381716|ref|NP_773245.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Bradyrhizobium
           japonicum USDA 110]
 gi|61214345|sp|Q89FU4|MRAY_BRAJA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|27354885|dbj|BAC51870.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Bradyrhizobium
           japonicum USDA 110]
          Length = 367

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 199/373 (53%), Positives = 254/373 (68%), Gaps = 13/373 (3%)

Query: 1   MFIQLADFSEYYIIT-------HVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           MF  L + S  +          +V +Y+TFR+  A  +  L VF FGP +ID LR  Q  
Sbjct: 1   MFYWLIELSNTFPGFGAFRTFLNVFRYITFRTGGAVVTGALFVFLFGPWIIDHLRIRQGK 60

Query: 54  RGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVG 113
            GQP+R      H  K  TPTMGG++IL GL   ++LWA+  + +V I+L +TL FG VG
Sbjct: 61  -GQPIRTDGPQSHLAKKGTPTMGGLMILSGLTVGTVLWANPLNPYVWIVLAVTLGFGFVG 119

Query: 114 FYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRD 173
           FYDDY+K+T     G   K+R+LIE  IA++A  AL+  +          T++  PF +D
Sbjct: 120 FYDDYLKVTKQTTTGFGSKLRLLIEAAIALVACYALVRLNRD-----PASTALTIPFLKD 174

Query: 174 IILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHY 233
            +L  G FF+ F AFVIV   NAVNLTDGLDGLAIVPVMIA+ +F+ IAY+AGN + + Y
Sbjct: 175 TVLHFGWFFVVFGAFVIVGAGNAVNLTDGLDGLAIVPVMIATASFAMIAYLAGNAVFADY 234

Query: 234 LQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHE 293
           LQ+ +V G GEL V+  AL+GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHE
Sbjct: 235 LQIKYVAGTGELAVLCGALLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGAIAVAVKHE 294

Query: 294 ILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISF 353
           I+L +IGGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFE+ GWTE QIVIRFWIIS 
Sbjct: 295 IVLAVIGGLFVLEAVSVIVQVVSFKLTGKRIFRMAPIHHHFEQLGWTEPQIVIRFWIISV 354

Query: 354 IFAVIGLLTLKMR 366
           + A+ GL TLK+R
Sbjct: 355 MLALAGLSTLKLR 367


>gi|304413640|ref|ZP_07395084.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Candidatus
           Regiella insecticola LSR1]
 gi|304283731|gb|EFL92125.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Candidatus
           Regiella insecticola LSR1]
          Length = 360

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  Y+TFR+  +  +A  I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVLLAEYLVKFYSGFNVFSYLTFRAIVSLLTAFFISLLMGPYLIVWLQKLQL--GQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +I + L+WA  S+ +V  +L + +S+G++GF DDY 
Sbjct: 59  DDGPESHLTKSGTPTMGGVMILFSIIIAILMWAYPSNPYVWCVLFILVSYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +A GL  + +   +  IA++A   +      ++      T +V PFF+D++  +G
Sbjct: 119 KVVRKNAKGLIARWKYFWQSAIALVAAFTMY-----SMAHEMPATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAIVP ++ +  FS IA+  GN+  +HYL +  +
Sbjct: 174 LPYILLAYFVIVGTSNAVNLTDGLDGLAIVPTVLVAAGFSLIAWATGNVNFAHYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RYAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|238784571|ref|ZP_04628578.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           bercovieri ATCC 43970]
 gi|238714537|gb|EEQ06542.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           bercovieri ATCC 43970]
          Length = 356

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 167/359 (46%), Positives = 235/359 (65%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
             ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR      H 
Sbjct: 5   LVKFYSGFNVFSYLTFRAIVSLLTALVISLWMGPHLIAYLQKLQ--IGQVVRNDGPESHF 62

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY K+   D  
Sbjct: 63  SKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILVGYGIVGFIDDYRKVVRKDTK 122

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +   + IIA+ A  A+      T       T +V PFF+DI+  +GL +I  A 
Sbjct: 123 GLIARWKYFWQSIIALAAAFAMYSIGKDT-----PATELVVPFFKDIMPQLGLLYILLAY 177

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
           FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++   GELV+
Sbjct: 178 FVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNVNFAAYLHIPYLRHAGELVI 237

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
           V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+GG+FVVET
Sbjct: 238 VCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVET 297

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IGL TLK+R
Sbjct: 298 LSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR 356


>gi|117620237|ref|YP_858326.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117561644|gb|ABK38592.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 360

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 154/367 (41%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    ++   +V  Y+TFR+  +  + +++    GP++I  L+ L+   GQ +R
Sbjct: 1   MLVWLAELLTPHFTFFNVFSYLTFRAILSIITGLVVALWMGPRLIRRLQILK--FGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++I+  +  S LLW    + +V ++L +  ++G +GF DDY+
Sbjct: 59  NDGPESHLSKKGTPTMGGLMIIAAIFISVLLWCRLDNPYVWLVLFVLGAYGAIGFADDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  +A+     L   +       + +T +V PF +D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAVALGVAVFLYATATH-----DGQTQLVVPFLKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+FIA+  GN+  ++YL + +V
Sbjct: 174 LMFIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGFAFIAWATGNVNFANYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PYTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+   R+F MAPIHHH+EKKGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGVRIFRMAPIHHHYEKKGWPEPRVIVRFWIITLMLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|238760094|ref|ZP_04621244.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           aldovae ATCC 35236]
 gi|238701713|gb|EEP94280.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           aldovae ATCC 35236]
          Length = 356

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 165/359 (45%), Positives = 234/359 (65%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
             ++Y   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR      H 
Sbjct: 5   LVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAYLQKLQ--IGQVVRNDGPESHF 62

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY K+   D  
Sbjct: 63  SKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILVGYGIVGFIDDYRKVVRKDTK 122

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +   + +IA+ A  A+      T       T +V PFF+D++  +GL +I  A 
Sbjct: 123 GLIARWKYFWQSVIALAAAFAMYSIGKDT-----AATELVVPFFKDVMPQLGLMYILLAY 177

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
           FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++   GELV+
Sbjct: 178 FVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNVNFAAYLHIPYLRHAGELVI 237

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
           V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+GG+FVVET
Sbjct: 238 VCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVET 297

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IGL TLK+R
Sbjct: 298 LSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR 356


>gi|170728855|ref|YP_001762881.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           woodyi ATCC 51908]
 gi|229621817|sp|B1KKY0|MRAY_SHEWM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|169814202|gb|ACA88786.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           woodyi ATCC 51908]
          Length = 360

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 174/367 (47%), Positives = 253/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYTGFNVFSYVTFRAILGLMTALMFSLWWGPKMIERLQMLQ--IGQIVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL G+  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGILILAGVFISVLLWGDLGSRYVWVVLFVLASFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K + +++ + A++    L   ++ T      +T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIAKWKYILQSLAALVIAFYLYASADMT-----GETQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 GFFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHLPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|16759120|ref|NP_454737.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. CT18]
 gi|29140670|ref|NP_804012.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|62178692|ref|YP_215109.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161504753|ref|YP_001571865.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. arizonae serovar 62:z4,z23:-- str.
           RSK2980]
 gi|161612469|ref|YP_001586434.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167550680|ref|ZP_02344437.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|168230404|ref|ZP_02655462.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168234889|ref|ZP_02659947.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|168243460|ref|ZP_02668392.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168262190|ref|ZP_02684163.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168820881|ref|ZP_02832881.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|194442805|ref|YP_002039357.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194448066|ref|YP_002044095.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194471958|ref|ZP_03077942.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194735332|ref|YP_002113143.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197248344|ref|YP_002145111.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|200387155|ref|ZP_03213767.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204927383|ref|ZP_03218585.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|213052852|ref|ZP_03345730.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213622395|ref|ZP_03375178.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
 gi|213859657|ref|ZP_03385361.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|238911182|ref|ZP_04655019.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Tennessee str.
           CDC07-0191]
 gi|289823737|ref|ZP_06543349.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
 gi|22095891|sp|Q8Z9H1|MRAY_SALTI RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|75484867|sp|Q57TD3|MRAY_SALCH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189028764|sp|A9MQC5|MRAY_SALAR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189028765|sp|A9MZL6|MRAY_SALPB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700991|sp|B5F7W1|MRAY_SALA4 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621813|sp|B4TJ84|MRAY_SALHS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621814|sp|B4SU47|MRAY_SALNS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621816|sp|B4TXH5|MRAY_SALSV RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|25288754|pir||AB0518 phospho-N-acetylmuramoyl-pentapeptide- transferase [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16501410|emb|CAD01282.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29136294|gb|AAO67861.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
 gi|62126325|gb|AAX64028.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|160866100|gb|ABX22723.1| hypothetical protein SARI_02876 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161361833|gb|ABX65601.1| hypothetical protein SPAB_00159 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401468|gb|ACF61690.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194406370|gb|ACF66589.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194458322|gb|EDX47161.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194710834|gb|ACF90055.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197212047|gb|ACH49444.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
 gi|197291784|gb|EDY31134.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|199604253|gb|EDZ02798.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|204324048|gb|EDZ09243.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|205324367|gb|EDZ12206.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205334972|gb|EDZ21736.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337459|gb|EDZ24223.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205342426|gb|EDZ29190.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205348638|gb|EDZ35269.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|320084368|emb|CBY94161.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
 gi|322615946|gb|EFY12863.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315996572]
 gi|322620730|gb|EFY17590.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-1]
 gi|322623918|gb|EFY20755.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-3]
 gi|322627366|gb|EFY24157.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           495297-4]
 gi|322630673|gb|EFY27437.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-1]
 gi|322638107|gb|EFY34808.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           515920-2]
 gi|322640593|gb|EFY37244.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 531954]
 gi|322647734|gb|EFY44219.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648083|gb|EFY44550.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           OH_2009072675]
 gi|322656885|gb|EFY53171.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657405|gb|EFY53677.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 19N]
 gi|322663724|gb|EFY59924.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           81038-01]
 gi|322666557|gb|EFY62735.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MD_MDA09249507]
 gi|322672284|gb|EFY68396.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 414877]
 gi|322676404|gb|EFY72475.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 366867]
 gi|322679503|gb|EFY75548.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 413180]
 gi|322686168|gb|EFY82152.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 446600]
 gi|322713145|gb|EFZ04716.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Choleraesuis str. A50]
 gi|323195012|gb|EFZ80198.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           609458-1]
 gi|323200079|gb|EFZ85166.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           556150-1]
 gi|323201100|gb|EFZ86169.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 609460]
 gi|323209497|gb|EFZ94430.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           507440-20]
 gi|323212251|gb|EFZ97075.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str. 556152]
 gi|323216556|gb|EGA01282.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB101509-0077]
 gi|323219905|gb|EGA04383.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB102109-0047]
 gi|323225815|gb|EGA10035.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB110209-0055]
 gi|323228643|gb|EGA12772.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           MB111609-0052]
 gi|323236743|gb|EGA20819.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009083312]
 gi|323239756|gb|EGA23803.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           2009085258]
 gi|323242196|gb|EGA26225.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           315731156]
 gi|323249380|gb|EGA33296.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2009159199]
 gi|323252287|gb|EGA36138.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008282]
 gi|323256623|gb|EGA40353.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008283]
 gi|323262992|gb|EGA46542.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008284]
 gi|323265477|gb|EGA48973.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008285]
 gi|323271735|gb|EGA55153.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Montevideo str.
           IA_2010008287]
          Length = 360

 Score =  285 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|260462087|ref|ZP_05810331.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium
           opportunistum WSM2075]
 gi|259031947|gb|EEW33214.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium
           opportunistum WSM2075]
          Length = 360

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 214/366 (58%), Positives = 279/366 (76%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L DF++   + +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MFTLLVDFADKISVFNVFRYITFRTGGALITSALIVFIFGPTIINSLRLRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G+IGSSLLWA+ SS++V ++LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILSGIIGSSLLWANLSSIYVWVVLLVTLGFGSIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EF+IA +A  A++    +        +S+ FPF ++ I+++G 
Sbjct: 120 VTKQSHLGFSGKARLALEFVIAGIAAWAIMHNGQA-----PFSSSLTFPFAKEFIINLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPF+ FVIV   NAVNLTDGLDGLAIVP+MIA+ +F  IAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFSCFVIVGAGNAVNLTDGLDGLAIVPIMIAAASFGVIAYLSGNAVFAEYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLA+G  IG +AV+TKHEI+L+I+G
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLAMGGLIGTVAVATKHEIVLVIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QVGYFKMT KRVFLMAPIHHHFEK GWTE+Q+VIRFWII+ I A++GL
Sbjct: 295 GLFVVEILSVIIQVGYFKMTGKRVFLMAPIHHHFEKLGWTESQVVIRFWIIAVILALVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|261211502|ref|ZP_05925790.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp.
           RC341]
 gi|260839457|gb|EEX66083.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp.
           RC341]
          Length = 360

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIRRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ S  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PHTSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|260596512|ref|YP_003209083.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Cronobacter
           turicensis z3032]
 gi|260215689|emb|CBA28024.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Cronobacter
           turicensis z3032]
          Length = 360

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSIVVSVLLWAYPSNPYVWCVLFVLVGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALTVAFALYITGKGT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F++  A FVIV T NAVNLTDGLDGLAI+P ++ +  F+ +A+  GN+  + YL + ++
Sbjct: 174 IFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVLVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFW+IS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWVISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|254479947|ref|ZP_05093195.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine gamma
           proteobacterium HTCC2148]
 gi|214039509|gb|EEB80168.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine gamma
           proteobacterium HTCC2148]
          Length = 360

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 232/367 (63%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y     V +Y+T R   A  +A+ I    GP +I  L   Q   GQ VR
Sbjct: 1   MLLLLAEYLAQYQNAFTVFQYLTLRGILAAGTALAISLLVGPTMIRKLSYHQ--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ +V ++LL+T  FG VG+ DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGALILVAIAIATLLWADLSNPYVWVVLLVTGVFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + + L + I  + A   L    ++        T +  PF +D  L MG
Sbjct: 119 KVVEKDSRGLPARWKYLWQSIAGLAAALYLYLAFDT-----PVTTELYVPFLKDFSLTMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+  A FVIV ++NAVNLTDGLDGLAI+P ++   A   IAY+ G++  + YLQ+ +V
Sbjct: 174 PLFVVLAYFVIVGSSNAVNLTDGLDGLAILPTVMVGGALGIIAYLTGHVDFARYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V   A+ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV T+HEI+  I+
Sbjct: 234 AGSGELAVFCGAIAGAGLGFLWFNTYPAQVFMGDVGALALGAALGTVAVITRHEIVFFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T KR+F MAPIHHH+E KGW E ++++RFWII+ +  + G
Sbjct: 294 GGIFVLETVSVILQVASFKLTGKRIFRMAPIHHHYELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|258620873|ref|ZP_05715907.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio mimicus
           VM573]
 gi|258625126|ref|ZP_05720043.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio mimicus
           VM603]
 gi|262170649|ref|ZP_06038327.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio mimicus
           MB-451]
 gi|258582577|gb|EEW07409.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio mimicus
           VM603]
 gi|258586261|gb|EEW10976.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio mimicus
           VM573]
 gi|261891725|gb|EEY37711.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio mimicus
           MB-451]
          Length = 360

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIRRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF++++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGKDT-----AATQLVVPFFKEVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ S  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAVIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PYTSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|237729385|ref|ZP_04559866.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citrobacter sp.
           30_2]
 gi|226909114|gb|EEH95032.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Citrobacter sp.
           30_2]
          Length = 360

 Score =  285 bits (729), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|238791170|ref|ZP_04634809.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           intermedia ATCC 29909]
 gi|238729303|gb|EEQ20818.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia
           intermedia ATCC 29909]
          Length = 356

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 164/359 (45%), Positives = 234/359 (65%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
             ++Y   +V  Y+TFR+  +  +A+ I    GP +I  L+ LQ   GQ VR      H 
Sbjct: 5   LVKFYSGFNVFSYLTFRAIVSLLTALFISLWMGPHLIAYLQKLQ--IGQVVRNDGPESHF 62

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY K+   +  
Sbjct: 63  SKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILVGYGIVGFIDDYRKVVRKNTK 122

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +   + +IA+ A  A+      T       T +V PFF+D++  +GL +I  A 
Sbjct: 123 GLIARWKYFWQSVIALAAAFAMYSIGKDT-----AATELVVPFFKDVMPQLGLMYILLAY 177

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
           FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++   GELV+
Sbjct: 178 FVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNVNFAAYLHIPYLRHAGELVI 237

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
           V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+GG+FVVET
Sbjct: 238 VCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVET 297

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IGL TLK+R
Sbjct: 298 LSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR 356


>gi|224581968|ref|YP_002635766.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
 gi|254813252|sp|C0Q5I3|MRAY_SALPC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|224466495|gb|ACN44325.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi C strain
           RKS4594]
          Length = 360

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T +     T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDTPV-----TQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|260773497|ref|ZP_05882413.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           metschnikovii CIP 69.14]
 gi|260612636|gb|EEX37839.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           metschnikovii CIP 69.14]
          Length = 360

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALSLSLWMGPRLIKRLQVLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWA+ S+ +V  +L + L FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGVMILASISITVLLWANLSNPYVWAVLAVLLGFGVIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +IA++   AL  + + T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNSDGLIARWKYFWQSVIALVVAFALYAHGHDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ + AF+ IA+  GN+  ++YL +  +
Sbjct: 174 LLYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTILVAAAFAVIAWATGNVNFANYLHIPHI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E+LL+I+
Sbjct: 234 PYTSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETISVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|156935393|ref|YP_001439309.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Cronobacter
           sakazakii ATCC BAA-894]
 gi|166220378|sp|A7MIF2|MRAY_ENTS8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|156533647|gb|ABU78473.1| hypothetical protein ESA_03251 [Cronobacter sakazakii ATCC BAA-894]
          Length = 360

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L + + +G VGF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSIVVSVLLWAYPSNPYVWCVLFVLVGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSLIALTVAFALYITGKGT-----PATELVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F++  A FVIV T NAVNLTDGLDGLAI+P ++ +  F+ +A+  GN+  + YL + ++
Sbjct: 174 IFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVLVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFW+IS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWVISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|114773352|ref|ZP_01450556.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [alpha
           proteobacterium HTCC2255]
 gi|114546286|gb|EAU49197.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [alpha
           proteobacterium HTCC2255]
          Length = 361

 Score =  285 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 196/367 (53%), Positives = 259/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ S+     ++ +Y+TFRS  AFF+A+++ F FG  +I  L+ +Q+  GQP+R 
Sbjct: 1   MLYFLSELSDGGDAFNLFRYITFRSGGAFFTALILSFIFGAPLIRRLKKMQKH-GQPIRE 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H  +K  TPTMGG++IL  L+ SSLLWA   + +V I+LL+T+ FG++GF DDY+
Sbjct: 60  DGPTSHIIQKAGTPTMGGVLILGTLLFSSLLWARSDNGYVWIVLLVTVGFGVIGFLDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G S K RI++  +I+++AV         TL   +    +  P F+D +L++G
Sbjct: 120 KVTKNNVIGFSSKARIILGLLISLIAVYW-----AQTLHSEDLSRHLALPIFKDTLLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L + PFA  VIV  ANAVNLTDGLDGLAI+PV+IA+     IAYV G    + YL V++V
Sbjct: 175 LIYFPFAIIVIVGAANAVNLTDGLDGLAIMPVIIAAGTLGVIAYVVGRTDFTAYLDVHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL+V  SAL+GAG+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHE++L I+
Sbjct: 235 EGTGELLVFTSALVGAGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHELVLAIV 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFVVE LSVI+QV YFK T KRVFLMAPIHHHFEKKGW E+QIVIRFWII+ I A+IG
Sbjct: 295 GGLFVVEALSVIIQVLYFKSTGKRVFLMAPIHHHFEKKGWGESQIVIRFWIIALILALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|170768611|ref|ZP_02903064.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia
           albertii TW07627]
 gi|170122715|gb|EDS91646.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia
           albertii TW07627]
          Length = 360

 Score =  285 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL    N T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGNDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|262404718|ref|ZP_06081273.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp.
           RC586]
 gi|262349750|gb|EEY98888.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio sp.
           RC586]
          Length = 360

 Score =  285 bits (728), Expect = 9e-75,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ S  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PHSSELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|269101757|ref|ZP_06154454.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268161655|gb|EEZ40151.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 360

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA   E  +    + +Y+TFR+  +  +A+++    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIYWLAHVLESTFPFFRLFEYLTFRAIMSILTALVLSLWMGPRLIARLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  + LLWAD S+ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGIMILAAITITVLLWADLSNPYVWAVLFVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +IAI+   AL  Y   T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSLIAIIVAFALYAYGKDT-----AATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAI+P ++ +   +FIA+  GN   + YL + +V
Sbjct: 174 LFYIILTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGMAFIAWATGNYNYAEYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+++
Sbjct: 234 KDASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLIRQEFLLVLM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ +  +I 
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITLMLVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|13471552|ref|NP_103118.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium
           loti MAFF303099]
 gi|22095899|sp|Q98KB0|MRAY_RHILO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|14022294|dbj|BAB48904.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Mesorhizobium
           loti MAFF303099]
          Length = 360

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 214/366 (58%), Positives = 278/366 (75%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L DF++   + +V +Y+TFR+  A  ++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MFTLLVDFADKISVFNVFRYITFRTGGALITSALIVFIFGPTIINSLRLRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G+IGSSLLWA+ SS++V ++LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILSGIIGSSLLWANLSSIYVWVVLLVTLGFGSIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EFIIA +A   ++    +        +S+ FPF ++ I+++G 
Sbjct: 120 VTKQSHLGFSGKARLGLEFIIAGIAAWVIMHNGQA-----PFSSSLTFPFAKEFIINLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPF+ FVIV   NAVNLTDGLDGLAIVP+MIA+ +F  IAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFSCFVIVGAGNAVNLTDGLDGLAIVPIMIAAASFGVIAYLSGNAVFAEYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLA+G  IG +AV+TKHEI+L+I+G
Sbjct: 235 GTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLAMGGLIGTVAVATKHEIVLVIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QVGYFKMT KRVFLMAPIHHHFEK GWTE+Q+VIRFWII+ I A++GL
Sbjct: 295 GLFVVEILSVIIQVGYFKMTGKRVFLMAPIHHHFEKLGWTESQVVIRFWIIAVILALVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|238752429|ref|ZP_04613906.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia rohdei
           ATCC 43380]
 gi|238709362|gb|EEQ01603.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Yersinia rohdei
           ATCC 43380]
          Length = 356

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 166/359 (46%), Positives = 236/359 (65%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
             ++Y   +V  Y+TFR+  +  +A++I    GP +I  L+ LQ   GQ VR      H 
Sbjct: 5   LVKFYSGFNVFSYLTFRAIVSLLTALIISLWMGPHLISYLQKLQ--IGQVVRNDGPESHF 62

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGG++IL  +  S L+WA  S+ +V  +L + + +G+VGF DDY K+   D  
Sbjct: 63  SKRGTPTMGGLMILFSITISVLMWAYPSNPYVWCVLFILVGYGIVGFIDDYRKVVRKDTK 122

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +   + +IA++A  A+      T       T +V PFF+DI+  +GL +I  A 
Sbjct: 123 GLIARWKYFWQSVIALVAAFAMYSIGKDT-----PATELVVPFFKDIMPQLGLLYILLAY 177

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
           FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++   GELV+
Sbjct: 178 FVIVGTSNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFAAYLHIPYLRHAGELVI 237

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
           V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+GG+FVVET
Sbjct: 238 VCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVET 297

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IGL TLK+R
Sbjct: 298 LSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR 356


>gi|302383886|ref|YP_003819709.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302194514|gb|ADL02086.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 369

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 178/370 (48%), Positives = 259/370 (70%), Gaps = 5/370 (1%)

Query: 1   MFIQLADF----SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQ 56
           MF  L  +    ++ Y + ++++Y T R + A  +AM++    G + I  +R  Q   GQ
Sbjct: 1   MFYLLYLYFGDAAKDYPLLNLVQYQTVRVALAMATAMIVAVMMGSRFISWMRVKQGK-GQ 59

Query: 57  PVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           P+R      H  K+ TPTMGG++IL G+  +  LW D ++ ++ I+  +TL+F ++GF D
Sbjct: 60  PIRADGPVSHLSKVGTPTMGGLMILAGIAVAVFLWGDLTNPYIWIVSAVTLAFAVLGFVD 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+T   + GL+ K +++ + I++++A   ++ ++  +      +TSI FPFF++++L
Sbjct: 120 DYAKVTKQTSAGLTSKQKLVAQVIVSVIAGILVVLWTTYSPTSPGLETSIAFPFFKNVLL 179

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
           ++G F++ FAAF IV  +NAVNLTDGLDGLAIVPVM+A+ AF  I+Y+ GN + S YL V
Sbjct: 180 NIGWFYVAFAAFTIVGFSNAVNLTDGLDGLAIVPVMMAAAAFGIISYLVGNFIFSDYLGV 239

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           + VPG GEL +  +A+IG G GFLW+N  PA IFMGDTGSLALG  +G IAV+TKHE++L
Sbjct: 240 HHVPGSGELAIFCAAIIGGGTGFLWYNAPPAKIFMGDTGSLALGGALGSIAVATKHELVL 299

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            I+GGLFVVE  SV++QV YFK TKKR+FLMAPIHHHFEK GW E+ +VIRFWI++ + A
Sbjct: 300 GIVGGLFVVEAASVMIQVAYFKATKKRIFLMAPIHHHFEKLGWPESTVVIRFWIVAAMLA 359

Query: 357 VIGLLTLKMR 366
           ++GL TLK+R
Sbjct: 360 LVGLSTLKLR 369


>gi|312885133|ref|ZP_07744817.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309367206|gb|EFP94774.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 360

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ +    GP +I  L+ +Q   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAILSILTALGLSLWIGPILIRRLQVMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  ++LLWAD S+ ++  ++++   +GL+GF DDY 
Sbjct: 59  NEGPESHFCKRGTPTMGGIMILSAITLTTLLWADLSNPYIWAVMIVLGGYGLIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF++I+  +G
Sbjct: 119 KVVHKNTDGLIARWKYFWQSAIALVVAFALYIHGKDT-----AATQLVVPFFKEIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F+I  + FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  + YL + +V
Sbjct: 174 VFYIVLSYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAVIAWATGNVNFASYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA IFMGD GSLALG  +G IAV  + E +L+I+
Sbjct: 234 PYSSELVVVCTAIVGAGLGFLWFNTYPAQIFMGDVGSLALGGVLGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFKMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|84516393|ref|ZP_01003752.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Loktanella
           vestfoldensis SKA53]
 gi|84509429|gb|EAQ05887.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Loktanella
           vestfoldensis SKA53]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 188/366 (51%), Positives = 250/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L   S+   + ++ +Y+TFR+  AF +A++  F FG  +I+ LR  Q   GQP+R 
Sbjct: 1   MFYWLTALSDGGDVFNLFRYITFRAGGAFLTALVFGFIFGRPLINVLRRKQGK-GQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L  S+LLWA   +  V ++L +TLSF  +GF DDY K
Sbjct: 60  DGPEGHFAKAGTPTMGGLLIVGALTFSTLLWARLDNPFVWMVLFVTLSFAAIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++     G+SGKVRIL+   IA +A      Y        +    +  P F+D ++++G+
Sbjct: 120 VSKQTTSGVSGKVRILLGITIAAIAAYWAAQY-----HPDDLTNRLAVPIFKDTLINLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  VIV +ANAVNLTDGLDGLAI+PVMIA+  F  IAY  G +  + YL V++VP
Sbjct: 175 LFVPFAVIVIVGSANAVNLTDGLDGLAIMPVMIAAGTFGVIAYAVGRVDFTQYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GEL+++   LIG G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L I+G
Sbjct: 235 DTGELLILTMGLIGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLSIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV Y+K T KRVFLMAPIHHH+EK+GW+E QIVIRFWII+ I A++GL
Sbjct: 295 GLFVVEALSVIIQVLYYKRTGKRVFLMAPIHHHYEKQGWSEPQIVIRFWIIALILAMVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|304396560|ref|ZP_07378441.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pantoea sp. aB]
 gi|304356069|gb|EFM20435.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pantoea sp. aB]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MLVWLAEHLVAFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRLIAWLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S L+WA  S+ +V  +L + + FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTSITISVLMWAYPSNPYVWCVLFVLIGFGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +I++     L      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVISLGVAFGLYAAGKDT-----PATQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYVLLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|289209364|ref|YP_003461430.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thioalkalivibrio
           sp. K90mix]
 gi|288944995|gb|ADC72694.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thioalkalivibrio
           sp. K90mix]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L ++  ++Y    V +Y+TFR+     +A+ I    GP +I  L       GQ VR
Sbjct: 1   MLYALTEYLTQFYSGFTVFQYLTFRAILGVVTALAIALLIGPAMIRRLTV--GNVGQQVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLW+D ++  V I+LL TL+FG VG +DDY+
Sbjct: 59  DDGPESHLSKAGTPTMGGALILVAVAVATLLWSDLTNRFVWIVLLTTLAFGAVGGWDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+  G++ GLS K ++L + + A++A   ++  + S       +TS   P F+D  L +G
Sbjct: 119 KLRYGNSKGLSAKAKLLWQTLFALIAAGVIMATAQS-----PVETSFYLPIFKDFELHLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FIP    V+V ++NAVNLTDGLDGLAI+P ++ + A    AY AG+ + + YLQ+  V
Sbjct: 174 WLFIPLVWLVVVGSSNAVNLTDGLDGLAIMPAVLVAGALGVFAYAAGHAVFADYLQIPAV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGE+ V  +AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +A+ T+ EI+L+I+
Sbjct: 234 PGVGEVGVFAAALVGAGLGFLWFNAYPAQVFMGDVGALALGAALGMMAILTRQEIVLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +R+F MAP+HHHFE KGW E ++++RFWI++ +F +IG
Sbjct: 294 GGIFVLETLSVMLQVASFKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWILTVVFVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|148259081|ref|YP_001233208.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Acidiphilium
           cryptum JF-5]
 gi|326402232|ref|YP_004282313.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Acidiphilium
           multivorum AIU301]
 gi|187609669|sp|A5FUK7|MRAY_ACICJ RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|146400762|gb|ABQ29289.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Acidiphilium
           cryptum JF-5]
 gi|325049093|dbj|BAJ79431.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Acidiphilium
           multivorum AIU301]
          Length = 362

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 177/368 (48%), Positives = 256/368 (69%), Gaps = 8/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L      +   ++++Y+TFR+  A  +A+++ F  GP++I  L+SLQ  +GQP+R
Sbjct: 1   MLYALLLPHVAAFHAFNLIRYITFRAGGACLTALVVSFLLGPRLIRWLKSLQ-KQGQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG +IL+ L  S+LLWAD  + +V  +L++T+ +G +GF DD+
Sbjct: 60  ADGPERHLIEKKGTPTMGGFLILIALTVSTLLWADLRNGYVWAVLMITIGYGALGFADDF 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
           +K+T  +  G+ G+++++++ ++ + A   +     + L+      S+  P F+ +++  
Sbjct: 120 LKLTKRNTKGVPGRIKLVVQAVLGLGAAVWI-----TQLMPGSIADSLAVPVFKHLMIPF 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G  F   A FV++  +NAVNLTDGLDGLAIVP +IA+  F+ IAY+ GN + SHYL++NF
Sbjct: 175 GPLFPLVAMFVMMGASNAVNLTDGLDGLAIVPTIIAAGVFTLIAYLVGNRIFSHYLEINF 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V  SALIGAG+GFLWFN  PA +FMGDTGSLALG  +G +AV+TK+EI+L I
Sbjct: 235 VPGTGELAVFCSALIGAGMGFLWFNAPPAAVFMGDTGSLALGGALGSVAVATKNEIVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
            GGLFVVET+SVI+QV ++K T +RVFLMAP+HHHFEKKGW E  +VIRFWI++ I A++
Sbjct: 295 TGGLFVVETVSVIVQVFWYKRTGRRVFLMAPLHHHFEKKGWAEPTVVIRFWIVAMILALL 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLATLKIR 362


>gi|84501751|ref|ZP_00999923.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanicola
           batsensis HTCC2597]
 gi|84390372|gb|EAQ02931.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanicola
           batsensis HTCC2597]
          Length = 373

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 194/374 (51%), Positives = 252/374 (67%), Gaps = 9/374 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L   S+   + ++ +Y+TFR+  AF +A++  F FG  +ID LR  Q   GQP+R 
Sbjct: 1   MLYWLTALSDGGDVFNLFRYITFRAGGAFMTALIFGFLFGRPLIDVLRRRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ SSLLWA   +  V ++L +TL+FGL+GF DDY K
Sbjct: 60  DGPEGHLVKAGTPTMGGLLIVGALLTSSLLWARLDNAFVWLVLFVTLAFGLIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIE--------TKTSIVFPFFR 172
           ++  +  GLS + R+ I F IA +A    +         +             + FP F+
Sbjct: 120 VSKQNVKGLSSRARLAIGFAIAAVASAWAMHIHGMIDADLLSRDEGYAALSGRLAFPVFK 179

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
           D++L++G  F+PFA FVIV  ANAVNLTDGLDGLAI+PVMIAS A   IAY  G I  S 
Sbjct: 180 DLLLNLGWLFLPFAMFVIVGAANAVNLTDGLDGLAIMPVMIASGALGVIAYTVGRIDFSE 239

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YL V++VPG GE+++ ++ L+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKH
Sbjct: 240 YLDVHYVPGTGEILIFVAGLMGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKH 299

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI+L I+GG+FVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E  IVIRFWIIS
Sbjct: 300 EIVLGIVGGIFVVEALSVIIQVAYFKRTGKRVFLMAPIHHHYEKKGWAEPTIVIRFWIIS 359

Query: 353 FIFAVIGLLTLKMR 366
            I A+IGL TLK+R
Sbjct: 360 LILALIGLATLKLR 373


>gi|114704925|ref|ZP_01437833.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Fulvimarina
           pelagi HTCC2506]
 gi|114539710|gb|EAU42830.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Fulvimarina
           pelagi HTCC2506]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 200/366 (54%), Positives = 265/366 (72%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  F++   + +V +Y+TFR+ AA     + VF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MIAYLGQFADQIAVFNVFRYITFRTGAAMIFGFITVFLFGPAIISALRLRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++ S+L WAD ++++V  +LL+T+ FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILSGVLVSTLFWADLTNIYVWTVLLVTVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EF+IA +AV  ++             TS+ FPF ++++ ++GL
Sbjct: 120 VTKQSDKGFSGKSRLALEFLIAAMAVLLIVL-----RTEGPFATSLAFPFVKELLFNLGL 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++ FAAFVIV   NAVNLTDGLDGLAIVP+MIA  A   IAY+AGN+  ++YLQ+++V 
Sbjct: 175 FYVGFAAFVIVGAGNAVNLTDGLDGLAIVPIMIAVAALGLIAYLAGNVNFANYLQIHYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL  V  A+IGAG+GFLWFN  PA IFMGDTGSLALG   G +AV+TKHEI+L IIG
Sbjct: 235 GTGELAPVCGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGMTGAVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QVG+FK+T +RVFLMAPIHHHFEK GWTE+Q+VIRFWII+F+ A +GL
Sbjct: 295 GLFVIEALSVIIQVGWFKITGRRVFLMAPIHHHFEKLGWTESQVVIRFWIIAFMLAFVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|154245791|ref|YP_001416749.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthobacter
           autotrophicus Py2]
 gi|229621807|sp|A7IGE9|MRAY_XANP2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|154159876|gb|ABS67092.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthobacter
           autotrophicus Py2]
          Length = 361

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 202/367 (55%), Positives = 271/367 (73%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+F   +   +V +Y+TFR+  A  +A+L VF FGP +I  LR L++ +GQP+R 
Sbjct: 1   MLQWLAEFHASFPAFNVFRYITFRTGGAVVTALLFVFLFGPGMISTLR-LKQGKGQPIRT 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL G++ ++LLWA+ S+ +V ++L +TL FGL+GFYDDY+
Sbjct: 60  DGPQSHLLTKKGTPTMGGLMILSGIVVATLLWANLSNPYVWVVLGVTLGFGLIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     GLSGK R+ IE +IA +AV  ++             TS+ FPFF+D++L++G
Sbjct: 120 KVTKQTHNGLSGKARLAIEAVIAGVAVVIVMSVGKPG-----LSTSVAFPFFKDLLLNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF  F  FVIVA  NAVNLTDGLDGLAIVPVMIA+ +F FIAY+AGN++ + YLQ+++V
Sbjct: 175 MFFAIFGMFVIVAAGNAVNLTDGLDGLAIVPVMIAAGSFGFIAYLAGNVVFADYLQIHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL V+  AL+GAG+GFLWFN  PA +FMGDTGSLALG  +G +AV+TKHEI+L +I
Sbjct: 235 AGVGELAVICGALMGAGLGFLWFNAPPAQVFMGDTGSLALGGLLGTVAVATKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+ GWTE Q+VIRFWI++ + A+ G
Sbjct: 295 GGLFVLEAVSVIVQVVSFKLTGKRVFKMAPIHHHFEQLGWTEPQVVIRFWIVAVVLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|188584359|ref|YP_001927804.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           populi BJ001]
 gi|229621783|sp|B1Z8W9|MRAY_METPB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|179347857|gb|ACB83269.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           populi BJ001]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 198/366 (54%), Positives = 251/366 (68%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ S      +V +Y+TFR+  A F+A   VF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLFLLSELSGTLTPLNVFRYITFRTGGALFTAGFFVFWFGPWIISLLRLRQGK-GQPIRE 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL G + S LLW +  + +V + L +TL FG +GFYDDY+K
Sbjct: 60  DGPATHLTKRGTPTMGGLMILAGAVVSILLWTNPRNHYVWVTLAVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SG+ R+L+EF IA  A   +  YS +       +  + FP F+D +L++G 
Sbjct: 120 VTKQSHKGFSGRFRLLLEFAIAGAACLLISIYSPAG-----LQNQLAFPVFKDALLNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++PFAAFVIV   NAVN+TDGLDGLAIVPVMIA   F  IAY+ GN   + YLQVN+V 
Sbjct: 175 FWVPFAAFVIVGAGNAVNITDGLDGLAIVPVMIACGTFGVIAYLVGNSFTAGYLQVNYVR 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GEL VV  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L I+G
Sbjct: 235 DTGELAVVCGAVIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGAIAVAAKHEIVLAIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGW E Q+VIRFWII+ I A++GL
Sbjct: 295 GLFVLEIMSVIIQVASFKLTGKRVFRMAPIHHHFEQKGWKEPQVVIRFWIIAVILALVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|24375707|ref|NP_719750.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           oneidensis MR-1]
 gi|38372362|sp|Q8E9P5|MRAY_SHEON RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|24350641|gb|AAN57194.1|AE015855_5 phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           oneidensis MR-1]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 247/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   ++   +V  YVTFR+     +A++    +GPK+I+ L+ +Q   GQ VR
Sbjct: 1   MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALMFSLWWGPKLIERLQLMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW D  S +V ++L +  SFG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILGAIFLSVLLWGDLGSRYVWVMLFVLGSFGMIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A++    L   + +       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALIIAFFLYTTAAN-----PGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G+   ++YL +  +
Sbjct: 174 AVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHAQFANYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|113971901|ref|YP_735694.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           MR-4]
 gi|114045893|ref|YP_736443.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           MR-7]
 gi|117922178|ref|YP_871370.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           ANA-3]
 gi|122945017|sp|Q0HZR9|MRAY_SHESR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|123324593|sp|Q0HE80|MRAY_SHESM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166221359|sp|A0L1P5|MRAY_SHESA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|113886585|gb|ABI40637.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           MR-4]
 gi|113887335|gb|ABI41386.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           MR-7]
 gi|117614510|gb|ABK49964.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella sp.
           ANA-3]
          Length = 360

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 248/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   ++   +V  YVTFR+     +A++    +GPK+I+ L+ +Q   GQ VR
Sbjct: 1   MLVYLAEYLTRFHTGFNVFSYVTFRAILGLLTALMFSLWWGPKLIERLQLMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW D  S +V ++L +  SFG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLMILGAIFISVLLWGDLGSRYVWVMLFVLGSFGMIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A++    L   +++       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALIIAFFLYTTASN-----PGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G+   ++YL +  +
Sbjct: 174 AVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHAQFANYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSL+LGA +G IAV  + EILL+I+
Sbjct: 234 PGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|39998163|ref|NP_954114.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           sulfurreducens PCA]
 gi|61214207|sp|Q748D3|MRAY_GEOSL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|39985109|gb|AAR36464.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           sulfurreducens PCA]
 gi|298507100|gb|ADI85823.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Geobacter
           sulfurreducens KN400]
          Length = 358

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 174/367 (47%), Positives = 236/367 (64%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  + I +V KY+TFR+  A  +A+++ F  GP VI  L +LQ    Q +R
Sbjct: 1   MLYHLLYPLAADFRIFNVFKYLTFRTIYAVITALVVSFILGPWVIRKLEALQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL  ++  +LLWAD ++ +V   L + L +GL+GF DDY 
Sbjct: 59  TDGPESHLKKSGTPTMGGILILASIVIPTLLWADLTNRYVWTTLFVILGYGLIGFTDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GLS + ++  + +IA  AVC L+  +          T +  PFF+ +  D+ 
Sbjct: 119 KVVEKDTKGLSPRQKMFWQMLIAGGAVCFLVLVAG-------MSTELSVPFFKRLHPDLS 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +IPF   V+V  +NAVNLTDGLDGLAI PV I +  F   AY+AGN  LS YLQ  +V
Sbjct: 172 YLYIPFGMLVVVGASNAVNLTDGLDGLAIGPVAINAATFLLFAYIAGNAKLSSYLQTPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAGIGFLW+N  PA +FMGD GSL+LG  +G +AV TK E+LL+I+
Sbjct: 232 PGAGELAVLCGAMVGAGIGFLWYNAYPAEVFMGDVGSLSLGGGLGILAVITKQEMLLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGIFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLK+R
Sbjct: 352 ISTLKLR 358


>gi|170684044|ref|YP_001742209.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           SMS-3-5]
 gi|218698510|ref|YP_002406139.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           IAI39]
 gi|218703347|ref|YP_002410866.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           UMN026]
 gi|293403159|ref|ZP_06647256.1| mraY [Escherichia coli FVEC1412]
 gi|293408178|ref|ZP_06652018.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B354]
 gi|298378689|ref|ZP_06988573.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           FVEC1302]
 gi|300900882|ref|ZP_07119019.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 198-1]
 gi|300938482|ref|ZP_07153222.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 21-1]
 gi|301026105|ref|ZP_07189580.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 69-1]
 gi|331661461|ref|ZP_08362385.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA143]
 gi|331671606|ref|ZP_08372404.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA280]
 gi|226709938|sp|B7NHJ3|MRAY_ECO7I RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709940|sp|B7N7W0|MRAY_ECOLU RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709941|sp|B1LG24|MRAY_ECOSM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|170521762|gb|ACB19940.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           SMS-3-5]
 gi|218368496|emb|CAR16231.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           IAI39]
 gi|218430444|emb|CAR11310.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           UMN026]
 gi|291430074|gb|EFF03088.1| mraY [Escherichia coli FVEC1412]
 gi|291472429|gb|EFF14911.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B354]
 gi|298281023|gb|EFI22524.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           FVEC1302]
 gi|300355646|gb|EFJ71516.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 198-1]
 gi|300395676|gb|EFJ79214.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 69-1]
 gi|300456551|gb|EFK20044.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 21-1]
 gi|323964817|gb|EGB60284.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           M863]
 gi|324112500|gb|EGC06477.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia
           fergusonii B253]
 gi|327255065|gb|EGE66668.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           STEC_7v]
 gi|331061376|gb|EGI33339.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA143]
 gi|331071451|gb|EGI42808.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA280]
          Length = 360

 Score =  284 bits (726), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|15642401|ref|NP_232034.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121587624|ref|ZP_01677388.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           2740-80]
 gi|121728358|ref|ZP_01681387.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           V52]
 gi|153214089|ref|ZP_01949223.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           1587]
 gi|153803320|ref|ZP_01957906.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MZO-3]
 gi|153818413|ref|ZP_01971080.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           NCTC 8457]
 gi|153822238|ref|ZP_01974905.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           B33]
 gi|153826888|ref|ZP_01979555.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MZO-2]
 gi|227082527|ref|YP_002811078.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Vibrio cholerae
           M66-2]
 gi|229507534|ref|ZP_04397039.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           BX 330286]
 gi|229512270|ref|ZP_04401749.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           B33]
 gi|229514033|ref|ZP_04403495.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           TMA 21]
 gi|229519406|ref|ZP_04408849.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           RC9]
 gi|229521235|ref|ZP_04410655.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           TM 11079-80]
 gi|229524390|ref|ZP_04413795.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           bv. albensis VL426]
 gi|229528609|ref|ZP_04417999.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           12129(1)]
 gi|229607040|ref|YP_002877688.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MJ-1236]
 gi|254226622|ref|ZP_04920202.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           V51]
 gi|254291798|ref|ZP_04962583.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           AM-19226]
 gi|254849526|ref|ZP_05238876.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MO10]
 gi|255746923|ref|ZP_05420868.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholera
           CIRS 101]
 gi|262161534|ref|ZP_06030644.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           INDRE 91/1]
 gi|297581031|ref|ZP_06942956.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           RC385]
 gi|298500236|ref|ZP_07010041.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MAK 757]
 gi|22095911|sp|Q9KPG4|MRAY_VIBCH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|254813263|sp|C3LQU9|MRAY_VIBCM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|9656977|gb|AAF95547.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           O1 biovar El Tor str. N16961]
 gi|121548134|gb|EAX58207.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           2740-80]
 gi|121629349|gb|EAX61780.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           V52]
 gi|124115515|gb|EAY34335.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           1587]
 gi|124121138|gb|EAY39881.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MZO-3]
 gi|125620841|gb|EAZ49195.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           V51]
 gi|126511046|gb|EAZ73640.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           NCTC 8457]
 gi|126520248|gb|EAZ77471.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           B33]
 gi|149739304|gb|EDM53560.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MZO-2]
 gi|150422310|gb|EDN14272.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           AM-19226]
 gi|227010415|gb|ACP06627.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Vibrio cholerae
           M66-2]
 gi|229332383|gb|EEN97869.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           12129(1)]
 gi|229337971|gb|EEO02988.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           bv. albensis VL426]
 gi|229341767|gb|EEO06769.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           TM 11079-80]
 gi|229344095|gb|EEO09070.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           RC9]
 gi|229349214|gb|EEO14171.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           TMA 21]
 gi|229352235|gb|EEO17176.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           B33]
 gi|229355039|gb|EEO19960.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           BX 330286]
 gi|229369695|gb|ACQ60118.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MJ-1236]
 gi|254845231|gb|EET23645.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MO10]
 gi|255735325|gb|EET90725.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholera
           CIRS 101]
 gi|262028845|gb|EEY47499.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           INDRE 91/1]
 gi|297534857|gb|EFH73693.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           RC385]
 gi|297540929|gb|EFH76983.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           MAK 757]
 gi|327484900|gb|AEA79307.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Vibrio cholerae
           LMA3894-4]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PHSSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|146342501|ref|YP_001207549.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Bradyrhizobium
           sp. ORS278]
 gi|166219009|sp|A4YZK6|MRAY_BRASO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|146195307|emb|CAL79332.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Bradyrhizobium
           sp. ORS278]
          Length = 368

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 198/374 (52%), Positives = 259/374 (69%), Gaps = 14/374 (3%)

Query: 1   MFIQLADFSEYY-------IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           MF  L + +  +        + +V +Y+TFR+  A  +  L VF FGP +ID LR  Q  
Sbjct: 1   MFYWLIELTNTFPSLSVFRGVLNVFRYITFRTGGAVVTGALFVFLFGPWIIDHLRLRQGK 60

Query: 54  RGQPVRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLV 112
            GQP+R      H   K  TPTMGG++IL GL+ S++LWA+  + +V I+L +TL FG V
Sbjct: 61  -GQPIRTDGPQSHIISKKGTPTMGGLMILSGLVVSTVLWANPLNPYVWIVLAVTLGFGFV 119

Query: 113 GFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFR 172
           GFYDDY+K+T     G +G+ R+LIE  IA++A  AL+           + T +  PFF+
Sbjct: 120 GFYDDYLKVTKQSHSGFAGRARLLIEAAIALVACYALVRLGRD-----PSSTGLAIPFFK 174

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
           D+++  G  ++ F AFVIV   NAVNLTDGLDGLAIVPVMIAS +F  IAY+AGN + S 
Sbjct: 175 DLVIKFGWMYVIFGAFVIVGAGNAVNLTDGLDGLAIVPVMIASASFGLIAYLAGNAVFSD 234

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YLQ+++V G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KH
Sbjct: 235 YLQIHYVAGTGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKH 294

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI+L +IGGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFE+ GWTE QIVIRFWIIS
Sbjct: 295 EIVLAVIGGLFVLEAVSVIVQVASFKLTGKRIFRMAPIHHHFEQLGWTEPQIVIRFWIIS 354

Query: 353 FIFAVIGLLTLKMR 366
            + A++GL TLK+R
Sbjct: 355 VMLALVGLSTLKLR 368


>gi|145297482|ref|YP_001140323.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142850254|gb|ABO88575.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 154/367 (41%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    ++   +V  Y+TFR+  +  + +++    GP +I  L+ L+   GQ +R
Sbjct: 1   MLVWLAELLTPHFTFFNVFSYLTFRAILSIITGLVVALWMGPHLIRRLQILK--FGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++I+  +  S LLW+   + +V ++L +  ++G +GF DDY+
Sbjct: 59  NDGPESHLSKRGTPTMGGLMIIAAIFISVLLWSRLDNPYVWLVLFVLGAYGAIGFADDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  +A+L    L   +       + +T +V PF +D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAVALLVAVFLYTTATH-----DGQTQLVVPFLKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + +V
Sbjct: 174 LMFIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGGFALIAWATGNVNFANYLHIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 PYTSELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+   R+F MAPIHHH+EKKGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGVRIFRMAPIHHHYEKKGWPEPRVIVRFWIITLMLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|311280933|ref|YP_003943164.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter
           cloacae SCF1]
 gi|308750128|gb|ADO49880.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Enterobacter
           cloacae SCF1]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA   + +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVVSVLLWAYPWNPYVWCVLVVLVGYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYMAGKDT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|194434431|ref|ZP_03066693.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           dysenteriae 1012]
 gi|194417347|gb|EDX33454.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           dysenteriae 1012]
 gi|332098113|gb|EGJ03086.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           dysenteriae 155-74]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|333011475|gb|EGK30889.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri K-272]
 gi|333021718|gb|EGK40967.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri K-227]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNSYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|147674771|ref|YP_001217906.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           O395]
 gi|262168385|ref|ZP_06036082.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           RC27]
 gi|172047588|sp|A5F5N2|MRAY_VIBC3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|146316654|gb|ABQ21193.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           O395]
 gi|227014298|gb|ACP10508.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Vibrio cholerae
           O395]
 gi|262023277|gb|EEY41981.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           RC27]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PHSSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFW+IS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWVISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|153830350|ref|ZP_01983017.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           623-39]
 gi|148874157|gb|EDL72292.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           623-39]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + +LWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVMLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSTIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PHSSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|103487368|ref|YP_616929.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingopyxis
           alaskensis RB2256]
 gi|123379713|sp|Q1GRX6|MRAY_SPHAL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|98977445|gb|ABF53596.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingopyxis
           alaskensis RB2256]
          Length = 356

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 178/366 (48%), Positives = 244/366 (66%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA++  +    ++++Y++FRS AA  +AM++    GP+ I  LR  Q   GQP+R 
Sbjct: 1   MLYWLAEWLGFPGALNLIRYLSFRSGAAVATAMILGLWIGPRFILMLRMRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL+ L+ S+LLW D S+  V   L +T  F +VGF DDY K
Sbjct: 60  DGPQSHLAKKGTPTMGGLMILISLMISALLWMDLSNRFVWACLFVTAGFAVVGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G+ G+VR+L+EF+IA +AV  ++           T T +  PFF  I++ +G 
Sbjct: 120 VTKSSHRGIPGRVRLLVEFLIAGVAVLLIV---------SRTGTDLYLPFFSGIVIPLGP 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FA  +IV   NAVNLTDGLDGLA  PV+IAS+ F  I Y++GN+  + YL +  VP
Sbjct: 171 FYYVFAMVLIVGFGNAVNLTDGLDGLATFPVIIASLTFLVIVYLSGNVKFAGYLGIPHVP 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V  +A+IGA + FLWFN  PA +FMGDTGSLALG  +  IAV+ +HE++L+++G
Sbjct: 231 GAGELAVFAAAIIGACLAFLWFNAPPAAVFMGDTGSLALGGALATIAVTAQHELVLVLVG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV ++K T KRVF MAPIHHHFE+ GW E+ +VIRFWI+S + A+ GL
Sbjct: 291 GLFVVEALSVIIQVFWYKRTGKRVFRMAPIHHHFEQLGWPESTVVIRFWIVSIVLALAGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 ATLKLR 356


>gi|262190387|ref|ZP_06048647.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           CT 5369-93]
 gi|262033727|gb|EEY52207.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Vibrio cholerae
           CT 5369-93]
          Length = 360

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I LA+  + Y+    + +Y++FR+  +  +A+ I    GP++I  L+ LQ   GQ VR
Sbjct: 1   MIIWLAELLQPYFSFFRLFEYLSFRAIVSILTALGISLWMGPRMIKRLQMLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  + LLWAD ++ +V  +L + L +G VGF DDY 
Sbjct: 59  NEGPESHFSKRGTPTMGGVMILAAITITVLLWADLTNPYVWAVLAVLLGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  IA++   AL  +   T       T +V PFF+D++  +G
Sbjct: 119 KVVRKNTDGLIARWKYFWQSTIALVVAFALYAHGQDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I    FVIV T+NAVNLTDGLDGLAI+P ++ +  F+ IA+  GN+  ++YL + ++
Sbjct: 174 LMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGFAAIAWATGNVNFANYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVVV +A++GAG+GFLWFN  PA +FMGD G+LALG  +G IAV  + E +L+I+
Sbjct: 234 PHSSELVVVCTAMVGAGLGFLWFNTYPAQVFMGDVGALALGGALGTIAVLVRQEFVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|149914523|ref|ZP_01903053.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Roseobacter sp.
           AzwK-3b]
 gi|149811316|gb|EDM71151.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Roseobacter sp.
           AzwK-3b]
          Length = 360

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 193/366 (52%), Positives = 255/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L + S+     ++ +Y+TFR+  AF +A+   F FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLFWLTELSDGGDFFNLFRYITFRAGGAFLTALFFGFLFGPPLINVLRKRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   + +V I+L +TLSF  +GF+DDY K
Sbjct: 60  DGPETHLAKSGTPTMGGLLIVGALVTSTLLWARLDNAYVWIVLFVTLSFAAIGFWDDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+ G++R+ + F+IA +A     +Y        E +  +  P F+D++L++G 
Sbjct: 120 VSKQNVTGVPGRLRLALGFLIAAIAAVWAAWY-----HPPELQYQLALPVFKDVLLNLGW 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFA FVIV +ANAVNLTDGLDGLAI+PVMIA  A   IAY  G +  + YL V++VP
Sbjct: 175 FFIPFAMFVIVGSANAVNLTDGLDGLAIMPVMIAGGALGIIAYAVGRVDFTEYLDVHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++  + L G G+GFLW+N  PA +FMGDTGSLALG  +G IAV+TKHEI+L IIG
Sbjct: 235 GTGEILIFAAGLFGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVATKHEIVLGIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWII+ I A+IGL
Sbjct: 295 GLFVVEALSVIVQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIIALILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKVR 360


>gi|34499801|ref|NP_904016.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Chromobacterium
           violaceum ATCC 12472]
 gi|61214278|sp|Q7NPZ6|MRAY_CHRVO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|34105651|gb|AAQ62005.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Chromobacterium
           violaceum ATCC 12472]
          Length = 361

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 165/368 (44%), Positives = 230/368 (62%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD    +    +V  Y T R+  A  +A+ I    GP VI  L  L+   GQ VR
Sbjct: 1   MLLWLADLLGSHIRAFNVFNYTTLRAVMAALTALTISLLLGPWVIRKLTELK--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ +V ++L + L  G +GFYDD+ 
Sbjct: 59  NDGPQTHLVKAGTPTMGGSLILLAITLTTLLWADLSNKYVWLLLAVMLGTGALGFYDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD-M 178
           K+   D  G+S K ++  +  IAI A   L+  +      +   T ++ PFF+ +     
Sbjct: 119 KVVYKDPKGVSAKFKMAWQSAIAIGAGVFLIATAK-----LPASTELIVPFFKTVAYPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + F     FVIV T+NAVNLTDGLDGLA +P ++ S   +  AYVAG+ + S YL + F
Sbjct: 174 AVGFCVLTYFVIVGTSNAVNLTDGLDGLAALPTVLVSAGLAIFAYVAGHAVFSKYLGLPF 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG  E+VV  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L +
Sbjct: 234 IPGAHEVVVFCAAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEIVLFL 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+E LSV++QV  FK+T KRVF MAP+HHHFE KGW E Q+V+RFWI++ +  +I
Sbjct: 294 MGGLFVMEALSVMIQVTSFKLTGKRVFRMAPLHHHFELKGWKETQVVVRFWIVTMMLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLSTLKLR 361


>gi|56412397|ref|YP_149472.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197361333|ref|YP_002140968.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|61213942|sp|Q5PDC3|MRAY_SALPA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621815|sp|B5BLB9|MRAY_SALPK RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|56126654|gb|AAV76160.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|197092808|emb|CAR58234.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
          Length = 360

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYH 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++
Sbjct: 174 LFYILLSYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RYAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|15799771|ref|NP_285783.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 EDL933]
 gi|15829345|ref|NP_308118.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. Sakai]
 gi|26246020|ref|NP_752059.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           CFT073]
 gi|82775494|ref|YP_401841.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           dysenteriae Sd197]
 gi|168751403|ref|ZP_02776425.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4113]
 gi|168755695|ref|ZP_02780702.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4401]
 gi|168764034|ref|ZP_02789041.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4501]
 gi|168771311|ref|ZP_02796318.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4486]
 gi|168776931|ref|ZP_02801938.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4196]
 gi|168781972|ref|ZP_02806979.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4076]
 gi|168789614|ref|ZP_02814621.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC869]
 gi|168801514|ref|ZP_02826521.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC508]
 gi|195939303|ref|ZP_03084685.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808243|ref|ZP_03250580.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4206]
 gi|208812833|ref|ZP_03254162.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4045]
 gi|208818343|ref|ZP_03258663.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4042]
 gi|209398077|ref|YP_002268695.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4115]
 gi|217324779|ref|ZP_03440863.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. TW14588]
 gi|218687964|ref|YP_002396176.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           ED1a]
 gi|227885008|ref|ZP_04002813.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           83972]
 gi|254791224|ref|YP_003076061.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. TW14359]
 gi|261226844|ref|ZP_05941125.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255248|ref|ZP_05947781.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291280912|ref|YP_003497730.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O55:H7 str. CB9615]
 gi|293417963|ref|ZP_06660585.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B185]
 gi|300981124|ref|ZP_07175370.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 45-1]
 gi|301048479|ref|ZP_07195504.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 185-1]
 gi|309787237|ref|ZP_07681849.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           dysenteriae 1617]
 gi|331661133|ref|ZP_08362065.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA206]
 gi|331681472|ref|ZP_08382109.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H299]
 gi|54037806|sp|P64258|MRAY_ECO57 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|54041319|sp|P64257|MRAY_ECOL6 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|97179617|sp|Q32K05|MRAY_SHIDS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700983|sp|B5YZC3|MRAY_ECO5E RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|254813239|sp|B7MNU6|MRAY_ECO81 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|12512790|gb|AAG54391.1|AE005185_8 phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O157:H7 str. EDL933]
 gi|26106417|gb|AAN78603.1|AE016755_103 Phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           CFT073]
 gi|13359547|dbj|BAB33514.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|81239642|gb|ABB60352.1| possible phospho-N-acetylmuramoyl-pentapeptide transferase
           [Shigella dysenteriae Sd197]
 gi|187767751|gb|EDU31595.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4196]
 gi|188014533|gb|EDU52655.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4113]
 gi|189000418|gb|EDU69404.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4076]
 gi|189357084|gb|EDU75503.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4401]
 gi|189359900|gb|EDU78319.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4486]
 gi|189365901|gb|EDU84317.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4501]
 gi|189370790|gb|EDU89206.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC869]
 gi|189376354|gb|EDU94770.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC508]
 gi|208728044|gb|EDZ77645.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4206]
 gi|208734110|gb|EDZ82797.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4045]
 gi|208738466|gb|EDZ86148.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4042]
 gi|209159477|gb|ACI36910.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. EC4115]
 gi|209746574|gb|ACI71594.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Escherichia coli]
 gi|209746576|gb|ACI71595.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Escherichia coli]
 gi|209746578|gb|ACI71596.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Escherichia coli]
 gi|209746580|gb|ACI71597.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Escherichia coli]
 gi|209746582|gb|ACI71598.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Escherichia coli]
 gi|217321000|gb|EEC29424.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. TW14588]
 gi|218425528|emb|CAR06311.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           ED1a]
 gi|227837837|gb|EEJ48303.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           83972]
 gi|254590624|gb|ACT69985.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O157:H7 str. TW14359]
 gi|284919867|emb|CBG32922.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Escherichia
           coli 042]
 gi|290760785|gb|ADD54746.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O55:H7 str. CB9615]
 gi|291430681|gb|EFF03679.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B185]
 gi|300299665|gb|EFJ56050.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 185-1]
 gi|300409026|gb|EFJ92564.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 45-1]
 gi|307551931|gb|ADN44706.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           ABU 83972]
 gi|308924815|gb|EFP70310.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           dysenteriae 1617]
 gi|315294718|gb|EFU54061.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 153-1]
 gi|315300012|gb|EFU59250.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 16-3]
 gi|320179649|gb|EFW54598.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Shigella boydii
           ATCC 9905]
 gi|320190390|gb|EFW65040.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli O157:H7 str. EC1212]
 gi|320642126|gb|EFX11477.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. G5101]
 gi|320647489|gb|EFX16284.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H- str. 493-89]
 gi|320652823|gb|EFX21061.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H- str. H 2687]
 gi|320658212|gb|EFX25941.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320663521|gb|EFX30805.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320668833|gb|EFX35628.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323935139|gb|EGB31506.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E1520]
 gi|326345193|gb|EGD68936.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli O157:H7 str. 1125]
 gi|326346953|gb|EGD70687.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli O157:H7 str. 1044]
 gi|331052175|gb|EGI24214.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA206]
 gi|331081693|gb|EGI52854.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H299]
 gi|332095378|gb|EGJ00401.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella boydii
           5216-82]
          Length = 360

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLVGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|149910624|ref|ZP_01899262.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Moritella sp.
           PE36]
 gi|149806352|gb|EDM66327.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Moritella sp.
           PE36]
          Length = 360

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 161/367 (43%), Positives = 242/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +  SE++ +  V  Y+TFR+     +++ +    GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVWLFESLSEHFSLFRVFSYLTFRAIITILTSLFLTLWMGPKLIRYLQDMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  ++ S+LLWA   + +V I++ + ++FG +GF DDY 
Sbjct: 59  DDGPESHFSKRGTPTMGGVMILAAILISTLLWARLDNAYVWIMMFVFVAFGAIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   +  IAI     L   +     G   +T++V PFF++ + ++G
Sbjct: 119 KVIRKDTDGLIARWKYFWQSAIAIGIAVYLYVTA-----GSAAETTLVVPFFKEYMPELG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI    FVIV ++NAVNLTDGLDGLAI+P ++ + AF  +AY+  N+  + YL + ++
Sbjct: 174 LLFIVLTYFVIVGSSNAVNLTDGLDGLAILPTVLVAGAFMLVAYLTSNVKFAEYLFIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G +AV  + E +L+I+
Sbjct: 234 PQASELVIVCAAMVGAGLGFLWFNTYPAQVFMGDVGSLALGAGLGTLAVLVRQEFMLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIITIILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|16128080|ref|NP_414629.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24111532|ref|NP_706042.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 2a str. 301]
 gi|30061654|ref|NP_835825.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 2a str. 2457T]
 gi|74310706|ref|YP_309125.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella sonnei
           Ss046]
 gi|82542691|ref|YP_406638.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella boydii
           Sb227]
 gi|89106970|ref|AP_000750.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           str. K-12 substr. W3110]
 gi|91209151|ref|YP_539137.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           UTI89]
 gi|110640300|ref|YP_668028.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           536]
 gi|110804151|ref|YP_687671.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 5 str. 8401]
 gi|117622373|ref|YP_851286.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           APEC O1]
 gi|157158057|ref|YP_001461257.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E24377A]
 gi|157159558|ref|YP_001456876.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           HS]
 gi|170021557|ref|YP_001726511.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           ATCC 8739]
 gi|170079726|ref|YP_001729046.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|187733257|ref|YP_001878897.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella boydii
           CDC 3083-94]
 gi|188493107|ref|ZP_03000377.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           53638]
 gi|191167760|ref|ZP_03029567.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B7A]
 gi|191174587|ref|ZP_03036081.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           F11]
 gi|191174609|ref|ZP_03036100.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           F11]
 gi|194439404|ref|ZP_03071481.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           101-1]
 gi|209917280|ref|YP_002291364.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           SE11]
 gi|215485253|ref|YP_002327684.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218547544|ref|YP_002381335.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia
           fergusonii ATCC 35469]
 gi|218552670|ref|YP_002385583.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           IAI1]
 gi|218557027|ref|YP_002389940.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           S88]
 gi|218693556|ref|YP_002401223.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           55989]
 gi|237704236|ref|ZP_04534717.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia sp.
           3_2_53FAA]
 gi|238899488|ref|YP_002925284.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           BW2952]
 gi|253774883|ref|YP_003037714.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254037502|ref|ZP_04871579.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia sp.
           1_1_43]
 gi|254160209|ref|YP_003043317.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B str. REL606]
 gi|256020075|ref|ZP_05433940.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella sp. D9]
 gi|256025401|ref|ZP_05439266.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia sp.
           4_1_40B]
 gi|293476747|ref|ZP_06665155.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B088]
 gi|297519211|ref|ZP_06937597.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           OP50]
 gi|300816125|ref|ZP_07096348.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 107-1]
 gi|300821908|ref|ZP_07102052.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 119-7]
 gi|300905496|ref|ZP_07123260.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 84-1]
 gi|300919642|ref|ZP_07136133.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 115-1]
 gi|300931786|ref|ZP_07147086.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 187-1]
 gi|300949895|ref|ZP_07163858.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 116-1]
 gi|300955953|ref|ZP_07168286.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 175-1]
 gi|300984509|ref|ZP_07177001.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 200-1]
 gi|301028570|ref|ZP_07191800.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 196-1]
 gi|301303813|ref|ZP_07209933.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 124-1]
 gi|301646399|ref|ZP_07246281.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 146-1]
 gi|306815315|ref|ZP_07449464.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           NC101]
 gi|307136688|ref|ZP_07496044.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H736]
 gi|307311462|ref|ZP_07591104.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           W]
 gi|309796077|ref|ZP_07690489.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 145-7]
 gi|312966215|ref|ZP_07780441.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           2362-75]
 gi|312970181|ref|ZP_07784363.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           1827-70]
 gi|331640540|ref|ZP_08341688.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H736]
 gi|331645197|ref|ZP_08346308.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           M605]
 gi|331650984|ref|ZP_08352012.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           M718]
 gi|331666324|ref|ZP_08367205.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA271]
 gi|332281225|ref|ZP_08393638.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella sp. D9]
 gi|61228257|sp|P0A6W3|MRAY_ECOLI RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|61228258|sp|P0A6W4|MRAY_SHIFL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|97179611|sp|Q326E8|MRAY_SHIBS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|97179625|sp|Q3Z5S2|MRAY_SHISS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|122425023|sp|Q1RGA8|MRAY_ECOUT RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|123147291|sp|Q0T8B0|MRAY_SHIF8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|123148433|sp|Q0TLQ2|MRAY_ECOL5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166220377|sp|A1A7D2|MRAY_ECOK1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167011841|sp|A7ZHH8|MRAY_ECO24 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167011842|sp|A7ZW39|MRAY_ECOHS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189082228|sp|B1IR91|MRAY_ECOLC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700984|sp|B6HZ64|MRAY_ECOSE RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709937|sp|B7MAL0|MRAY_ECO45 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709939|sp|B7M130|MRAY_ECO8A RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709942|sp|B7LWF0|MRAY_ESCF3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621777|sp|B1XC64|MRAY_ECODH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621818|sp|B2U292|MRAY_SHIB3 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|254813237|sp|B7UID7|MRAY_ECO27 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|254813238|sp|B7LFV7|MRAY_ECO55 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|259496171|sp|C4ZRI2|MRAY_ECOBW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|40855|emb|CAA38864.1| MraY protein (AA 1-360) [Escherichia coli]
 gi|42059|emb|CAA35932.1| unnamed protein product [Escherichia coli]
 gi|1786275|gb|AAC73198.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           str. K-12 substr. MG1655]
 gi|21321968|dbj|BAB96655.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           str. K12 substr. W3110]
 gi|24050290|gb|AAN41749.1| phospho-N-acetylmuramoyl-pentapeptidetransferase [Shigella flexneri
           2a str. 301]
 gi|30039896|gb|AAP15630.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Shigella
           flexneri 2a str. 2457T]
 gi|73854183|gb|AAZ86890.1| phospho-N-acetylmuramoyl-pentapeptide transferase? [Shigella sonnei
           Ss046]
 gi|81244102|gb|ABB64810.1| putative phospho-N-acetylmuramoyl-pentapeptide transferase
           [Shigella boydii Sb227]
 gi|91070725|gb|ABE05606.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli UTI89]
 gi|110341892|gb|ABG68129.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           536]
 gi|110613699|gb|ABF02366.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Shigella
           flexneri 5 str. 8401]
 gi|115511497|gb|ABI99571.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           APEC O1]
 gi|157065238|gb|ABV04493.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           HS]
 gi|157080087|gb|ABV19795.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E24377A]
 gi|169756485|gb|ACA79184.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           ATCC 8739]
 gi|169887561|gb|ACB01268.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           str. K-12 substr. DH10B]
 gi|187430249|gb|ACD09523.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella boydii
           CDC 3083-94]
 gi|188488306|gb|EDU63409.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           53638]
 gi|190902186|gb|EDV61928.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B7A]
 gi|190905111|gb|EDV64759.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           F11]
 gi|190905134|gb|EDV64779.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           F11]
 gi|194421663|gb|EDX37673.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           101-1]
 gi|209910539|dbj|BAG75613.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           SE11]
 gi|215263325|emb|CAS07640.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218350288|emb|CAU95971.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           55989]
 gi|218355085|emb|CAQ87692.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia
           fergusonii ATCC 35469]
 gi|218359438|emb|CAQ96976.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           IAI1]
 gi|218363796|emb|CAR01456.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           S88]
 gi|222031918|emb|CAP74656.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           LF82]
 gi|226840608|gb|EEH72610.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia sp.
           1_1_43]
 gi|226902148|gb|EEH88407.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia sp.
           3_2_53FAA]
 gi|238862053|gb|ACR64051.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           BW2952]
 gi|242375923|emb|CAQ30604.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           BL21(DE3)]
 gi|253325927|gb|ACT30529.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972110|gb|ACT37781.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B str. REL606]
 gi|253976319|gb|ACT41989.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           BL21(DE3)]
 gi|260450706|gb|ACX41128.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           DH1]
 gi|281177307|dbj|BAI53637.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           SE15]
 gi|281599449|gb|ADA72433.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 2002017]
 gi|291321200|gb|EFE60642.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B088]
 gi|294491532|gb|ADE90288.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           IHE3034]
 gi|299878381|gb|EFI86592.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 196-1]
 gi|300306678|gb|EFJ61198.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 200-1]
 gi|300317173|gb|EFJ66957.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 175-1]
 gi|300402646|gb|EFJ86184.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 84-1]
 gi|300413282|gb|EFJ96592.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 115-1]
 gi|300450727|gb|EFK14347.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 116-1]
 gi|300460446|gb|EFK23939.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 187-1]
 gi|300525508|gb|EFK46577.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 119-7]
 gi|300531332|gb|EFK52394.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 107-1]
 gi|300840940|gb|EFK68700.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 124-1]
 gi|301075369|gb|EFK90175.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 146-1]
 gi|305850977|gb|EFM51432.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           NC101]
 gi|306908441|gb|EFN38939.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           W]
 gi|307629661|gb|ADN73965.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           UM146]
 gi|308120319|gb|EFO57581.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 145-7]
 gi|309700298|emb|CBI99586.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Escherichia
           coli ETEC H10407]
 gi|310337679|gb|EFQ02790.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           1827-70]
 gi|312289458|gb|EFR17352.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           2362-75]
 gi|312944693|gb|ADR25520.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|313646530|gb|EFS10991.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 2a str. 2457T]
 gi|315059310|gb|ADT73637.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           W]
 gi|315134781|dbj|BAJ41940.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli DH1]
 gi|315253161|gb|EFU33129.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 85-1]
 gi|315285167|gb|EFU44612.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 110-3]
 gi|315616134|gb|EFU96753.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           3431]
 gi|320172822|gb|EFW48054.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Shigella
           dysenteriae CDC 74-1112]
 gi|320183626|gb|EFW58469.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Shigella
           flexneri CDC 796-83]
 gi|320197462|gb|EFW72076.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli WV_060327]
 gi|323165970|gb|EFZ51750.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella sonnei
           53G]
 gi|323171250|gb|EFZ56898.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           LT-68]
 gi|323181784|gb|EFZ67197.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           1357]
 gi|323190231|gb|EFZ75507.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           RN587/1]
 gi|323380132|gb|ADX52400.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           KO11]
 gi|323939873|gb|EGB36073.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E482]
 gi|323945716|gb|EGB41764.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H120]
 gi|323950917|gb|EGB46794.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H252]
 gi|323955285|gb|EGB51058.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H263]
 gi|323960033|gb|EGB55679.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H489]
 gi|323970759|gb|EGB66013.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA007]
 gi|323975749|gb|EGB70845.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TW10509]
 gi|324008322|gb|EGB77541.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 57-2]
 gi|324012250|gb|EGB81469.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 60-1]
 gi|324017752|gb|EGB86971.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 117-3]
 gi|324118437|gb|EGC12331.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E1167]
 gi|325496023|gb|EGC93882.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia
           fergusonii ECD227]
 gi|330909934|gb|EGH38444.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli AA86]
 gi|331040286|gb|EGI12493.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           H736]
 gi|331045954|gb|EGI18073.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           M605]
 gi|331051438|gb|EGI23487.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           M718]
 gi|331066535|gb|EGI38412.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           TA271]
 gi|332098963|gb|EGJ03914.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella boydii
           3594-74]
 gi|332103577|gb|EGJ06923.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella sp. D9]
 gi|332341419|gb|AEE54753.1| phospho-N-acetylmuramoyl-pentapeptide-transferase MraY [Escherichia
           coli UMNK88]
 gi|332762335|gb|EGJ92602.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 2747-71]
 gi|332762648|gb|EGJ92913.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 4343-70]
 gi|332764933|gb|EGJ95161.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri K-671]
 gi|332768877|gb|EGJ99056.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri 2930-71]
 gi|333009170|gb|EGK28626.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri K-218]
 gi|333010583|gb|EGK30016.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri VA-6]
 gi|333022262|gb|EGK41500.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shigella
           flexneri K-304]
          Length = 360

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGVAFALYLAGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|91776624|ref|YP_546380.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacillus
           flagellatus KT]
 gi|122399512|sp|Q1GYZ8|MRAY_METFK RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|91710611|gb|ABE50539.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacillus
           flagellatus KT]
          Length = 361

 Score =  283 bits (724), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 166/368 (45%), Positives = 239/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA +  +     +V  Y+T R+  A  +A+ I F  GPK+I  L   +   GQ VR
Sbjct: 1   MLLELARWLAQDIRGFNVFNYITLRAVLATLTALTISFLVGPKLIRKLTEYK--VGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ S+LLWAD S+  V ++L+ TL FG++G+ DD+ 
Sbjct: 59  DDGPQTHLVKAGTPTMGGALILIAIVISTLLWADLSNRFVWVVLITTLGFGVIGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRD-IILDM 178
           K+   +  GLS K +   + +I       L   +      +  +T ++ PFF+  ++   
Sbjct: 119 KVVYRNPKGLSAKAKYFWQSLIGAGVAAYLFHTAT-----VPAETELIVPFFKHLVLPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + FI    FVIV T+NAVNLTDGLDGLAI+P ++ + A +  AYVAG++  S YL V +
Sbjct: 174 AVSFIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVASALAVFAYVAGHLYFSKYLGVPY 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V  +A+ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 VPGAGELTVFCAAIGGAGLGFLWFNAYPAEVFMGDVGALALGAALGTVAVIVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ET+SV++QVG FK+T KR+F MAP+HHH+E KGW E Q+V+RFWII+ +  ++
Sbjct: 294 MGGVFVMETISVMLQVGSFKLTGKRIFRMAPLHHHYELKGWKETQVVVRFWIITMMLVLV 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLSTLKLR 361


>gi|149201999|ref|ZP_01878973.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius sp.
           TM1035]
 gi|149145047|gb|EDM33076.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseovarius sp.
           TM1035]
          Length = 360

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 188/366 (51%), Positives = 253/366 (69%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  +S+     ++ +Y+TFR+  AF +A++  F FG  +I  LR  Q   GQP+R 
Sbjct: 1   MLYWLTIWSDGGDFFNLFRYITFRAGGAFMTALIFGFLFGAPLIMVLRKRQGK-GQPIRS 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++I+  L+ S+LLWA   + +V ++L +TLSF L+GF DDY K
Sbjct: 60  DGPEGHFSKAGTPTMGGLLIVGALVTSTLLWARLDNPYVWLVLFVTLSFALIGFADDYAK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ++  +  G+S +VR+ + F+IA++A               E +  +  P F+D+++++G 
Sbjct: 120 VSKQNVKGVSSRVRLGLGFLIALIAAYWAGL-----NHPSELQYQLALPVFKDVLINLGF 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FIPFA FVIV  ANAVNLTDGLDGLAI+PVMIAS A   IAY  G +  + YL +++VP
Sbjct: 175 LFIPFAMFVIVGAANAVNLTDGLDGLAIMPVMIASSALGVIAYTVGRVDFTDYLGLHYVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GE+++ ++ L+G G+GFLW+N  PA +FMGDTGSLALG  +G IAV TKHE++L I+G
Sbjct: 235 GTGEILIFVAGLVGGGLGFLWYNAPPAAVFMGDTGSLALGGALGAIAVVTKHELVLGIVG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV YFK T KRVFLMAPIHHH+EKKGW E QIVIRFWII+ I A+IGL
Sbjct: 295 GLFVVEALSVIIQVLYFKRTGKRVFLMAPIHHHYEKKGWAEPQIVIRFWIIALILAMIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 ATLKLR 360


>gi|114321345|ref|YP_743028.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311121|sp|Q0A6J9|MRAY_ALHEH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|114227739|gb|ABI57538.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 360

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLA-DFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA      Y   +V +Y+TFR+     +A+ I    GP VI  L   Q   GQ VR
Sbjct: 1   MLYHLAMALEGVYSGFNVFQYLTFRTILGVLTALGIALLVGPAVIQRLVEHQ--IGQQVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLW+D ++ +V ++LL TL+FG++G  DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGALILVAIAVATLLWSDLTNRYVWVVLLTTLAFGVIGGVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+  G++ GLS + +   + ++A++A   L   + S       +TS++ P F+D++L +G
Sbjct: 119 KLALGNSKGLSARAKFFWQTVVALMAAVFLFSTAQS-----PLETSLIVPLFKDVVLPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FIP    V+V ++NAVNLTDGLDGLAI+P ++ +   +  AY  G+ + + YL + FV
Sbjct: 174 LLFIPLVWLVVVGSSNAVNLTDGLDGLAILPSVLVAGGLAVFAYATGHAVFADYLGIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GE+VV   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L+I+
Sbjct: 234 AGAGEVVVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGILAVVVRQELVLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSV++QV  +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVVETLSVMLQVASYKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVVLVLVG 353

Query: 360 LLTLKMR 366
           L  LK+R
Sbjct: 354 LAMLKVR 360


>gi|88704097|ref|ZP_01101812.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Congregibacter
           litoralis KT71]
 gi|88701924|gb|EAQ99028.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Congregibacter
           litoralis KT71]
          Length = 360

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 234/367 (63%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD+   +     V +Y+T R   A  +A+LI    GP +I  L   Q   GQ VR
Sbjct: 1   MLMILADYLAQFESAFRVFQYLTLRGILAAGTALLISLLVGPVMIRRLSYYQ--VGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD S+ +V + LL+T +FG VG+ DDY 
Sbjct: 59  SDGPESHLEKSGTPTMGGALILVAIAISTLLWADLSNAYVWVALLVTAAFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + + L + +  + A   L   ++S        T +  PFF+DI + MG
Sbjct: 119 KVVERNHRGLPARWKYLWQSVAGLSAAVFLFMTADS-----PVTTQLFIPFFKDIAIPMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+  A FVIV  +NAVNLTDGLDGLAI+P ++   A   IAY+ GN+  + YLQ+ +V
Sbjct: 174 AAFVVLAYFVIVGASNAVNLTDGLDGLAILPTVLVGTALGLIAYLTGNVNFAQYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V   ++ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV T+HEI+  I+
Sbjct: 234 AGSGELSVFCGSIAGAGLGFLWFNTYPAQVFMGDVGALALGAALGTVAVITRHEIVFFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T KR+F MAPIHHH+E KGW E ++++RFWII+ +  + G
Sbjct: 294 GGIFVLETVSVILQVASFKLTGKRLFRMAPIHHHYELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|240948409|ref|ZP_04752787.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           minor NM305]
 gi|240297235|gb|EER47793.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           minor NM305]
          Length = 360

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y  + +V+ Y+TFRS  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTVFNVVSYITFRSIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  +  S+LLWAD  + +V  +L +   +G+VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGVMILASIGISTLLWADLRNSYVWFVLFVLFGYGVVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF++ +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALVAVFGIYAVGKDT-----AATQLVVPFFKEFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + F+
Sbjct: 174 VFFIVLSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNYNFAQYLHIPFI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 ANAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|254283822|ref|ZP_04958790.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium NOR51-B]
 gi|219680025|gb|EED36374.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium NOR51-B]
          Length = 360

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA+          V +Y+T R   A  +A+LI    GP +I  L  LQ   GQ VR
Sbjct: 1   MLKWLAEQLIPLEPGFAVFQYLTLRGILAAGTALLISLLVGPWMIRRLNRLQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
           +     H  K  TPTMGG +IL+ +  +SLLW D  S ++ + L +T++FG VG+ DDY 
Sbjct: 59  IDGPQTHLAKAGTPTMGGALILVSIAVASLLWGDLGSRYLWVTLAVTIAFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + + L + IIA++A   L   +         +T++  PFF+D+ L MG
Sbjct: 119 KVVEKDSRGLPARWKYLWQSIIAVIATVYLAASAVD-----PAETTLYVPFFKDVALSMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+PF+ FVIV ++NAVNLTDGLDGLAI+P ++ +     IAYV GNI  S YL + ++
Sbjct: 174 WLFVPFSYFVIVGSSNAVNLTDGLDGLAILPTVMVATGLGAIAYVTGNINFSDYLNIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GELV+   A+ G+G+GFLWFN  PA++FMGD G+LALGA +G +AV T+HEI+L+I+
Sbjct: 234 AGSGELVIFCGAIAGSGLGFLWFNTYPAMVFMGDVGALALGAALGVMAVITRHEIVLLIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ +  + G
Sbjct: 294 GGIFVLETVSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|220925311|ref|YP_002500613.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           nodulans ORS 2060]
 gi|254813243|sp|B8IMW7|MRAY_METNO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|219949918|gb|ACL60310.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           nodulans ORS 2060]
          Length = 361

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 201/367 (54%), Positives = 260/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ S  +   +V +Y+TFR+  A F+A L VF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLYLLSELSGVFSPFNVFRYITFRTGGALFTAGLFVFWFGPWIISLLRLRQGK-GQPIRE 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL+ + LLWA+  + +V I +++TL FG +GFYDDY+
Sbjct: 60  DGPQTHLLTKRGTPTMGGLMILAGLLVAVLLWANPRNSYVWITVVVTLGFGAIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G SGK R+ +E +IA+ A  A+  YS            + FP F+D I+++G
Sbjct: 120 KVTKQSHKGFSGKFRLGLEALIAVAACVAVAEYSAPG-----LAYRLAFPVFKDAIVNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I FA+FVIV   NAVN+TDGLDGLAIVPVMIA+  F  IAY+ GN++ + YLQVN+V
Sbjct: 175 LFWILFASFVIVGAGNAVNITDGLDGLAIVPVMIAAATFGIIAYLVGNVIYASYLQVNYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV  ALIGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L ++
Sbjct: 235 PGTGELAVVCGALIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGTVAVATKHEIVLAVV 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E  SVI+QV  FK+T KRVF MAPIHHHFE+KGW E Q+VIRFWII+ + A++G
Sbjct: 295 GGLFVLEIASVIIQVASFKLTGKRVFRMAPIHHHFEQKGWKEPQVVIRFWIIAVVLALLG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|254495863|ref|ZP_05108773.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Legionella
           drancourtii LLAP12]
 gi|254354899|gb|EET13524.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Legionella
           drancourtii LLAP12]
          Length = 361

 Score =  283 bits (723), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 169/368 (45%), Positives = 242/368 (65%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y    V +Y+TFRS  A  +A+L+    GP  I  LR+LQ   GQ VR
Sbjct: 1   MLYWLTQLFQGQYHALRVFQYLTFRSILAALTALLVGLLCGPLTIRWLRTLQ--IGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  S LLW D     + ++LL+TL  G+VG+ DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGVLILLAITVSCLLWGDLQQSSLWLVLLVTLGNGVVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL G+ +   + +IA++AV  L   +      +   T +  PFF+ + + +G
Sbjct: 119 KLVLKNSKGLPGRWKFFWQSVIALIAVIYLYMNAT-----LPVHTLLTVPFFKSVTVGLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF   A FVIV ++NAVNLTDGLDGLAI+P+++ + A    AY + N + +HYL + FV
Sbjct: 174 IFFPVLAYFVIVGSSNAVNLTDGLDGLAIMPIVMVAGALGIFAYASSNAVHAHYLGIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  ++++GAG+GFLW+N  PA +FMGD GSLALGA +G +AV  + E++L+++
Sbjct: 234 PNEGELTIFCASIVGAGLGFLWYNSYPAQLFMGDVGSLALGAALGIVAVVVRQELVLLMM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ETLSVI+QVGYFK T  KR+F MAP+HHHFE KGW+E +I++RFWII+ +F + 
Sbjct: 294 GGLFVIETLSVILQVGYFKYTHGKRLFRMAPLHHHFELKGWSEPKIIVRFWIITVVFVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|170738608|ref|YP_001767263.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           sp. 4-46]
 gi|229621785|sp|B0UFH5|MRAY_METS4 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|168192882|gb|ACA14829.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           sp. 4-46]
          Length = 361

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 200/367 (54%), Positives = 259/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L++ S  +   +V +Y+TFR+  A F+A L VF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLYLLSELSGVFSPFNVFRYITFRTGGALFTAGLFVFWFGPWIISLLRLRQGK-GQPIRE 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL+ +  LWA+  + +V I +++TL FG +GFYDDY+
Sbjct: 60  DGPQTHLLTKRGTPTMGGLMILAGLLVAVFLWANPRNSYVWITVVVTLGFGAIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G SGK R+ +E +IA+ A  A+  YS            + FP F+D I+++G
Sbjct: 120 KVTKQSHKGFSGKFRLGLEALIAVAACVAVAEYSAPG-----LAYRLAFPVFKDAIVNLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I FA+FVIV   NAVN+TDGLDGLAIVPVMIA+  F  IAY+ GN++ + YLQVN+V
Sbjct: 175 LFWIFFASFVIVGAGNAVNITDGLDGLAIVPVMIAAATFGIIAYLVGNVIYASYLQVNYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV  ALIGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L ++
Sbjct: 235 PGTGELAVVCGALIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGTVAVATKHEIVLAVV 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E  SVI+QV  FK+T KRVF MAPIHHHFE+KGW E Q+VIRFWII+ + A++G
Sbjct: 295 GGLFVLEIASVIIQVASFKLTGKRVFRMAPIHHHFEQKGWKEPQVVIRFWIIAVVLALLG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|90020492|ref|YP_526319.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Saccharophagus
           degradans 2-40]
 gi|122996462|sp|Q21MH2|MRAY_SACD2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|89950092|gb|ABD80107.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Saccharophagus
           degradans 2-40]
          Length = 360

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + Y     V+KY+TFR+     +A+ +    GP VI+ L  LQ   GQ +R
Sbjct: 1   MLLWLAEYLQQYISAFAVVKYLTFRAILGVMTALGLSLLLGPWVINKLNKLQ--IGQSIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  ++ ++LLW+D ++ +V  +L +TLSFGLVG+ DDY 
Sbjct: 59  DDGPESHLVKSGTPTMGGTLILFAIVFATLLWSDLTNRYVLAVLFVTLSFGLVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  K +   + +        L   +      I  +T++  PFF+ + L++G
Sbjct: 119 KVVQKNSKGLPAKWKYFWQSLAGFTVAYGLYVTAQ-----IPEETTLYIPFFKGVALELG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F+I    F++V  +NAVNLTDGLDGLAI+P ++   A   IAY+ GN   S YLQ+ +V
Sbjct: 174 VFYIILTYFMVVGFSNAVNLTDGLDGLAIMPTVMVGSALGIIAYLVGNANFSAYLQIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELVV  +AL GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  +HEI+ II+
Sbjct: 234 PGAGELVVYCAALAGAGLGFLWFNTYPAQVFMGDVGALALGAALGIIAVIVRHEIVFIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
            G+FV+ET+SVI+QV  FK+T +R+F MAP+HHHFE KGW E ++++RFWII+ +  + G
Sbjct: 294 SGIFVMETVSVILQVASFKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|193065890|ref|ZP_03046951.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E22]
 gi|193070843|ref|ZP_03051776.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E110019]
 gi|260842323|ref|YP_003220101.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O103:H2 str. 12009]
 gi|260853300|ref|YP_003227191.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O26:H11 str. 11368]
 gi|260866240|ref|YP_003232642.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O111:H- str. 11128]
 gi|300923131|ref|ZP_07139191.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 182-1]
 gi|301330132|ref|ZP_07222801.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 78-1]
 gi|192926477|gb|EDV81110.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E22]
 gi|192955873|gb|EDV86343.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E110019]
 gi|257751949|dbj|BAI23451.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O26:H11 str. 11368]
 gi|257757470|dbj|BAI28967.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O103:H2 str. 12009]
 gi|257762596|dbj|BAI34091.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Escherichia coli
           O111:H- str. 11128]
 gi|300420586|gb|EFK03897.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 182-1]
 gi|300843879|gb|EFK71639.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           MS 78-1]
 gi|320200394|gb|EFW74980.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Escherichia
           coli EC4100B]
 gi|323157846|gb|EFZ43949.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           EPECa14]
 gi|323160115|gb|EFZ46076.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           E128010]
 gi|323176395|gb|EFZ61987.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           1180]
          Length = 360

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGIAFALYLAGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|298369638|ref|ZP_06980955.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria sp.
           oral taxon 014 str. F0314]
 gi|298282195|gb|EFI23683.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria sp.
           oral taxon 014 str. F0314]
          Length = 360

 Score =  282 bits (722), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ L+  S++    +V +Y TFR+  A  +A++     GP  I  L   Q   GQ VR 
Sbjct: 1   MFVWLSHLSDWLSALNVFQYTTFRAVMAALTALVFSLLLGPWTIRKLT--QLKVGQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLIKNGTPTMGGSLILTAIAVSTLLWGNWANPYIWILLAVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD-MG 179
           +   D  G+S K +++ +  +AILA   L + +      + + T+ + PF + I     G
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAILAGVFLFYAAE-----LPSSTAFIVPFLKQIAYPLGG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V
Sbjct: 174 VGFVVLTYFVIVGTSNAVNLTDGLDGLAAFPVVLVAGGLAIFAYASGHAQFAQYLQLPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G  E+VV  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 AGANEVVVFCAAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  ++G
Sbjct: 294 GGLFVVEAVSVMLQVGWYKRTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LSTLKIR 360


>gi|223041553|ref|ZP_03611754.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           minor 202]
 gi|223017648|gb|EEF16058.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           minor 202]
          Length = 360

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFRS  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRSIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  +  S+LLWAD  + +V  +L +   +G+VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGVMILASIGISTLLWADLRNSYVWFVLFVLFGYGVVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF++ +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALVAVFGIYAVGKDT-----AATQLVVPFFKEFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + F+
Sbjct: 174 VFFIVLSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNYNFAQYLHIPFI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 SKAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|229588487|ref|YP_002870606.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens SBW25]
 gi|259509639|sp|C3KCS7|MRAY_PSEFS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229360353|emb|CAY47210.1| phospho-N-acetylmuramoyl-pentapeptide-transfera se [Pseudomonas
           fluorescens SBW25]
          Length = 360

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+ +    GP +I  L++LQ   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLTLRGILGVLTALCLSLFLGPWMIRTLQNLQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD  + +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLHNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S       +T+++ P  +D  + +G
Sbjct: 119 KVIEKNSKGLPSRWKYFWQSVFGVGAAIFLYTTAPSA-----VETTLIIPMLKDASIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  ++G
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|303250494|ref|ZP_07336691.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307251536|ref|ZP_07533443.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307256036|ref|ZP_07537824.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|302650482|gb|EFL80641.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306861000|gb|EFM93006.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306865458|gb|EFM97353.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 360

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 173/367 (47%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFR+  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL+ +  S+LLWAD  + +V  +L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFGYGAVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF+D +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDT-----AATQLVVPFFKDFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + FV
Sbjct: 174 IFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G +AV  + E+LL+I+
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTVAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|163751821|ref|ZP_02159037.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           benthica KT99]
 gi|161328306|gb|EDP99467.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           benthica KT99]
          Length = 360

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 175/367 (47%), Positives = 254/367 (69%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GPK+I+ L++LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYSGFNVFSYVTFRAILGLMTALVFCLWWGPKMIERLQTLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL G+  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  SDGPESHFSKNGTPTMGGILILAGIFISVLLWGDLGSRYVWVVLFVLASFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K + +++ I AI+    L   +++       +T +V PFF+D++  MG
Sbjct: 119 KVVRKDTKGLIAKWKYILQSIAAIVIAFYLYASADT-----PGETQLVVPFFKDVMPQMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +FI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 AYFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|254787000|ref|YP_003074429.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Teredinibacter
           turnerae T7901]
 gi|259509643|sp|C5BP37|MRAY_TERTT RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|237684166|gb|ACR11430.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Teredinibacter
           turnerae T7901]
          Length = 360

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 234/367 (63%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F E Y     V +Y+T R+     +A+ +    GP VI  L  LQ   GQ +R
Sbjct: 1   MLVWLANFLESYVSGFGVFQYLTLRAILGVLTALGLSMVLGPWVIRKLNELQ--IGQAIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  ++ ++LLWAD S+ +V  +L +T++FGL+G+ DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGTLILFSIVTATLLWADLSNRYVLAVLFVTITFGLIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  K +   +     +   AL   + +       +T++  PFF+++   MG
Sbjct: 119 KVVEKNSKGLPAKWKYFWQSACGFIVAIALFVTAQT-----PAETTLYIPFFKNVAWQMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + ++     +IV  +NAVNLTDGLDGLAI+P ++   A   IAY+ GN   S YL + FV
Sbjct: 174 VLYVFVTYLMIVGFSNAVNLTDGLDGLAIMPTVMVGSALGVIAYLVGNANFSEYLHIAFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELVV  +AL GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  +HEI+  I+
Sbjct: 234 PGSGELVVYCAALAGAGLGFLWFNTYPAQVFMGDVGALALGAALGVIAVIVRHEIVFFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
            G+FV+ET+SVI+QVG +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ I  + G
Sbjct: 294 SGIFVMETVSVILQVGSYKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVILVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|194364378|ref|YP_002026988.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stenotrophomonas
           maltophilia R551-3]
 gi|194347182|gb|ACF50305.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stenotrophomonas
           maltophilia R551-3]
          Length = 361

 Score =  282 bits (721), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 163/368 (44%), Positives = 237/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M  +LA + +    +  +  Y TFR+  A  +A+ +    GP +I  L   Q   GQP+R
Sbjct: 1   MLYELARWLQQLESLFGLFNYQTFRAILAALTALFLSLWLGPAMIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S L+WAD  + +V ++L + L FG +G+YDD+I
Sbjct: 59  KDGPQTHFSKAGTPTMGGSLILLTITLSVLMWADLRNRYVWLVLAVMLCFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLFYTAD-----VPAALTFYIPMFKSVALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ ++YLQ+  
Sbjct: 174 GIGFVTIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFANYLQIPQ 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GELV++ +A+ GAG+GFLWFN  PA++FMGD G+LALGA +G IAV T+ E++L+I
Sbjct: 234 IPGAGELVIICAAIAGAGLGFLWFNTYPAMVFMGDIGALALGAVLGTIAVITRQELVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|213426158|ref|ZP_03358908.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
          Length = 357

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 166/359 (46%), Positives = 235/359 (65%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
           F + Y   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR      H 
Sbjct: 6   FGQNYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQKL--SFGQVVRNDGPESHF 63

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY K+   D  
Sbjct: 64  SKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLIGYGIIGFVDDYRKVVRKDTK 123

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +     +IA+    AL      T       T +V PFF+D++  +GLF+I  + 
Sbjct: 124 GLIARWKYFWMSVIALGVAFALYLVGKDT-----PATQLVVPFFKDVMPQLGLFYILLSY 178

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
           FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  ++YL + ++   GELV+
Sbjct: 179 FVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNMNFANYLHIPYLRHAGELVI 238

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
           V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+GG+FVVET
Sbjct: 239 VCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIMGGVFVVET 298

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IGL TLK+R
Sbjct: 299 LSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR 357


>gi|118581692|ref|YP_902942.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pelobacter
           propionicus DSM 2379]
 gi|166221340|sp|A1AU64|MRAY_PELPD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|118504402|gb|ABL00885.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pelobacter
           propionicus DSM 2379]
          Length = 358

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 230/367 (62%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +    + ++ KY+TFR+  A  +A+L+ F  GP VI  L  LQ    Q +R
Sbjct: 1   MLYHLLYPLAGDVKLFNIFKYLTFRTIYAMITALLVCFVLGPWVIRVLEGLQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  ++  +LLWAD S+ ++  +L +T+ +GL+GF DDY 
Sbjct: 59  TDGPESHLQKQGTPTMGGVMILAAIVIPTLLWADLSNQYIWTVLFITIGYGLIGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++A      L                +  PFF++   D+ 
Sbjct: 119 KVVEKNPKGLSPRQKMFWQVLLAGAVGTFLFLKPG-------FNAQLFVPFFKNFHPDLW 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            ++IPF   VIV  +NAVNLTDGLDGLAI PV I +  +   +YVAG+  LS YLQV  V
Sbjct: 172 FWYIPFVTLVIVGASNAVNLTDGLDGLAIGPVAINAATYMLFSYVAGHATLSAYLQVPRV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV TK EILL+I+
Sbjct: 232 AGAGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGTLGAIAVITKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGIFVIEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|312959054|ref|ZP_07773573.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens WH6]
 gi|311286824|gb|EFQ65386.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens WH6]
          Length = 360

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+ +    GP +I  L++LQ   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLTLRGILGVLTALSLSLFLGPWMIRTLQNLQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD  + +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLHNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S       +T+++ P  +D  + +G
Sbjct: 119 KVIEKNSKGLPSRWKYFWQSVFGLAAAIFLYTTAPSA-----VETTLIIPMLKDASIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  ++G
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|254524595|ref|ZP_05136650.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stenotrophomonas
           sp. SKA14]
 gi|219722186|gb|EED40711.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stenotrophomonas
           sp. SKA14]
          Length = 361

 Score =  282 bits (720), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 163/368 (44%), Positives = 237/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M  +LA + +    +  +  Y TFR+  A  +A+ +    GP +I  L   Q   GQP+R
Sbjct: 1   MLYELARWLQQLESLFGLFNYQTFRAILAALTALFLSLWLGPAMIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S L+WAD  + +V ++L + L FG +G+YDD+I
Sbjct: 59  KDGPQTHFSKAGTPTMGGSLILLTITLSVLMWADLRNRYVWLVLAVMLCFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLFYTAD-----VPAALTFYIPMFKSVALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ ++YLQ+  
Sbjct: 174 GIGFVAIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFANYLQIPQ 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GELV++ +A+ GAG+GFLWFN  PA++FMGD G+LALGA +G IAV T+ E++L+I
Sbjct: 234 IPGAGELVIICAAIAGAGLGFLWFNTYPAMVFMGDIGALALGAVLGTIAVITRQELVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|209884379|ref|YP_002288236.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oligotropha
           carboxidovorans OM5]
 gi|226700988|sp|B6JCF5|MRAY_OLICO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|209872575|gb|ACI92371.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oligotropha
           carboxidovorans OM5]
          Length = 361

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 193/367 (52%), Positives = 258/367 (70%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF  L + +      +V +Y+TFR+  A  +  L VF FGP +ID LR L + +GQP+R 
Sbjct: 1   MFYWLTELAGTIPGINVFRYITFRTGGAMVTGALFVFLFGPWIIDHLR-LAQGKGQPIRA 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
              P H   K  TPTMGG++IL GL+ S+LLWA+  + +V ++L++TL FG VGFYDDY+
Sbjct: 60  DGPPTHLMTKKGTPTMGGLMILSGLVVSTLLWANLHNPYVWVVLMVTLGFGFVGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G SG++R+ +E +IA+ A   +++    + +       +  PF +D  +++G
Sbjct: 120 KVTKQTHAGFSGRLRLAVEGLIALFACLVIIWAGRDSSV-----MHLGIPFAKDFAINLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F++ F AF+IV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+ GN + S YLQ+ +V
Sbjct: 175 WFYLVFGAFIIVGAGNAVNLTDGLDGLAIVPVMIAAASFGMIAYLVGNAVFSEYLQIRYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+ KHEI+L +I
Sbjct: 235 AGTGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMIGSIAVAVKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV E LSVI+QV  FK+T KR+F MAPIHHH+E+KGWTE QIVIRFWII+ + A+ G
Sbjct: 295 GGLFVFEALSVIVQVASFKLTGKRIFRMAPIHHHYEQKGWTEPQIVIRFWIIAVMLALAG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|53803415|ref|YP_114846.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylococcus
           capsulatus str. Bath]
 gi|61213989|sp|Q604V4|MRAY_METCA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|53757176|gb|AAU91467.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylococcus
           capsulatus str. Bath]
          Length = 360

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ E Y+ +  V  Y+T R      +A++I F  GP +I  L S +   GQ +R
Sbjct: 1   MLLILANWLEHYFDVFRVFHYLTLRGILGILTALVISFIVGPPMIRYLGSYK--IGQTIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW+D  + +V  +LL+TL++GL+GF DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGALILVTITVSTLLWSDLGNRYVWAVLLVTLAYGLIGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL+ + + L + +  + A   L   ++S       +T  + PFF+ ++L+MG
Sbjct: 119 KLVLKNSKGLAARYKYLWQSVFGLGAALFLYHTASS-----PQETQFIVPFFKQVVLNMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             ++P   FV+V ++NAVNLTDGLDGLAI+P ++ +   +  AY +G+   S YL + ++
Sbjct: 174 WLYVPLVYFVVVGSSNAVNLTDGLDGLAILPTVLVAGGLAIFAYASGHSEFSEYLGIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELVV   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L+I+
Sbjct: 234 PKAGELVVFCGALVGAGLGFLWFNTYPAQVFMGDIGALALGAALGMVAVLVRQEIVLMIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QV  FK+T +R+F MAPIHHHFE KGW E ++++RFWIIS I  +IG
Sbjct: 294 GGIFVMETVSVMLQVLSFKLTGRRIFRMAPIHHHFELKGWPEPRVIVRFWIISVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|148257422|ref|YP_001242007.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Bradyrhizobium
           sp. BTAi1]
 gi|166219008|sp|A5EPK7|MRAY_BRASB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|146409595|gb|ABQ38101.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Bradyrhizobium
           sp. BTAi1]
          Length = 368

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 199/374 (53%), Positives = 259/374 (69%), Gaps = 14/374 (3%)

Query: 1   MFIQLADFSEYY-------IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           MF  L + +  +        + +V +Y+TFR+  A  +  L VF FGP +ID LR  Q  
Sbjct: 1   MFYWLIELTNTFPSLAMFRGLLNVFRYITFRTGGAVVTGALFVFLFGPWIIDHLRLRQGK 60

Query: 54  RGQPVRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLV 112
            GQP+R      H   K  TPTMGG++IL GL+ S++LWA+  + +V I+L +TL FG V
Sbjct: 61  -GQPIRADGPQSHIISKKGTPTMGGLMILSGLVVSTVLWANPLNPYVWIVLAVTLGFGFV 119

Query: 113 GFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFR 172
           GFYDDY+K+T     G +G+ RILIE  IA++A  AL+           + T +  PFF+
Sbjct: 120 GFYDDYLKVTKQSHSGFAGRARILIEAGIALVACYALVRLGRD-----PSSTGLAIPFFK 174

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
           D+++  G  ++ F AFVIV   NAVNLTDGLDGLAIVPVMIAS +F  IAY+AGN + S 
Sbjct: 175 DLVIKFGWMYVIFGAFVIVGAGNAVNLTDGLDGLAIVPVMIASASFGLIAYLAGNAVFSD 234

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YLQ+++V G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KH
Sbjct: 235 YLQIHYVAGTGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKH 294

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI+L +IGGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFE+ GWTE QIVIRFWIIS
Sbjct: 295 EIVLAVIGGLFVLEAVSVIVQVASFKLTGKRIFKMAPIHHHFEQLGWTEPQIVIRFWIIS 354

Query: 353 FIFAVIGLLTLKMR 366
            + A++GL TLK+R
Sbjct: 355 VMLALVGLSTLKLR 368


>gi|53729122|ref|ZP_00134086.2| COG0472: UDP-N-acetylmuramyl pentapeptide
           phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
           transferase [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126207503|ref|YP_001052728.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           pleuropneumoniae L20]
 gi|166219000|sp|A3MY87|MRAY_ACTP2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|126096295|gb|ABN73123.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 360

 Score =  282 bits (720), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 173/367 (47%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFR+  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL+ +  S+LLWAD  + ++  +L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYIWFVLFVLFGYGAVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF+D++  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + FV
Sbjct: 174 IFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|307260466|ref|ZP_07542161.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307262597|ref|ZP_07544227.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|306869869|gb|EFN01651.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306872020|gb|EFN03734.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 360

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 173/367 (47%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFR+  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL+ +  S+LLWAD  + +V  +L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFGYGAVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF++ +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDT-----AATQLVVPFFKEFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + FV
Sbjct: 174 IFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|222086447|ref|YP_002544981.1| phospho-N-acetylmuramoyl-pentapeptide- transferase protein
           [Agrobacterium radiobacter K84]
 gi|254813212|sp|B9JH54|MRAY_AGRRK RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|221723895|gb|ACM27051.1| phospho-N-acetylmuramoyl-pentapeptide- transferase protein
           [Agrobacterium radiobacter K84]
          Length = 373

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 214/374 (57%), Positives = 282/374 (75%), Gaps = 9/374 (2%)

Query: 1   MFIQLADFSEY-------YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           M I LA+ S++       +   ++ +Y+TFR+  A F++ LIVF FGP++I  LR  Q  
Sbjct: 1   MLIWLAELSDHIHFFSTHFRFLNLFRYITFRTGGALFTSALIVFLFGPRIISSLRVRQGR 60

Query: 54  RGQPVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVG 113
            GQP+R      H +K  TPTMGG++IL G++ SSLLWAD ++++V   LL+TL FG +G
Sbjct: 61  -GQPIRADGPQTHFKKAGTPTMGGLMILAGIVVSSLLWADLANVYVVATLLVTLGFGAIG 119

Query: 114 FYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFR 172
           FYDDY+K+T     G SG+ R+ +EFIIA +AV  ++  + +S   G    +SI FPFF+
Sbjct: 120 FYDDYLKVTKQSDKGFSGRARLGLEFIIAAIAVYFMMNTALSSGPAGSTFGSSIAFPFFK 179

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
             +L++G+FF+ F AFVIV+  NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN + + 
Sbjct: 180 SFMLNLGMFFVLFGAFVIVSAGNAVNLTDGLDGLAIVPVMIAAASFGVIAYLAGNFVFAD 239

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YL +NFVPG GEL VV+ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKH
Sbjct: 240 YLAINFVPGTGELAVVLGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKH 299

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI++ IIGGLFV+E LSVI+QVG+FKMT++RVFLMAPIHHHFEKKGWTE+Q+V+RFWI++
Sbjct: 300 EIVMAIIGGLFVLEALSVIIQVGFFKMTRRRVFLMAPIHHHFEKKGWTESQVVVRFWIVA 359

Query: 353 FIFAVIGLLTLKMR 366
            I A+IGL TLK+R
Sbjct: 360 VILAMIGLSTLKLR 373


>gi|239999608|ref|ZP_04719532.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae 35/02]
 gi|240081132|ref|ZP_04725675.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae FA19]
 gi|240126245|ref|ZP_04739131.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae SK-92-679]
          Length = 368

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 9   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 66

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 67  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 126

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + + ++   I     IV  F +  +    +
Sbjct: 127 VVYKDPNGVSAKFKMVWQSSVAVIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 182

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 183 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 242

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 243 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 302

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 303 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 362

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 363 STLKIR 368


>gi|70732387|ref|YP_262143.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens Pf-5]
 gi|97176883|sp|Q4K6J0|MRAY_PSEF5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|68346686|gb|AAY94292.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens Pf-5]
          Length = 360

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ +  Y    V +Y+T R      +A+ +    GP +I  L++ Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFYKGFAVFQYLTLRGILGVLTALSLALCLGPWMIRTLQNRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD  + +V ++LL+TL+FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSAIGISTLLWADLRNHYVWVVLLVTLAFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S       +T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLGAAIFLYMTAQS-----PVETTLLIPMLKDVSIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|77460897|ref|YP_350404.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens Pf0-1]
 gi|97176906|sp|Q3K741|MRAY_PSEPF RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|77384900|gb|ABA76413.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           fluorescens Pf0-1]
          Length = 360

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ +  Y    V +Y+T R      +A+++   +GP +I  L++ Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFYKGFAVFQYLTLRGILGVLTALVLSLCYGPWMIRTLQNRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGVSTLLWADLSNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   +++       +T+++ P  +D  + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLGAAIFLYMTAST-----PVETTLILPMLKDYSIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI    FVIV ++NAVNLTDGLDGLAI+P ++         Y++GN+  + YL + +V
Sbjct: 174 AGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGGLGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|300715305|ref|YP_003740108.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           billingiae Eb661]
 gi|299061141|emb|CAX58248.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Erwinia
           billingiae Eb661]
          Length = 360

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+    +Y   +V  Y+TFR+  +  +A+ I    GPK+I  L+ +    GQ VR
Sbjct: 1   MLVWLAEHLVTFYSGFNVFSYLTFRAIVSLLTALFISLWMGPKMIARLQEM--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S L+WA  S+ +V  +L++ + FG++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGVMILFSITVSVLMWAYPSNPYVWCVLVVLVGFGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +I++     L      T       T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVISLGVAFGLYIAGKGT-----PATELVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF++  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYVVLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|165975473|ref|YP_001651066.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303251837|ref|ZP_07338008.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307244816|ref|ZP_07526915.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307249138|ref|ZP_07531145.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249214|ref|ZP_07531211.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307253770|ref|ZP_07535624.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258227|ref|ZP_07539970.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|229621233|sp|B0BRH4|MRAY_ACTPJ RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|165875574|gb|ABY68622.1| phospho-N-acetylmuramoyl-pentapeptide-transferase E [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302649267|gb|EFL79452.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|306854261|gb|EFM86467.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306854426|gb|EFM86622.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858738|gb|EFM90797.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306863254|gb|EFM95194.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867687|gb|EFM99532.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 360

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 174/367 (47%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFR+  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL+ +  S+LLWAD  + +V  +L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFGYGAVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF+D +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDT-----AATQLVVPFFKDFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + FV
Sbjct: 174 IFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|114777865|ref|ZP_01452796.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Mariprofundus
           ferrooxydans PV-1]
 gi|114551856|gb|EAU54396.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Mariprofundus
           ferrooxydans PV-1]
          Length = 356

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 159/367 (43%), Positives = 234/367 (63%), Gaps = 12/367 (3%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L    E Y   ++ +Y+TFR+  A  ++++I +  GP  I  L++ Q   GQP+R
Sbjct: 1   MLYNLLYPLHEEYSFFNLFQYITFRTVYALITSLVICWLLGPWFIRWLKTAQGK-GQPIR 59

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ L  ++LLWAD +S  + + LL+TL +GLVG+ DDY+
Sbjct: 60  DDGPQTHLIKQGTPTMGGLLILLSLTVATLLWADLTSGFIWLALLVTLGYGLVGWLDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI  G+  GL+G+ ++L++ +   +A   L+  +            +  PFF     +MG
Sbjct: 120 KIMRGNPKGLAGRYKLLLQVLFGGIAAAGLMLMTEPL---------VDIPFFNMQ-WNMG 169

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F++ F  FV+V T+NAVNLTDGLDGLA+ P  +   + + + Y+AG+   S YL + FV
Sbjct: 170 WFYVVFVLFVLVGTSNAVNLTDGLDGLAVAPTFMVGSSLAVVVYLAGHAKFSAYLMIPFV 229

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL +   AL+G  +GFLWFN  PA +FMGD G+L+LG  +G +A +   ++LL I 
Sbjct: 230 PGAGELAIFCGALVGGCLGFLWFNTYPAQVFMGDVGALSLGGALGFVACAVHQQLLLAIA 289

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SV++QV  FK+T KRVF MAPIHHH+E KGW E ++++RFWIIS + A++ 
Sbjct: 290 GGLFVLEAVSVMVQVASFKLTGKRVFRMAPIHHHYELKGWPEPKVIVRFWIISILLALVA 349

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 350 LSTLKIR 356


>gi|91791719|ref|YP_561370.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           denitrificans OS217]
 gi|123061328|sp|Q12SC9|MRAY_SHEDO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|91713721|gb|ABE53647.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           denitrificans OS217]
          Length = 360

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   +    HV  YVTFR+     +A++     GPK+I  L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFHTGFHVFSYVTFRAILGLLTALVFSLWCGPKLIRRLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL G+  S LLW D  S +V ++L +  SFG +GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAGIFVSVLLWGDLESRYVLVMLFVLGSFGTIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + A++    L      +   +  +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAALVVAVFLY-----SSSTLPGETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI  A F IV  +NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL +  +
Sbjct: 174 LVFIVLAYFTIVGASNAVNLTDGLDGLAIMPTVMVAGAFALIAYLSGHVQFANYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PEAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|255020010|ref|ZP_05292083.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970539|gb|EET28028.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 360

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLA-DFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L       Y   +V +Y+T R   A  +A+++  A GP VI  LR      GQ VR
Sbjct: 1   MLYYLFMQLGSLYHGFYVFQYLTLRGVMAILTALVLSLALGPWVIARLRRY--RIGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ ++LLW+D  +  V + ++ T +FG +GF DD+ 
Sbjct: 59  SDGPETHLVKQGTPTMGGALILLVVLLTTLLWSDLGNPLVWVAIVTTSAFGAIGFIDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GLS + +  ++ ++A+ A   L   ++        +TS++ PF   +++ +G
Sbjct: 119 KLRRRNSKGLSARAKYGLQSLVALAAAGTLYALASK-----PVETSLIIPFVPHVLIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI F+ FVIV T+NAVNLTDGLDGLAIVP ++ + A    AYV+GN + + YL V +V
Sbjct: 174 LGFIVFSYFVIVGTSNAVNLTDGLDGLAIVPTVMVAGALGIFAYVSGNAVFAKYLGVPWV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG G++++   AL+GAG+GFLWFN  PA +FMGDTG+LALGA +  +A+  + E++L I+
Sbjct: 234 PGAGQMLIFCGALVGAGLGFLWFNTYPAEVFMGDTGALALGAALAIVAIVARQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSV++QV  F++T KRVF MAP+HHH+EKKGW E ++ +RFWII+ I  +IG
Sbjct: 294 GGVFVVETLSVMIQVTSFRLTGKRVFRMAPLHHHYEKKGWPEPRVAVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L +LK+R
Sbjct: 354 LSSLKIR 360


>gi|255068198|ref|ZP_05320053.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria sicca
           ATCC 29256]
 gi|255047540|gb|EET43004.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria sicca
           ATCC 29256]
          Length = 360

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 235/366 (64%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    +V +Y TFR+  A  +A+      GP  I  L   Q   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNVFQYTTFRAVMAALTALAFSLLLGPWTIRKLT--QLKVGQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLIKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + ++++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIVAALALFYLASNSSNNIL----IVPFFKQVALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+      IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFVVLTYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYASGHAQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|26988068|ref|NP_743493.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida KT2440]
 gi|148549595|ref|YP_001269697.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida F1]
 gi|167035506|ref|YP_001670737.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida GB-1]
 gi|325275013|ref|ZP_08141007.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas sp.
           TJI-51]
 gi|37999640|sp|Q88N79|MRAY_PSEPK RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167011848|sp|A5W8Q3|MRAY_PSEP1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189082239|sp|B0KFS9|MRAY_PSEPG RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|24982792|gb|AAN66957.1|AE016324_7 phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida KT2440]
 gi|148513653|gb|ABQ80513.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida F1]
 gi|166861994|gb|ABZ00402.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida GB-1]
 gi|313500440|gb|ADR61806.1| MraY [Pseudomonas putida BIRD-1]
 gi|324099852|gb|EGB97704.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas sp.
           TJI-51]
          Length = 360

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLSLRGILGVLTALSLALWLGPWMIRTLQIRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++L++TL+FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSAIAVSTLLWADLSNRYVWVVLIVTLAFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + ++      +T+++ PF +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLAAAVFLYKTAPTS-----VETTLILPFIKDVTIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 VGFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGSGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGIFVVETLSVVIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|296534968|ref|ZP_06897262.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseomonas
           cervicalis ATCC 49957]
 gi|296264706|gb|EFH11037.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Roseomonas
           cervicalis ATCC 49957]
          Length = 362

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 180/366 (49%), Positives = 254/366 (69%), Gaps = 7/366 (1%)

Query: 2   FIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVP 61
           F  L+  ++ +I+ ++ +YVTFR+ AA  +A+ I   FGP++I  LR+ Q   GQP+R  
Sbjct: 3   FNLLSSNADGFILFNLFRYVTFRAGAACMTALFISLFFGPRIIAWLRTFQNG-GQPIRTD 61

Query: 62  NLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
               H   K  TPTMGG+++L+ L  S+LLWAD  +  V  +LL+TL +GL+GF+DD++K
Sbjct: 62  GPEGHLLTKKGTPTMGGVLMLLALTVSTLLWADLRNGFVWAVLLVTLGYGLLGFWDDWLK 121

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T  +  G+SGK ++ ++  + ++A   +     + L+       +  P F+D ++  G+
Sbjct: 122 VTKRNTKGVSGKTKLAVQAGVGLVAAIWI-----TALMPGALADKLAMPVFKDALIGFGV 176

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F      V++  +NAVNLTDGLDGLA VPVM+A+  F  I+Y+ GN L + YLQ+N VP
Sbjct: 177 LFPLVGMLVMMGASNAVNLTDGLDGLATVPVMLAAAVFGLISYLVGNRLFAEYLQLNGVP 236

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  EL V  SALIGAG+GFLWFN  PA +FMGDTGSL+LG  +G +AV+TKHE++L I+G
Sbjct: 237 GTSELAVFCSALIGAGLGFLWFNAPPAKVFMGDTGSLSLGGALGAVAVATKHEVVLAIVG 296

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVET+SVI+QV ++K T +RVFLMAP+HHHFEKKGW E  IVIRFWII+ I A++GL
Sbjct: 297 GLFVVETVSVIIQVFWYKRTGRRVFLMAPLHHHFEKKGWAEATIVIRFWIIAMILALVGL 356

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 357 STLKIR 362


>gi|238898848|ref|YP_002924530.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466608|gb|ACQ68382.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 360

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   HV  Y+TFR+  +  +A+ I    GP  I  L+ LQ   GQ +R
Sbjct: 1   MLVWLAEYLVKFYSGFHVFSYLTFRAIISLLTALCIALWTGPAFIRWLQKLQ--IGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG+IIL+ +  S ++WA+ ++ +V  +L + + +G +GF DDY 
Sbjct: 59  DDGPQSHFSKSGTPTMGGLIILLSIFISVVIWANPANPYVWSVLFILVGYGFIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +A GLS + +   + I+A+L    L     +T     + T +V PFF++I+  +G
Sbjct: 119 KVVRKNARGLSPRWKYFWQSILALLLSFFLYSIGKNT-----SATQLVVPFFKEIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAI+P ++ +   + +A+  GNI  +HYL + ++
Sbjct: 174 LLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVLVAAGLALVAWATGNINFAHYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELVVV +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LLII+
Sbjct: 234 RHAGELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGILGTIAVLLRQEFLLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  +R+F MAPIHHHFE KGW E ++++RFWI+S +F +I 
Sbjct: 294 GGVFVIETLSVILQVGSFKLRGERIFRMAPIHHHFELKGWPEPRVIVRFWIVSLMFVLIA 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|148556851|ref|YP_001264433.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingomonas
           wittichii RW1]
 gi|166221362|sp|A5VDC9|MRAY_SPHWW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|148502041|gb|ABQ70295.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingomonas
           wittichii RW1]
          Length = 356

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 181/366 (49%), Positives = 248/366 (67%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   +A+   +  + ++++Y+TFR+ AA  +A+ I    GP+ I  LR  Q   GQP+R 
Sbjct: 1   MLYLIAEQLGFPGVLNLIRYITFRAGAAALTALFIGLIIGPRFIGWLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K+ TPTMGG++IL+ ++ S LLW D  + +V   + +TL FGL+GF DDY K
Sbjct: 60  DGPQTHLSKVGTPTMGGLMILISVMLSLLLWMDLGNRYVWACIGVTLGFGLIGFMDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +      G+SGK R+L EF+IA LA   ++             T +  PF+   ++D+G 
Sbjct: 120 VKKRSTKGVSGKARLLGEFLIAGLASWLIV---------SGNGTQLYVPFYNGPVIDLGP 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F++ FAAFVIVA  NAVNLTDGLDGLAI+PV+IAS+AF  IAY+ GN   + YL +  VP
Sbjct: 171 FYVVFAAFVIVAFGNAVNLTDGLDGLAIMPVVIASLAFFVIAYLVGNAKFAQYLGIPHVP 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G G+L ++ +A+IG G+ FLWFN  PA +FMGDTGSLALG  +G I+V   HEI+L I+G
Sbjct: 231 GAGDLTILTAAIIGGGLAFLWFNAPPAAVFMGDTGSLALGGALGVISVVAHHEIVLAIVG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+ET+SVI+QV ++K T KR+F MAPIHHHFE+ GW+E  +VIRFWIISF+ A+ GL
Sbjct: 291 GLFVMETISVILQVFFYKRTGKRIFRMAPIHHHFEQLGWSEPTVVIRFWIISFVLALAGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 ATLKLR 356


>gi|94498176|ref|ZP_01304737.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingomonas sp.
           SKA58]
 gi|94422306|gb|EAT07346.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingomonas sp.
           SKA58]
          Length = 357

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 183/366 (50%), Positives = 244/366 (66%), Gaps = 9/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA   ++  + ++++Y++FR+ AA  +A++I    GPK I  LR  Q   GQP+R 
Sbjct: 1   MLYWLAQTLDFAGVFNLIRYLSFRAGAAIATALVIGLVIGPKFIGWLRVRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  ++ S LLW D SS++V   L +TL FG +GF DDY K
Sbjct: 60  DGPQTHLAKRGTPTMGGLMILTSMVASVLLWMDLSSIYVWACLFVTLGFGAIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     GLSGK+R++ EF+IA +A   ++    +        T++  PF+    +++G 
Sbjct: 120 VTKASHKGLSGKMRLIFEFLIAGVAAWMIVNQHGN--------TALYVPFYNGPAIELGP 171

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAAFVIVA  NAVNLTDGLDGLA +PV+IA +AF  I Y+ G    + YL +  VP
Sbjct: 172 FYFCFAAFVIVAFGNAVNLTDGLDGLATMPVIIACLAFLLIVYLVGRADFAEYLGIPHVP 231

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G G L ++  A+IGAG+ FLWFN  PA +FMGDTGSLALG  IG IAV+  HEI+L IIG
Sbjct: 232 GAGNLTILCGAIIGAGLAFLWFNAPPAAVFMGDTGSLALGGTIGVIAVTAHHEIVLGIIG 291

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV ++K T KR+F MAPIHHHFE+ GW E  +VIRFWII+F+ A+ GL
Sbjct: 292 GLFVVEALSVIIQVFFYKRTGKRIFRMAPIHHHFEQLGWAEPTVVIRFWIIAFVLALAGL 351

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 352 ATLKLR 357


>gi|221235576|ref|YP_002518013.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Caulobacter
           crescentus NA1000]
 gi|254813229|sp|B8H097|MRAY_CAUCN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|220964749|gb|ACL96105.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Caulobacter
           crescentus NA1000]
          Length = 370

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 190/371 (51%), Positives = 257/371 (69%), Gaps = 6/371 (1%)

Query: 1   MFIQLADFS----EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQ 56
           M   L ++     E+    ++LKY+TFRS  A  +A ++  A G + I  +++ Q   GQ
Sbjct: 1   MLYLLYEWLARSQEHLPALNLLKYLTFRSGMAMLTAYIVAVAMGSRFIRWMKAKQGK-GQ 59

Query: 57  PVRVPNLPIHAR-KIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFY 115
           P+R   +  H   K  TPTMGG +IL GL  ++LLWAD  ++HV ++LL+T S+GL+GF 
Sbjct: 60  PIRTDGIARHVTEKAGTPTMGGFMILAGLFVAALLWADLRNVHVWVVLLITGSYGLLGFM 119

Query: 116 DDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDII 175
           DDY K+T     GLS   +++ +FI+AI+A   L+ ++  + +    +TS+VFP F+ ++
Sbjct: 120 DDYAKVTKQTTAGLSSVQKLVAQFIVAIIATVILILFAPKSPMTPGMETSLVFPIFKALV 179

Query: 176 LDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQ 235
           +++G F++ FAAF I   +NAVNLTDGLDGLAIVPVM A+  F  IAY+ GN   + YL 
Sbjct: 180 INLGWFYVAFAAFTIAGFSNAVNLTDGLDGLAIVPVMFAASTFGLIAYLVGNYKFADYLN 239

Query: 236 VNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEIL 295
           ++F PGVGEL V+  A+IG G+GFLW+N  PA IFMGDTGSLALG  +G IAV  KHE++
Sbjct: 240 LHFAPGVGELAVLCGAIIGGGMGFLWYNAPPAKIFMGDTGSLALGGALGAIAVCAKHELV 299

Query: 296 LIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIF 355
           L I+GGLFV E LSV++QV YFK T KRVFLMAPIHHHFEK GW E+ +VIRFWI+S I 
Sbjct: 300 LGIVGGLFVAEALSVMIQVAYFKKTGKRVFLMAPIHHHFEKLGWPESTVVIRFWIVSMIL 359

Query: 356 AVIGLLTLKMR 366
           A IGL TLK+R
Sbjct: 360 AFIGLATLKLR 370


>gi|110634360|ref|YP_674568.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Mesorhizobium
           sp. BNC1]
 gi|123057817|sp|Q11GS2|MRAY_MESSB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|110285344|gb|ABG63403.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Chelativorans
           sp. BNC1]
          Length = 360

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 203/366 (55%), Positives = 273/366 (74%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L   ++ + + +V +Y+TFR+  A  +A  IVF FGP +I  LR L++ +GQP+R 
Sbjct: 1   MLMLLVALADEFSVLNVFRYITFRTGGALITAAFIVFLFGPAIISSLR-LRQGKGQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++I  G++GSS+LW + SS++V ++L++ + FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMIFSGILGSSILWGNLSSVYVWVVLMVMVGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EF+IA  A   ++             +S+ FPFF++++L++G+
Sbjct: 120 VTKQSHLGFSGKSRLALEFVIAGFAAWIIMSAGQE-----PFSSSLTFPFFKELLLNLGI 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFVIV   NAVNLTDGLDGLA VPVM+A+ +F  IAY++GN + + YLQ++FVP
Sbjct: 175 FFIPFAAFVIVGAGNAVNLTDGLDGLATVPVMVAAASFGVIAYLSGNAIFADYLQIHFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V++ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI+L IIG
Sbjct: 235 GTGELSVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVLAIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E LSVI+QV  FKMT KRVFLMAPIHHHFEK GWTE+Q+VIRFWII+ + A+IGL
Sbjct: 295 GLFVIEILSVIIQVAVFKMTGKRVFLMAPIHHHFEKLGWTESQVVIRFWIIAVVLALIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKLR 360


>gi|221133801|ref|ZP_03560106.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Glaciecola sp.
           HTCC2999]
          Length = 360

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I L ++     I   VL Y+T R+  A  +++L+    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLILLTNWLMQLDIGFSVLNYLTLRAILATLTSLLMAIVIGPTMIKWLQQLQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K+ TPTMGG++IL  +I S +LWAD S+ +V + L + + +G+VGF DDY 
Sbjct: 59  DDGPQTHLQKMGTPTMGGVLILAAIITSVILWADLSNKYVWVTLTILIGYGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +   + +IA+     L      +      +T +V PFF+D++  +G
Sbjct: 119 KVVRKDSKGLIARWKYFWQTVIALAVAIFLY-----STTTQAEETQLVVPFFKDVVPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I F  F +V ++NAVNLTDGLDGLAIVP ++ + A +  AYV GNI  + YL + F+
Sbjct: 174 LMYIAFVYFTVVGSSNAVNLTDGLDGLAIVPTILVAGALAIFAYVTGNINFAIYLHIPFI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELV++  A+IGAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + EI+L+I+
Sbjct: 234 PQTSELVIICGAIIGAGLGFLWFNAYPAEVFMGDVGSLALGGVLGIIAVLVRQEIVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG FK+  KRVF MAPIHHHFE KGW E ++++RFWIIS I  ++G
Sbjct: 294 GGIFVIETLSVIIQVGSFKLRGKRVFRMAPIHHHFELKGWPEPKVIVRFWIISLILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|290476456|ref|YP_003469361.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Xenorhabdus
           bovienii SS-2004]
 gi|289175794|emb|CBJ82597.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Xenorhabdus
           bovienii SS-2004]
          Length = 360

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 234/367 (63%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD+  +Y+ + HV  Y+TFR+     +A+ I    GP +I  L+ LQ   GQ VR
Sbjct: 1   MLVWLADYLVKYHTVFHVFSYLTFRAIVGLLTALFIALWVGPTLIGYLQKLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW    + +V  +L + L +G+VGF DDY 
Sbjct: 59  DNGPESHFSKRGTPTMGGLLILFSITMSILLWTRLDNPYVWCVLAVLLGYGVVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +IA+    A+      T       T ++ PFF++++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWQSVIALGVAFAMYSMGKDT-----AATQLIVPFFKEVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +I  A FVIV T+NAVNLTDGLDGLAI+P +  +  F+ +A+   N+  + YL +  +
Sbjct: 174 LLYILLAYFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFAIVAWAMSNVKFALYLHIPHL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LLII+
Sbjct: 234 VHASELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLIIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|217979586|ref|YP_002363733.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylocella
           silvestris BL2]
 gi|254813244|sp|B8ETL9|MRAY_METSB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|217504962|gb|ACK52371.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylocella
           silvestris BL2]
          Length = 360

 Score =  281 bits (718), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 198/367 (53%), Positives = 262/367 (71%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   L  FS ++   ++ +Y+TFR+  A  +A+  VF FGP++I  LR +++ +GQP+R+
Sbjct: 1   MLTWLTQFSPHFQPLNLFRYITFRTGGATATALFFVFFFGPRIIAALR-IKQGKGQPIRL 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GLI S+LLWA+  + +V ++L +T  FGL+GFYDDY+
Sbjct: 60  DGPQSHLLTKKGTPTMGGLMILSGLIVSTLLWANLRNHYVWVVLFVTTGFGLIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K++     G  G++R+L+E  IA  A  A++       LG    TS+ FP      +D+G
Sbjct: 120 KVSKQSHKGFPGRIRLLLEVGIAGAACYAMML------LGTPHTTSLAFPAINGFAVDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LFF+    FVIV+  NAVNLTDGLDGLAIVPVMIA+  F  IAY+AGN + S YL +NFV
Sbjct: 174 LFFLVVGPFVIVSAGNAVNLTDGLDGLAIVPVMIAAGTFGVIAYLAGNAIFSTYLGINFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+ KHEI+L I+
Sbjct: 234 PGAGELSVVTGAVIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGAVAVAVKHEIVLAIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QV  FK+T +RVF MAPIHHHFE+ GW+E Q+V+RFWII+F+ A+IG
Sbjct: 294 GGLFVLETLSVIVQVISFKLTGRRVFKMAPIHHHFEQLGWSEPQVVVRFWIIAFVLALIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LSTLKLR 360


>gi|150397286|ref|YP_001327753.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           medicae WSM419]
 gi|166221361|sp|A6UB88|MRAY_SINMW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|150028801|gb|ABR60918.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           medicae WSM419]
          Length = 366

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 215/367 (58%), Positives = 279/367 (76%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + ++++   ++ +Y+TFR+ AA F++ LIVF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLIWLVELADHFQFFNLFRYITFRTGAALFTSALIVFLFGPAMIASLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++ SSLLWAD SS++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGIVVSSLLWADLSSIYVVSTLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIET-KTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  + S      T  +S+ FPFF+D++L++G
Sbjct: 120 VTKQSDKGFSGKARLGIEFVIASIAVFFMMQAALSAGAAGSTFGSSVTFPFFKDLMLNLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F  FVIV   N+VNLTDGLDGLAIVPVMIAS AF  IAY+AGN + ++YLQ++FV
Sbjct: 180 YFFVLFGGFVIVGAGNSVNLTDGLDGLAIVPVMIASAAFGLIAYLAGNAVFANYLQIHFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V++ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI+++II
Sbjct: 240 PGTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVMVII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QV +FK T  RVFLMAPIHHHFEKKGWTE+Q+VIRFWII+ I A++G
Sbjct: 300 GGLFVMETLSVIIQVFWFKRTGHRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVILAMVG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|330994426|ref|ZP_08318351.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter sp. SXCC-1]
 gi|329758426|gb|EGG74945.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter sp. SXCC-1]
          Length = 363

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 180/369 (48%), Positives = 252/369 (68%), Gaps = 9/369 (2%)

Query: 1   MFIQLADFSE--YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPV 58
           M   L       +  + ++ +Y+TFR+ AA  +A++I    G  +I  LR +Q   GQP+
Sbjct: 1   MLYDLFQHHATAHTSVFNLFRYITFRAGAACLTALVISLCLGNPLIAQLRRIQRG-GQPI 59

Query: 59  RVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDD 117
           R      H   K+ TPTMGG++IL+ L GS+LLWAD ++  V  ++L+TL+FG VGF DD
Sbjct: 60  RALGPERHLIEKVGTPTMGGVLILLSLFGSTLLWADLTNGFVWAVMLVTLAFGAVGFADD 119

Query: 118 YIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD 177
           Y+K++  +  G+S ++R+  EF  ++L    L       ++  E    + FPF +D++L 
Sbjct: 120 YLKLSRRNTDGVSKRMRLGCEFGASLLGGIWL-----EHMMPPELANHLAFPFVKDLLLP 174

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +G  F  FA   I    NAVN TDGLDGLAIVPV++A++ F+ I+Y+ GN + + YLQ++
Sbjct: 175 LGYAFPLFAMITITGFGNAVNFTDGLDGLAIVPVIVAALVFALISYLVGNHVFADYLQLH 234

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
            VPG GEL V  SAL+GAG+GFLWFN  PA +FMGDTGSLALG  +G +AV+ KHE++L 
Sbjct: 235 AVPGTGELGVFCSALVGAGLGFLWFNAPPAAVFMGDTGSLALGGALGAVAVAVKHELVLC 294

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           I+GGLFVVETLSVI+QV ++K T +RVFLMAP+HHHFEKKGW E++IVIRFWI+S +  +
Sbjct: 295 IVGGLFVVETLSVIIQVFWYKRTGRRVFLMAPLHHHFEKKGWAESKIVIRFWIVSIVLGL 354

Query: 358 IGLLTLKMR 366
            GL TLK+R
Sbjct: 355 CGLATLKLR 363


>gi|225023741|ref|ZP_03712933.1| hypothetical protein EIKCOROL_00605 [Eikenella corrodens ATCC
           23834]
 gi|224943623|gb|EEG24832.1| hypothetical protein EIKCOROL_00605 [Eikenella corrodens ATCC
           23834]
          Length = 360

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 159/366 (43%), Positives = 234/366 (63%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + LA  S +    ++ +Y TFR+  A  +A+      GP  I  L  L+   GQ +R 
Sbjct: 1   MLLWLAKLSNWISALNIFQYTTFRAVMAALTALAFSLMLGPWTIRKLTELKA--GQAIRS 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL+ +  S+LLW + S  ++ I+L + L  G +GFYDD+ K
Sbjct: 59  DGPKTHLAKAGTPTMGGVLILVSITVSTLLWGNVSHPYIWILLGVLLGTGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A+ A   L + ++++   I     IV  F +  +    +
Sbjct: 119 VVYKDPHGVSAKFKMVWQSSVALAAGLLLFYVASNSANNIL----IVPFFKQVALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  + F IV T+NAVNLTDGLDGLA  PV++ +   +  AY  G+   + YLQ+ FVP
Sbjct: 175 GFVVLSYFTIVGTSNAVNLTDGLDGLAAFPVVLVAGGMAVFAYATGHWQFARYLQLPFVP 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E++V  +A+ GA +GFLWFN +PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVMVFCAAMCGACLGFLWFNAAPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSV++QVG++K TKKR+FLMAPIHHHFE+KGW E Q+V+RFWII+ +  ++GL
Sbjct: 295 GLFVVEALSVMLQVGWYKKTKKRIFLMAPIHHHFEQKGWKETQVVVRFWIITIVLVLVGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|212635039|ref|YP_002311564.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           piezotolerans WP3]
 gi|226709946|sp|B8CNK8|MRAY_SHEPW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|212556523|gb|ACJ28977.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase
           (UDP-MurNAc-pentapeptide phosphotransferase) [Shewanella
           piezotolerans WP3]
          Length = 360

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 251/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GPK+I+ L+ LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYSGFNVFSYVTFRAILGLMTALMFSLWWGPKMIERLQLLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL G+  S LLW D  S +V ++L +  SFG +GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGLLILAGIFISVLLWGDLGSRYVWVVLFVLASFGTIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + L++ I AI+    L   +++       +T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYLLQSIAAIVIAVYLYASADTA-----GETQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI    F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 AFFIVLVYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|121998873|ref|YP_001003660.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Halorhodospira
           halophila SL1]
 gi|166220387|sp|A1WYU6|MRAY_HALHL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|121590278|gb|ABM62858.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Halorhodospira
           halophila SL1]
          Length = 360

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 161/367 (43%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA   E +Y   +V +Y+TFR+     +A+ I    GP VI  L   Q   GQ VR
Sbjct: 1   MLYHLAMVLETFYSGFNVFQYITFRTILGVLTALGIALMIGPAVIQRLVLHQ--VGQQVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD ++ +V ++LL+TL+FGL+G  DD +
Sbjct: 59  DDGPETHLEKAGTPTMGGALILVAIAVSTLLWADLTNRYVWVVLLVTLAFGLIGGVDDAL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL  + +  ++ + A+ A   L   +         +TS+V P  ++ +  +G
Sbjct: 119 KLARQDSQGLRARTKFSLQVLAALAASTFLFATATD-----PVETSLVLPLVKEWVFPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FI  A  VIV ++NAVNLTDGLDGLAI+P ++ +   +  AY +G+ + + YL +  V
Sbjct: 174 LGFIALATLVIVGSSNAVNLTDGLDGLAIMPTVLVATGLAVFAYASGHHVFADYLGIPSV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGELV+   A++GAG+GFLW+N  PA +FMGD G+LALGA +G +AV+ + EI+L I+
Sbjct: 234 PGVGELVIFCGAIVGAGLGFLWYNTYPAQVFMGDVGALALGAALGVVAVAVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QV  +K+T +RVF MAP+HHH+E KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGIFVMETVSVMIQVLSYKLTGRRVFRMAPLHHHYELKGWPEPRVIVRFWIITVVLVLIG 353

Query: 360 LLTLKMR 366
           L  LK+R
Sbjct: 354 LAMLKVR 360


>gi|162148958|ref|YP_001603419.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|189082231|sp|A9H0I1|MRAY_GLUDA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|161787535|emb|CAP57131.1| putaive phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 363

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 181/369 (49%), Positives = 247/369 (66%), Gaps = 9/369 (2%)

Query: 1   MFIQLADF--SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPV 58
           M   L     S +  + ++ +Y+TFR+ AA  +A+ I    G  +I  LR +Q   GQP+
Sbjct: 1   MLYDLIQHHGSAHVTVLNLFRYITFRAGAACLTALAISLLLGNPLIAQLRRIQ-REGQPI 59

Query: 59  RVPNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDD 117
           R      H   K  TPTMGG++IL  L GS+LLWAD +  +V  +LL TLSFG VGF DD
Sbjct: 60  RALGPERHILEKAGTPTMGGVLILAALFGSTLLWADLTDGYVWAVLLTTLSFGAVGFADD 119

Query: 118 YIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD 177
           Y+K++  +  G+S ++R+  EF  +++    +      +L+  +    + FPF ++ +L 
Sbjct: 120 YLKLSRRNTAGVSKRMRLGCEFAASLVGGYWM-----QSLMPADLANHLAFPFLKEWLLP 174

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +G  F  FA   I    NAVN TDGLDGLAIVPV+IA++ F  I+Y+ GN + + YLQ++
Sbjct: 175 LGFAFPLFAMITITGFGNAVNFTDGLDGLAIVPVIIAALVFGLISYLVGNHVFADYLQLH 234

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
            VPG GEL V  SAL+GAG+GFLWFN  PA +FMGDTGSL+LG  +G IAV+ KHE++L 
Sbjct: 235 AVPGTGELCVFCSALVGAGLGFLWFNAPPAAVFMGDTGSLSLGGALGAIAVAVKHELVLC 294

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           I+GGLFVVETLSVI+QV +F+ T +RVFLMAP+HHHFEKKGW E +IVIRFWI+S +  +
Sbjct: 295 IVGGLFVVETLSVIIQVFWFRRTGRRVFLMAPLHHHFEKKGWQEPKIVIRFWIVSIVLGL 354

Query: 358 IGLLTLKMR 366
            GL TLK+R
Sbjct: 355 CGLATLKLR 363


>gi|87122630|ref|ZP_01078507.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinomonas sp.
           MED121]
 gi|86162088|gb|EAQ63376.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinomonas sp.
           MED121]
          Length = 360

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L D+  + +    V  Y++ R+     +A +I    G  VI  L++LQ   GQ VR
Sbjct: 1   MLLLLTDYLSQSFTFFAVFNYLSLRAILGVLTAFVIALIIGGPVIRMLQNLQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +I+  +  S+LLW D S+ +V ++LL+ L+FG +G+ DDY 
Sbjct: 59  SDGPQSHLSKAGTPTMGGAMIIFSIAVSTLLWGDLSNEYVWVVLLVMLAFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  K +   + +  +LA   L   +++       +T ++ P F+D++L MG
Sbjct: 119 KVVEKNPRGLPAKWKYFWQSLFGLLAAVYLYMNAST-----PAETELIVPIFKDVVLPMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI    FVIV T+NAVNLTDGLDGLAI+P ++   A    AY+ GN+  S YL + +V
Sbjct: 174 IFFIVLTYFVIVGTSNAVNLTDGLDGLAILPTVLVGGALGVFAYLTGNVRFSEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GE+VV  +AL+GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EI+L I+
Sbjct: 234 GGAGEIVVFCAALVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGVIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+TK+R+F MAPIHHHFE KGW E ++++RFWII+    +IG
Sbjct: 294 GGVFVMETVSVILQVGSYKLTKRRIFRMAPIHHHFELKGWAEPKVIVRFWIITVCLVLIG 353

Query: 360 LLTLKMR 366
             TLK+R
Sbjct: 354 FATLKVR 360


>gi|190572799|ref|YP_001970644.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Stenotrophomonas
           maltophilia K279a]
 gi|190010721|emb|CAQ44330.1| putative phospho-N-acetylmuramoyl-pentapeptide-transfera se
           [Stenotrophomonas maltophilia K279a]
          Length = 361

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 163/368 (44%), Positives = 237/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M  +LA + +    +  +  Y TFR+  A  +A+ +    GP +I  L   Q   GQP+R
Sbjct: 1   MLYELARWLQQLESLFGLFNYQTFRAILAALTALFLSLWLGPAMIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S L+WAD  + +V ++L + L FG +G+YDD+I
Sbjct: 59  KDGPQTHFSKAGTPTMGGSLILLTITLSVLMWADLRNRYVWLVLAVMLCFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLFYTAD-----VPAALTFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ ++YLQ+  
Sbjct: 174 GIGFVAIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFANYLQIPQ 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GELV++ +A+ GAG+GFLWFN  PA++FMGD G+LALGA +G IAV T+ E++L+I
Sbjct: 234 IPGAGELVIICAAIAGAGLGFLWFNTYPAMVFMGDIGALALGAVLGTIAVITRQELVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|298293103|ref|YP_003695042.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Starkeya novella
           DSM 506]
 gi|296929614|gb|ADH90423.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Starkeya novella
           DSM 506]
          Length = 361

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 202/367 (55%), Positives = 267/367 (72%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+F       +V +Y+TFR+  A  +A+L VF FGP +I  LR L++ +GQP+R 
Sbjct: 1   MLQWLAEFQASVPALNVFRYITFRTGGAIITALLFVFMFGPAIIALLR-LKQGKGQPIRT 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++I  GL+ ++LLWA+ S+ +V ++L +T+ FGL+GFYDDY+
Sbjct: 60  DGPQSHLITKKGTPTMGGLMIFSGLMVATLLWANLSNPYVWVVLFVTIGFGLIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     GLSGK R+ IE +IA  A   ++             +S+ FPFF+D+++D+ 
Sbjct: 120 KVTKQTHNGLSGKARLAIEALIAGSAAVVIMHVGRE-----PLSSSLAFPFFKDLLIDLS 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F AFVIVA  NAVNLTDGLDGLAIVPVM+A+ +F  I+Y++GN+L + YLQ+++V
Sbjct: 175 WFFVIFGAFVIVAAGNAVNLTDGLDGLAIVPVMVAAASFGLISYLSGNVLFADYLQIHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL V+  A+IGAGIGFLWFN  PA IFMGDTGSLALG  +G IAV+ KHEI+L +I
Sbjct: 235 AGVGELAVICGAIIGAGIGFLWFNAPPAQIFMGDTGSLALGGLLGTIAVAAKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  FK+T KRVF MAPIHHHFE+KGWTE QIVIRFWII+ + A+IG
Sbjct: 295 GGLFVLEAVSVIVQVASFKLTGKRVFKMAPIHHHFEQKGWTEPQIVIRFWIIAVVLALIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|330811582|ref|YP_004356044.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379690|gb|AEA71040.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 360

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 235/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+ +    GP +I  L++LQ   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLTLRGILGVLTALSLSLFLGPWMIRTLQNLQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD ++ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLANRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S       +T+++ P  +D  + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLGAAIFLYMTAAS-----PVETTLILPMLKDYSIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI     VIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 AGFIVLTYLVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|15965932|ref|NP_386285.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           meliloti 1021]
 gi|307308242|ref|ZP_07587951.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           meliloti BL225C]
 gi|307319709|ref|ZP_07599134.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           meliloti AK83]
 gi|7387898|sp|Q52952|MRAY_RHIME RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|15075201|emb|CAC46758.1| Probable phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Sinorhizobium meliloti 1021]
 gi|306894640|gb|EFN25401.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           meliloti AK83]
 gi|306901240|gb|EFN31846.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sinorhizobium
           meliloti BL225C]
          Length = 366

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 216/367 (58%), Positives = 279/367 (76%), Gaps = 2/367 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + ++++   ++ +Y+TFR+ AA F++ LIVF FGP +I  LR  Q   GQP+R 
Sbjct: 1   MLIWLVELADHFQFFNLFRYITFRTGAALFTSALIVFLFGPAMIASLRIRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++ SSLLWAD SS++V   LL+TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILTGIVVSSLLWADLSSIYVVSTLLVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIET-KTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  + S      T  +S+ FPFF+D++L++G
Sbjct: 120 VTKQSEKGFSGKARLGIEFVIAAVAVFFMMQAALSAGAAGSTFGSSVTFPFFKDLMLNLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F  FVIV   N+VNLTDGLDGLAIVPVMIAS AF  IAY+AGN + ++YLQ++FV
Sbjct: 180 YFFVLFGGFVIVGAGNSVNLTDGLDGLAIVPVMIASAAFGLIAYLAGNAVFANYLQIHFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V++ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG +AV+TKHEI++III
Sbjct: 240 PGTGELAVILGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGTVAVATKHEIVMIII 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+ETLSVI+QV +FK T  RVFLMAPIHHHFEKKGWTE+Q+VIRFWII+ I A++G
Sbjct: 300 GGLFVIETLSVIIQVFWFKRTGHRVFLMAPIHHHFEKKGWTESQVVIRFWIIAVILAMVG 359

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 360 LSTLKLR 366


>gi|209545289|ref|YP_002277518.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532966|gb|ACI52903.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 363

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 180/369 (48%), Positives = 247/369 (66%), Gaps = 9/369 (2%)

Query: 1   MFIQLADF--SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPV 58
           M   L     + +  + ++ +Y+TFR+ AA  +A+ I    G  +I  LR +Q   GQP+
Sbjct: 1   MLYDLIQHHGAAHVTVLNLFRYITFRAGAACLTALAISLLLGNPLIAQLRRIQ-REGQPI 59

Query: 59  RVPNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDD 117
           R      H   K  TPTMGG++IL  L GS+LLWAD +  +V  +LL TLSFG VGF DD
Sbjct: 60  RALGPERHILEKAGTPTMGGVLILAALFGSTLLWADLTDGYVWAVLLTTLSFGAVGFADD 119

Query: 118 YIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD 177
           Y+K++  +  G+S ++R+  EF  +++    +      +L+  +    + FPF ++ +L 
Sbjct: 120 YLKLSRRNTAGVSKRMRLGCEFAASLVGGYWM-----QSLMPADLANHLAFPFLKEWLLP 174

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +G  F  FA   I    NAVN TDGLDGLAIVPV+IA++ F  I+Y+ GN + + YLQ++
Sbjct: 175 LGFAFPLFAMITITGFGNAVNFTDGLDGLAIVPVIIAALVFGLISYLVGNHVFADYLQLH 234

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
            VPG GEL V  SAL+GAG+GFLWFN  PA +FMGDTGSL+LG  +G IAV+ KHE++L 
Sbjct: 235 AVPGTGELCVFCSALVGAGLGFLWFNAPPAAVFMGDTGSLSLGGALGAIAVAVKHELVLC 294

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           I+GGLFVVETLSVI+QV +F+ T +RVFLMAP+HHHFEKKGW E +IVIRFWI+S +  +
Sbjct: 295 IVGGLFVVETLSVIIQVFWFRRTGRRVFLMAPLHHHFEKKGWQEPKIVIRFWIVSIVLGL 354

Query: 358 IGLLTLKMR 366
            GL TLK+R
Sbjct: 355 CGLATLKLR 363


>gi|194429386|ref|ZP_03061911.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B171]
 gi|194412606|gb|EDX28903.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Escherichia coli
           B171]
          Length = 360

 Score =  280 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+   +YY   +V  Y+TFR+  +  +A+ I    GP++I  L+ L    GQ VR
Sbjct: 1   MLVWLAEHLVKYYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIAHLQKL--SFGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  ++ S LLWA  S+ +V  +L++ + +G++GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGIMILTAIVISVLLWAYPSNPYVWCVLVVLVGYGVIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +     +IA+    AL      T       T +V PFF+D++  +G
Sbjct: 119 KVVRKDTKGLIARWKYFWMSVIALGIAFALYLAGKDT-----PATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  +  F+ +A+  GN+  + YL + ++
Sbjct: 174 LFYILLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAGGFALVAWATGNMNFASYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 RHAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGIIAVLLRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG FK+  +R+F MAPIHHH+E KGW E ++++RFWIIS +  +IG
Sbjct: 294 GGVFVVETLSVILQVGSFKLCGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|304321493|ref|YP_003855136.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Parvularcula
           bermudensis HTCC2503]
 gi|303300395|gb|ADM09994.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Parvularcula
           bermudensis HTCC2503]
          Length = 368

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 183/369 (49%), Positives = 254/369 (68%), Gaps = 4/369 (1%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L   F+E  I+ +V  Y+TFR+  A  +A+LI F  GP +I  +R  Q   GQP+R
Sbjct: 1   MLYHLLTPFAEEIILFNVFNYITFRTGGALMTALLISFVIGPPLIRWMRVRQGK-GQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG++IL+ ++ + LLWA   + +V  +L +T+ FGL+GF DDY
Sbjct: 60  TDGPQSHIIEKAGTPTMGGVLILLSVVIAVLLWAPLDNPYVWTVLGVTVGFGLLGFVDDY 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIE-TKTSIVFPFFRDIILD 177
           +K+T  +  G+ G  +++ +F +A+LA    +    ST        T++  PF ++ ++ 
Sbjct: 120 LKVTKQNTKGVVGSSKLVFQFALALLAGAVCVAVLRSTEGVDPAVATAVDVPFIKEWMIP 179

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +GLF  PFAA VIV ++NAVN+TDGLDGLAIVPVMIA+ +F+ IAY+ G    + YL + 
Sbjct: 180 LGLFIYPFAALVIVGSSNAVNMTDGLDGLAIVPVMIAAASFALIAYLVGRADYTAYLGLI 239

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
           +VPGVGEL V+  A++GAG+GFLWFN  PA+IFMGDTGSL+LG  +G IAV+ KHEI+L 
Sbjct: 240 YVPGVGELAVIGGAILGAGLGFLWFNAPPAMIFMGDTGSLSLGGALGAIAVAVKHEIVLA 299

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           IIGGLFV E +SV++Q+  FK+T KRVF MAP+HHHFE+ GW E+ IVIRFWII+ I A+
Sbjct: 300 IIGGLFVFEAVSVMIQIASFKLTGKRVFRMAPVHHHFEQLGWKESTIVIRFWIIAVILAL 359

Query: 358 IGLLTLKMR 366
           IGL +LK+R
Sbjct: 360 IGLSSLKLR 368


>gi|256821911|ref|YP_003145874.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Kangiella
           koreensis DSM 16069]
 gi|256795450|gb|ACV26106.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Kangiella
           koreensis DSM 16069]
          Length = 359

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 236/367 (64%), Gaps = 9/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LAD+  +YY   ++ +Y+TFRS  +  +A+ I    GP +I  L   Q   GQ VR
Sbjct: 1   MLTWLADYLSQYYSGFNLFQYLTFRSIVSVITALGISLLVGPTMIRRLSKYQ--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +I+  ++ SSL+W    + ++ + L+  + FGLVG  DDYI
Sbjct: 59  DDGPQTHLAKAGTPTMGGALIIFAIVFSSLMWGQLENRYLWVALIALVGFGLVGLADDYI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +I       L + ++        +T ++ PF +D++  +G
Sbjct: 119 KLVRKDPKGLVARWKYFWQSLIGAGIALYLFYNAS------PVETQLLVPFLKDVMPQLG 172

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI  A FVIV T+NAVNLTDGLDGLAI+P ++ +      AYV GN + S YL + F+
Sbjct: 173 VMFIFMAYFVIVGTSNAVNLTDGLDGLAILPTVLVASGLGIFAYVTGNQVFSEYLGIPFI 232

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGELV+  +A+IGAG+GFLWFN  PA +FMGD G+L LGA +G +AV  + E++L I+
Sbjct: 233 QGVGELVIFCAAIIGAGLGFLWFNTYPAQVFMGDVGALGLGAALGAVAVMVRQELVLFIM 292

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QVG +K+T KR+F MAP+HHH+E KGW E ++++RFWIIS I  +IG
Sbjct: 293 GGVFVIETLSVILQVGSYKLTGKRIFRMAPLHHHYELKGWPEPRVIVRFWIISLILVLIG 352

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 353 LATLKIR 359


>gi|325265592|ref|ZP_08132283.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Kingella
           denitrificans ATCC 33394]
 gi|324982940|gb|EGC18561.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Kingella
           denitrificans ATCC 33394]
          Length = 360

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 163/366 (44%), Positives = 233/366 (63%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + LA  S +    +V +Y TFR+  A  +A+      GP  I  L +L+   GQ VR 
Sbjct: 1   MLLWLARLSNWISALNVFQYTTFRAVMAALTALAFSLLLGPWTIRKLTALK--VGQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++ + ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILSTITLSTLLWGNWENAYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + +     G E    IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVALVAGFALFYLA----RGNENNILIVPFFKQVALPLGAV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FI  + F IV T+NAVNLTDGLDGLA  PV++ +   +  AY  G+   + YLQ+ +V 
Sbjct: 175 GFIILSYFTIVGTSNAVNLTDGLDGLAAFPVVLVAGGLAIFAYATGHFKFAEYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  SA+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCSAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIIRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ I  +IGL
Sbjct: 295 GLFVVEALSVMLQVGWYKRTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIILVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|254418352|ref|ZP_05032076.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brevundimonas
           sp. BAL3]
 gi|196184529|gb|EDX79505.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brevundimonas
           sp. BAL3]
          Length = 369

 Score =  280 bits (716), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 180/370 (48%), Positives = 259/370 (70%), Gaps = 5/370 (1%)

Query: 1   MFIQLADF----SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQ 56
           MF  L  +    +  Y + ++++Y T R++ A  +A ++  A G + I+ +R+ Q   GQ
Sbjct: 1   MFYLLYLYYADVAHQYPLLNLIQYQTVRAALALATAAIVAAAMGSRFINWIRAKQGK-GQ 59

Query: 57  PVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           P+R      H  K+ TPTMGG++IL G+  +  LW D ++ ++ I+  +T +FG++GF D
Sbjct: 60  PIRDDGPVSHLSKVGTPTMGGLMILAGIGVAVFLWGDLTNPYIWIVSGVTAAFGVLGFID 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+T   + GL+ K ++  + ++A++A    + +   +      +TSI FPFF+ ++L
Sbjct: 120 DYAKVTKQTSAGLTSKQKLAAQTVVAVIAGVLTVLWMKVSPTSPGLETSIAFPFFKAVLL 179

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
           ++G F++ FAAF IV  +NAVNLTDGLDGLA VPVM+A+ AF  IAY+AGN + + YLQV
Sbjct: 180 NIGWFYVAFAAFTIVGFSNAVNLTDGLDGLATVPVMMAAGAFGLIAYLAGNFVFAQYLQV 239

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           + VPG GEL +  +A+IG G GFLW+N  PA IFMGDTGSLALG  +G IAV+TKHE++L
Sbjct: 240 HHVPGAGELAIFCAAMIGGGAGFLWYNAPPAKIFMGDTGSLALGGALGAIAVTTKHELVL 299

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            I+GGLFV+E  SV++QVGY+K+TKKR+FLMAPIHHHFEK GW E+ +VIRFWII+   A
Sbjct: 300 GIVGGLFVMEAASVMIQVGYYKLTKKRIFLMAPIHHHFEKMGWPESTVVIRFWIIAGALA 359

Query: 357 VIGLLTLKMR 366
           +IGL TLK+R
Sbjct: 360 LIGLSTLKLR 369


>gi|317050621|ref|YP_004111737.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Desulfurispirillum indicum S5]
 gi|316945705|gb|ADU65181.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Desulfurispirillum indicum S5]
          Length = 357

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 171/367 (46%), Positives = 240/367 (65%), Gaps = 11/367 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   +E + + +V +Y+TFR+  A  +A+L+ F  GP +I  LR+ Q   GQ +R
Sbjct: 1   MLYNLLYPMAEQFPVLNVFRYITFRAIYAAITALLLSFLLGPSLIAYLRNKQ--FGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H+ K  TPTMGGI+I+   +  +LLWAD  +++V +I+L  +  GL+G  DD +
Sbjct: 59  TDGPQSHSGKRGTPTMGGILIIFATVIPTLLWADLKNMYVWLIVLTMVVGGLIGLADDLL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI    + GLSG+ ++L + ++A+     L              T +  PF++   LD+G
Sbjct: 119 KIFRNTSNGLSGRKKLLGQCLLALFVAYVLY--------ASGFSTGLNIPFYKQYALDLG 170

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L+FIPFA  VIV ++NAVNLTDGLDGLAI  V+I + AF+ I Y  G+   ++YL + FV
Sbjct: 171 LWFIPFAMLVIVGSSNAVNLTDGLDGLAIGAVLICAGAFAVIVYATGHAGFANYLLITFV 230

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL + + AL GAG+GFLW+N  PA IFMGD GSL++GA +G +AV  K EILL II
Sbjct: 231 RGVGELTIFLFALCGAGLGFLWYNSHPAEIFMGDVGSLSIGASLGAVAVMAKQEILLAII 290

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E LSVI+QV  FK+T KRVF MAPIHHHFE  G +E+++++R W ++ I A++G
Sbjct: 291 GGLFVLEALSVIIQVASFKLTGKRVFRMAPIHHHFELGGLSESKVIVRLWTVAIILALVG 350

Query: 360 LLTLKMR 366
           L TLKMR
Sbjct: 351 LSTLKMR 357


>gi|240014783|ref|ZP_04721696.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae DGI18]
 gi|240121306|ref|ZP_04734268.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID24-1]
          Length = 368

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 161/366 (43%), Positives = 239/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 9   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 66

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++L++ I+L + L+ G +GFYDD+ K
Sbjct: 67  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANLYIWILLGVLLATGALGFYDDWRK 126

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + + ++   I     IV  F +  +    +
Sbjct: 127 VVYKDPNGVSAKFKMVWQSSVAVIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 182

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 183 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 242

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 243 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 302

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 303 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 362

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 363 STLKIR 368


>gi|113460501|ref|YP_718565.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           somnus 129PT]
 gi|170718780|ref|YP_001783963.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           somnus 2336]
 gi|123031126|sp|Q0I1D6|MRAY_HAES1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621765|sp|B0US64|MRAY_HAES2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|112822544|gb|ABI24633.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           somnus 129PT]
 gi|168826909|gb|ACA32280.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           somnus 2336]
          Length = 361

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 172/368 (46%), Positives = 240/368 (65%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y  + +V  Y+T R+  A F+A+L+    GPKVI  L+ L+   GQ +R
Sbjct: 1   MLVWLAEYLHQYQSVFNVFSYLTVRAILALFTALLLSLWIGPKVIRRLQILK--FGQEIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  S+LLWA+ ++ +V   L +   +G VGF DDY 
Sbjct: 59  NDGPDSHLSKKGTPTMGGIMILFAIGVSTLLWANLANPYVWFCLFVLFGYGAVGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     +IA+++   +      T       T +V PFF+D++  +G
Sbjct: 119 KITRKNTAGLVARWKYFWLSVIALISAFGMYAIGKDTD-----ATRLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV T NAVNLTDGLDGLAI+P +  + AF+ IA+  GNI  S YL + ++
Sbjct: 174 LFYIVLAYFVIVGTGNAVNLTDGLDGLAIMPTVFVAAAFALIAWATGNIEWSKYLYIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               ELV+  +A++GAG+GFLWFN  PA +FMGD GSLALG  +G IAV  + E LL+I+
Sbjct: 234 KHTSELVIFCTAIVGAGLGFLWFNTYPAQLFMGDVGSLALGGVLGTIAVLVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FVVETLSVI+QVG +K+   KR+F MAPIHHH+E KGW E +++IRFWIIS +  ++
Sbjct: 294 GGVFVVETLSVILQVGSYKLRNGKRIFRMAPIHHHYELKGWPEPRVIIRFWIISLMLVLL 353

Query: 359 GLLTLKMR 366
           GL+TLK+R
Sbjct: 354 GLITLKLR 361


>gi|322513880|ref|ZP_08066959.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           ureae ATCC 25976]
 gi|322120279|gb|EFX92226.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           ureae ATCC 25976]
          Length = 360

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 245/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFR+  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL+ +  S+LLWAD  + +V  +L +  S+G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFSYGAVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF+D +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSLIALIAVFGIYAVGKDT-----AATQLVVPFFKDFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVI+ T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + FV
Sbjct: 174 IFFIILSYFVIIGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QV  +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVVEALSVILQVSSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLVG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|94264632|ref|ZP_01288415.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [delta
           proteobacterium MLMS-1]
 gi|93454927|gb|EAT05168.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [delta
           proteobacterium MLMS-1]
          Length = 359

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 168/368 (45%), Positives = 233/368 (63%), Gaps = 11/368 (2%)

Query: 1   MFIQ-LADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L    E Y I +V +Y+TFR   A  +A ++V   GP  I  L+S Q   GQ VR
Sbjct: 1   MLYHFLYSLHEQYTIFNVFRYITFRGIGAALTAFMLVMVLGPPFIAWLKSRQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K   PTMGG++IL  +  ++LLW D  +  V +IL + L FG +G YDDY 
Sbjct: 59  DDGPESHYSKRGVPTMGGLLILAAVTLTTLLWVDLYNPFVWLILGVLLWFGAIGAYDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   D+ GL    ++L++ + A  AV AL    +           + FPFF++I  D+G
Sbjct: 119 KICKQDSRGLGVAGKLLLQALGAGGAVLALYLLPD-------FSGQLSFPFFKEIRPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            ++  FA  V+V  +NAVNLTDGLDGL   PV+I    +   +Y+AG+ +L+ YLQ+  V
Sbjct: 172 AWYCLFALLVVVGASNAVNLTDGLDGLVTGPVVITGTVYLLFSYLAGHAVLASYLQIPHV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+ V  +AL+GA +GFLWFN  PA IFMGD GSLA+GA +G +A+ TK E LL I+
Sbjct: 232 PGAGEVAVFAAALVGASLGFLWFNTYPAQIFMGDVGSLAIGAALGMVAIITKQEFLLAIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+E LSV++QVG++K++  +R+FLMAP HHHFEKKGW E ++V+RFWIIS +  ++
Sbjct: 292 GGIFVMEALSVMLQVGFYKLSGGQRIFLMAPFHHHFEKKGWQEPKVVVRFWIISIVLGLV 351

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 352 ALATLKLR 359


>gi|94266851|ref|ZP_01290511.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [delta
           proteobacterium MLMS-1]
 gi|94269091|ref|ZP_01291366.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [delta
           proteobacterium MLMS-1]
 gi|93451351|gb|EAT02219.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [delta
           proteobacterium MLMS-1]
 gi|93452481|gb|EAT03080.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [delta
           proteobacterium MLMS-1]
          Length = 359

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 168/368 (45%), Positives = 233/368 (63%), Gaps = 11/368 (2%)

Query: 1   MFIQ-LADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L    E Y I +V +Y+TFR   A  +A ++V   GP  I  L+S Q   GQ VR
Sbjct: 1   MLYHFLYSLHEQYTIFNVFRYITFRGIGAALTAFMLVMVLGPPFIAWLKSRQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K   PTMGG++IL  +  ++LLW D  +  V +IL + L FG +G YDDY 
Sbjct: 59  EDGPESHYSKRGVPTMGGLLILAAVTLTTLLWVDLYNPFVWLILGVLLWFGAIGAYDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   D+ GL    ++L++ + A  AV AL    +           + FPFF++I  D+G
Sbjct: 119 KICKQDSRGLGVAGKLLLQALGAGGAVLALYLLPD-------FSGQLSFPFFKEIRPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            ++  FA  V+V  +NAVNLTDGLDGL   PV+I    +   +Y+AG+ +L+ YLQ+  V
Sbjct: 172 AWYCLFALLVVVGASNAVNLTDGLDGLVTGPVVITGTVYLLFSYLAGHAVLASYLQIPHV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+ V  +AL+GA +GFLWFN  PA IFMGD GSLA+GA +G +A+ TK E LL I+
Sbjct: 232 PGAGEVAVFAAALVGASLGFLWFNTYPAQIFMGDVGSLAIGAALGMVAIITKQEFLLAIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+E LSV++QVG++K++  +R+FLMAP HHHFEKKGW E ++V+RFWIIS +  ++
Sbjct: 292 GGIFVMEALSVMLQVGFYKLSGGQRIFLMAPFHHHFEKKGWQEPKVVVRFWIISIVLGLV 351

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 352 ALATLKLR 359


>gi|49086160|gb|AAT51332.1| PA4415 [synthetic construct]
          Length = 361

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ +  Y    V +Y+T R   +  +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFYKGFGVFQYLTLRGILSVLTALSLSLWLGPWMIRTLQIRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++L++TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKKGTPTMGGALILTAIAISTLLWADLSNRYVWVVLVVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  I A   L   + +       +T+++ P  + + + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGIGAAVFLYMTAET-----PIETTLIVPMLKSVEIQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF+    FVIV ++NAVNLTDGLDGLAI+P ++ + A     Y++GN+  + YL +  V
Sbjct: 174 IFFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVAGALGIFCYLSGNVKFAEYLLIPNV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V  +AL+GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCAALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVMIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|104783456|ref|YP_609954.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           entomophila L48]
 gi|122401964|sp|Q1I5B5|MRAY_PSEE4 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|95112443|emb|CAK17170.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Pseudomonas
           entomophila L48]
          Length = 360

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 161/367 (43%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y+T R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLTLRGILGVLTALSLALWLGPWMIRTLQIRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD ++ +V ++L++TL+FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSAIAISTLLWADLTNRYVWVVLIVTLAFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + ++      +T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLAAAIFLYKTAPTS-----VETTLIIPMLKDLAIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 AGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + E++L I+
Sbjct: 234 PGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEVVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|148265988|ref|YP_001232694.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           uraniireducens Rf4]
 gi|146399488|gb|ABQ28121.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           uraniireducens Rf4]
          Length = 358

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 235/367 (64%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y + +V KY+TFR+  A  +A+++ F  GP +I  L SLQ    Q +R
Sbjct: 1   MLYHLLFPLASSYKLFNVFKYLTFRTIYAMITALVVAFILGPWLIRRLESLQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  +I  +LLWAD +++++ + L +   +GL+GF DDY 
Sbjct: 59  TDGPESHLKKQGTPTMGGVLILAAIIIPTLLWADLTNVYIWLTLFIIAGYGLIGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++       L   +          T + FPFF+ +  D+G
Sbjct: 119 KVVEKNPKGLSPRQKMFWQVLLGSGVGIFLFNLAG-------FSTDLYFPFFKRLHPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L +IPF   VIV  +NAVNLTDGLDGLAI PV I +  +    Y+AGN  LS YLQ+ +V
Sbjct: 172 LLYIPFVTLVIVGASNAVNLTDGLDGLAIGPVAINAATYLLFTYIAGNAKLSGYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAG+GFLW+N  PA +FMGD GSL+LG  +G +AV TK EILL+I+
Sbjct: 232 PGSGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGGLGTLAVITKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGVFVVEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|182677682|ref|YP_001831828.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Beijerinckia
           indica subsp. indica ATCC 9039]
 gi|229621238|sp|B2IGF7|MRAY_BEII9 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|182633565|gb|ACB94339.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Beijerinckia
           indica subsp. indica ATCC 9039]
          Length = 360

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 197/367 (53%), Positives = 263/367 (71%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA+F+ Y+   ++ +Y+TFR+  A  +A+  VF FGP +I  LR +++ +GQP+R 
Sbjct: 1   MLTWLAEFAVYFTPLNLFRYITFRTGGAIATALFFVFFFGPNIIKSLR-IKQGKGQPIRS 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++IL GL  S+LLWA+ S+ +V ++L + L +G +GFYDDY+
Sbjct: 60  DGPQSHLLTKKGTPTMGGLMILSGLFVSTLLWANLSNHYVWVVLWVMLGYGAIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G SG+ R+  E  +A++A  A++       LG    TS+ FP     ++D+G
Sbjct: 120 KVTKQTHNGFSGRGRLACEAGVALVACIAMM------KLGTPHMTSLAFPAVNGYVVDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LFF+ F  FVIVA+ NAVNLTDGLDGLAIVPVMIA+  F  IAY+ GN + S YL++NFV
Sbjct: 174 LFFLIFGPFVIVASGNAVNLTDGLDGLAIVPVMIAAGTFGIIAYLVGNAIYSDYLRINFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL VV  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KHE++L I+
Sbjct: 234 PGAGELAVVSGAVIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGTIAVAIKHEMVLAIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLF +ETLSVI+QV  FK+T KRVF MAPIHHHFE+ GW+E Q+V+RFWII+F+ A++G
Sbjct: 294 GGLFALETLSVIVQVVSFKLTGKRVFKMAPIHHHFEQLGWSEPQVVVRFWIIAFVLALVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LSTLKLR 360


>gi|29653483|ref|NP_819175.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii RSA 493]
 gi|153207150|ref|ZP_01945929.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154707444|ref|YP_001425291.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii Dugway 5J108-111]
 gi|165918392|ref|ZP_02218478.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii RSA 334]
 gi|212213345|ref|YP_002304281.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii CbuG_Q212]
 gi|212219393|ref|YP_002306180.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii CbuK_Q154]
 gi|61214327|sp|Q83F26|MRAY_COXBU RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189082225|sp|A9KES2|MRAY_COXBN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700980|sp|B6J5K9|MRAY_COXB1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226700981|sp|B6J2Q9|MRAY_COXB2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|29540745|gb|AAO89689.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii RSA 493]
 gi|120576811|gb|EAX33435.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii 'MSU Goat Q177']
 gi|154356730|gb|ABS78192.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii Dugway 5J108-111]
 gi|165917898|gb|EDR36502.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii RSA 334]
 gi|212011755|gb|ACJ19136.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii CbuG_Q212]
 gi|212013655|gb|ACJ21035.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii CbuK_Q154]
          Length = 361

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 168/368 (45%), Positives = 249/368 (67%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +F  +++    V  Y+TFRS  +  +A+++V +  P++I  L SLQ   GQ VR
Sbjct: 1   MLLWLTNFLSQHFHAFRVFNYLTFRSIVSALTALILVLSLSPRLIKYLVSLQ--VGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++I++ ++ S LLW D S+  + +ILL+T++F  +G+ DDY 
Sbjct: 59  NDGPQTHLKKSGTPTMGGVLIIVAIVISVLLWGDLSNRFIWVILLVTVAFSAIGWMDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   ++ GLS + + L++ II  LA   L F + +       +T++V PF ++++ ++G
Sbjct: 119 KIIRKNSKGLSARSKYLLQSIIGALAAVYLYFSATTG-----AETALVIPFLKNVLPNLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV ++NAVNLTDGLDGLA++P ++   A    AY  GN   + YL + ++
Sbjct: 174 LFYIVLAYFVIVGSSNAVNLTDGLDGLALMPTVMIGAALGVFAYTTGNHFFAQYLAIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+VV  SAL+GAG+GFLW+N  PA +FMGD GSL LGA +G  AV  + E++  ++
Sbjct: 234 PGAGEVVVFCSALVGAGLGFLWYNTYPAQVFMGDVGSLGLGAALGVTAVVVRQELVYFLM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV ETLSVI+QVGYFK++  KR+F MAP+HHHFE KGW E ++++RFWII+FI  + 
Sbjct: 294 GGIFVAETLSVILQVGYFKLSGGKRIFRMAPLHHHFELKGWPEPKVIVRFWIITFILVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|15599611|ref|NP_253105.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa PAO1]
 gi|107100000|ref|ZP_01363918.1| hypothetical protein PaerPA_01001021 [Pseudomonas aeruginosa PACS2]
 gi|116052449|ref|YP_792761.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|152985990|ref|YP_001350323.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa PA7]
 gi|218893506|ref|YP_002442375.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa LESB58]
 gi|254238922|ref|ZP_04932245.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa C3719]
 gi|254244774|ref|ZP_04938096.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa 2192]
 gi|296391124|ref|ZP_06880599.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa PAb1]
 gi|313106945|ref|ZP_07793148.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Pseudomonas
           aeruginosa 39016]
 gi|22095905|sp|Q9HVZ8|MRAY_PSEAE RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|122257545|sp|Q02H25|MRAY_PSEAB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167011846|sp|A6VB88|MRAY_PSEA7 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709945|sp|B7UZJ3|MRAY_PSEA8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|9950647|gb|AAG07803.1|AE004856_14 phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa PAO1]
 gi|115587670|gb|ABJ13685.1| UDP-N-acetylmuramyl pentapeptide phosphotransferas [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126170853|gb|EAZ56364.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa C3719]
 gi|126198152|gb|EAZ62215.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa 2192]
 gi|150961148|gb|ABR83173.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa PA7]
 gi|218773734|emb|CAW29548.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           aeruginosa LESB58]
 gi|310879650|gb|EFQ38244.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase [Pseudomonas
           aeruginosa 39016]
          Length = 360

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ +  Y    V +Y+T R   +  +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFYKGFGVFQYLTLRGILSVLTALSLSLWLGPWMIRTLQIRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++L++TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKKGTPTMGGALILTAIAISTLLWADLSNRYVWVVLVVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  I A   L   + +       +T+++ P  + + + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGIGAAVFLYMTAET-----PIETTLIVPMLKSVEIQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF+    FVIV ++NAVNLTDGLDGLAI+P ++ + A     Y++GN+  + YL +  V
Sbjct: 174 IFFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVAGALGIFCYLSGNVKFAEYLLIPNV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V  +AL+GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCAALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVMIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|190149284|ref|YP_001967809.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|229621232|sp|B3GZK5|MRAY_ACTP7 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189914415|gb|ACE60667.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
          Length = 360

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFR+  A  +AM I    GP+VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRAIMALLTAMGIGLWIGPEVIRRLQLLK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL+ +  S+LLWAD  + +V  +L +   +G VGF DDY 
Sbjct: 59  NDGPESHFKKRGTPTMGGIMILIAIGVSTLLWADLRNSYVWFVLFVLFGYGAVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA++AV  +      T       T +V PFF++ +  +G
Sbjct: 119 KIKRKNTDGLIARWKYFWLSVIALIAVFGIYAVGKDT-----AATQLVVPFFKEFMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI  + FVIV T+NAVNLTDGLDGLAIVP ++ + AF+ IA+  GN   + YL + FV
Sbjct: 174 IFFIILSYFVIVGTSNAVNLTDGLDGLAIVPTIMVASAFALIAWATGNFNFAQYLHIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELV++ +A++GAG+GFLW+N  PA +FMGD GSL+LG  +G IAV  + E+LL+I+
Sbjct: 234 PNAGELVILCTAIVGAGLGFLWYNTYPAQVFMGDVGSLSLGGALGTIAVLVRQELLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++ FWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVCFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|295688558|ref|YP_003592251.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Caulobacter
           segnis ATCC 21756]
 gi|295430461|gb|ADG09633.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Caulobacter
           segnis ATCC 21756]
          Length = 370

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 187/371 (50%), Positives = 255/371 (68%), Gaps = 6/371 (1%)

Query: 1   MFIQLADFS----EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQ 56
           M   L ++     E+  + ++LKY+TFRS  A  +A ++  A G + I  +++ Q   GQ
Sbjct: 1   MLYFLYEWLARSQEHVPMLNLLKYLTFRSGMAMLTAYIVAVAMGSRFIRWMKTKQGK-GQ 59

Query: 57  PVRVPNLPIHAR-KIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFY 115
           P+R   +  H   K  TPTMGG +IL GL   +LLWAD  ++HV ++LL+T S+G++GF 
Sbjct: 60  PIRTDGIARHVTEKAGTPTMGGFMILAGLFVGALLWADLRNVHVWVVLLVTGSYGVLGFM 119

Query: 116 DDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDII 175
           DDY K+T     GLS   +++ +FI+AI A   L+ ++  + +    +TS+VFP F+ ++
Sbjct: 120 DDYAKVTKQTTAGLSSVQKLIAQFIVAIAATVILILFAPKSPMTPGMETSVVFPIFKALV 179

Query: 176 LDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQ 235
           +++G F++ FAA  I   +NAVNLTDGLDGLAIVPVM A+  F  IAY+ GN   + YL 
Sbjct: 180 INLGWFYVAFAAITIAGFSNAVNLTDGLDGLAIVPVMFAASTFGLIAYLVGNYKFADYLN 239

Query: 236 VNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEIL 295
           ++F PGVGEL V+  A+IG G+GFLW+N  PA IFMGDTGSLALG  +G IAV  KHE++
Sbjct: 240 LHFAPGVGELAVLCGAIIGGGMGFLWYNAPPAKIFMGDTGSLALGGALGAIAVCAKHELV 299

Query: 296 LIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIF 355
           L I+GGLFV E LSV++QV YFK T KRVFLMAPIHHHFEK GW E+ +VIRFWI+S I 
Sbjct: 300 LGIVGGLFVAEALSVMIQVAYFKKTGKRVFLMAPIHHHFEKLGWAESTVVIRFWIVSMIL 359

Query: 356 AVIGLLTLKMR 366
           A +GL TLK+R
Sbjct: 360 AFVGLATLKLR 370


>gi|95930734|ref|ZP_01313467.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfuromonas
           acetoxidans DSM 684]
 gi|95133214|gb|EAT14880.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfuromonas
           acetoxidans DSM 684]
          Length = 358

 Score =  279 bits (713), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 238/367 (64%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L       +   +V +++TFR+  A  +A+++ F  GP VI+ L SLQ   GQ +R
Sbjct: 1   MLYHLLYPLHTEFSALYVFRFITFRTIYATITALVLSFLLGPWVIERLSSLQ--IGQTIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG +IL+ ++  +LLWAD  + +V + LL+T+ +G +GF DDY 
Sbjct: 59  KVGPESHFKKEGTPTMGGTLILIAIVLPTLLWADLRNGYVWVALLVTVGYGAIGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+    + GLS + ++L + +IA +A   L             +  +  PFF+    ++G
Sbjct: 119 KVKLKSSDGLSARHKMLGQLLIAGIAGYLLF-------TVTPFEPVLTVPFFKGFQPNIG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+IP    V+V + NAVNLTDGLDGLAI P++ AS A+   AY+AGN  LS YLQ+  V
Sbjct: 172 LFYIPLILLVVVGSGNAVNLTDGLDGLAIGPMISASSAYLLFAYLAGNAKLSSYLQIGGV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL ++  A++GAG+GFLWFN  PA +FMGD GSL+LG  +G IA+  K E++L+I+
Sbjct: 232 PGAGELSIMCGAMVGAGLGFLWFNTYPAQVFMGDVGSLSLGGALGIIAIIVKQELVLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QV  F+   +RVF MAPIHHHFE KGW E +I++RFWIIS + A++ 
Sbjct: 292 GGIFVVEALSVIVQVMSFRFLGRRVFRMAPIHHHFELKGWPEPKIIVRFWIISIVLALVA 351

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 352 LSTLKLR 358


>gi|146281465|ref|YP_001171618.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           stutzeri A1501]
 gi|166221343|sp|A4VIH5|MRAY_PSEU5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|145569670|gb|ABP78776.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           stutzeri A1501]
 gi|327479640|gb|AEA82950.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           stutzeri DSM 4166]
          Length = 360

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 156/367 (42%), Positives = 235/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y++ R      +A+++    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLSLRGILGVLTALVLSLWMGPWLIRTLQLRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD ++ +V ++L +TL FG +G+ DDY 
Sbjct: 59  TDGPQSHLSKSGTPTMGGALILSAIGISTLLWADLANRYVWVVLAVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + +       +T+++ P  ++I + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLGAAIFLYMTAQT-----PVETTLILPLLKNIEIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++         Y++GN+  + YL + ++
Sbjct: 174 IGFVILTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGGLGIFCYLSGNVNFAEYLLIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + E++L I+
Sbjct: 234 PGSGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEVVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ I  ++G
Sbjct: 294 GGVFVMETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|325293468|ref|YP_004279332.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Agrobacterium
           sp. H13-3]
 gi|325061321|gb|ADY65012.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Agrobacterium
           sp. H13-3]
          Length = 366

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 205/354 (57%), Positives = 269/354 (75%), Gaps = 2/354 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + S+   + ++ +Y+TFR+ AA F++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLIWLVELSDKIQVFNLFRYITFRAGAAMFTSALIVFLFGPAIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++G SLLW D S+++V  +L++TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGILGGSLLWGDLSNVYVVAVLMVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  +  S   G    +SI FPFF+++++++G
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAVFFMMKVALASAPHGGTLGSSIAFPFFKELVINLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F AFVIV   NAVNLTDGLDGLAIVPVMIA+  F  IAY+AGN + ++YLQ+NFV
Sbjct: 180 YFFVLFGAFVIVGAGNAVNLTDGLDGLAIVPVMIAAATFGVIAYLAGNAVFANYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V++ A++GAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+TKHEI+++I+
Sbjct: 240 PGTGELAVIVGAVVGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGSIAVATKHEIVMVIV 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISF 353
           GGLFV+ETLSVI+QV +FK T +RVFLMAPIHHHFEKKGWTE+Q+VIRFWIIS 
Sbjct: 300 GGLFVMETLSVIIQVFWFKRTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIISV 353


>gi|226943450|ref|YP_002798523.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Azotobacter
           vinelandii DJ]
 gi|259495906|sp|C1DQ96|MRAY_AZOVD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226718377|gb|ACO77548.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Azotobacter
           vinelandii DJ]
          Length = 360

 Score =  278 bits (712), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 160/367 (43%), Positives = 232/367 (63%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V++Y+T R      +A+++    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHTGFAVVQYLTLRGILGVLTALILALCLGPWMIRTLQIRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V  +L +TL FG +G+ DDY 
Sbjct: 59  DDGPQSHLSKKGTPTMGGALILSAIAISTLLWADLSNRYVWTVLAVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + +       +T+++ P  + I + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLGAALFLYMTAQT-----PAETTLILPLIKTIEIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL +  V
Sbjct: 174 AAFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPSV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + E++L I+
Sbjct: 234 AGAGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEVVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVMETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|294142807|ref|YP_003558785.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Shewanella
           violacea DSS12]
 gi|42560204|sp|Q9F1N3|MRAY_SHEVD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|11761332|dbj|BAB19199.1| MraY [Shewanella violacea]
 gi|293329276|dbj|BAJ04007.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Shewanella
           violacea DSS12]
          Length = 360

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 175/367 (47%), Positives = 253/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +A++    +GPK+I  L++LQ   GQ VR
Sbjct: 1   MLVYLAEYLTQFYSGFNVFSYVTFRAILGLMTALVFCLWWGPKMIRRLQTLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL G+  S LLW D  S +V ++L +  SFGL+GF DDY 
Sbjct: 59  SDGPESHFSKSGTPTMGGILILAGIFISVLLWGDLGSRYVWVVLFVLASFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + +++ + AI+    L   +++       +T +V PFF+DI+  MG
Sbjct: 119 KVVRKDTKGLIARWKYILQSLAAIIIAFYLYASADTV-----GETQLVVPFFKDIMPQMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI  A F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  ++YL + ++
Sbjct: 174 AFFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFANYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVMLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|157963625|ref|YP_001503659.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           pealeana ATCC 700345]
 gi|189028769|sp|A8H987|MRAY_SHEPA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|157848625|gb|ABV89124.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Shewanella
           pealeana ATCC 700345]
          Length = 360

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 173/367 (47%), Positives = 249/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y   +V  YVTFR+     +AM+    +GPK+I  L+ +Q   GQ VR
Sbjct: 1   MLVYLAEYLTQFYTGFNVFSYVTFRAILGLMTAMVFSLWWGPKMIARLQVMQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL G+  S LLW D  S +V ++L +  +FGL+GF DDY 
Sbjct: 59  NDGPESHFSKRGTPTMGGILILAGVFISVLLWGDLGSRYVWVVLFVLATFGLIGFIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + + L++ + A++    L   + S       +T +V PFF+DI+  +G
Sbjct: 119 KVVRKDTKGLIARWKYLLQSVAALVIAVYLYASAQS-----PGETQLVVPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FFI    F IV ++NAVNLTDGLDGLAI+P ++ + AF+ IAY++G++  + YL + ++
Sbjct: 174 GFFIVLVYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHVQFASYLHLPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+V +A++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PGAGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGAALGAIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+  +R+F MAPIHHH+E KGW E ++++RFWIIS    ++G
Sbjct: 294 GGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLFLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|152996630|ref|YP_001341465.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinomonas sp.
           MWYL1]
 gi|189082233|sp|A6VYK1|MRAY_MARMS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|150837554|gb|ABR71530.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinomonas sp.
           MWYL1]
          Length = 360

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L A  S+Y+    V  Y++ R+     +A+ I    G KVI  L+ LQ   GQ VR
Sbjct: 1   MLLLLTAYLSKYHTFFTVFNYLSLRAILGVLTALAISLLVGNKVIVLLQRLQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +I+  +  S+LLW D  + +V ++LL+ L+FG+VG+ DDY 
Sbjct: 59  SDGPQTHLSKAGTPTMGGALIIFSISVSTLLWGDLRNQYVWVVLLVMLAFGVVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL G+ +   + +  + A   L + +++       +T+++ P F+D+ + +G
Sbjct: 119 KVVEKNPRGLPGRWKYFWQSVFGLAAAFYLYYTAST-----PAETALIVPLFKDVAIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFI    FVIV T+NAVNLTDGLDGLAI+P ++   A    AY+ GNI  + YL + +V
Sbjct: 174 MFFIVLTYFVIVGTSNAVNLTDGLDGLAILPTVLVGGALGVFAYLTGNIRFADYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL+V  +AL GAG+GFLWFN  PA IFMGD GSLALGA +G IAV  + E++L I+
Sbjct: 234 HGSGELLVFCAALAGAGLGFLWFNTYPAQIFMGDVGSLALGAALGTIAVIVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  +K+TK+R+F MAPIHHHFE KGW E ++++RFWII+    ++G
Sbjct: 294 GGVFVMETVSVILQVASYKLTKRRIFRMAPIHHHFELKGWAEPKVIVRFWIITVCLVLVG 353

Query: 360 LLTLKMR 366
             TLK+R
Sbjct: 354 FATLKVR 360


>gi|77166315|ref|YP_344840.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           oceani ATCC 19707]
 gi|254436068|ref|ZP_05049575.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           oceani AFC27]
 gi|97176785|sp|Q3J786|MRAY_NITOC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|76884629|gb|ABA59310.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           oceani ATCC 19707]
 gi|207089179|gb|EDZ66451.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           oceani AFC27]
          Length = 358

 Score =  278 bits (711), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 160/367 (43%), Positives = 243/367 (66%), Gaps = 10/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + + D+   +    HV +Y+T R+     +A++I F  GP +I  L+    F GQPVR
Sbjct: 1   MLLYVTDYLARFDSGFHVFQYLTLRAILGVLTALVISFVVGPPMIRRLK----FVGQPVR 56

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ ++ ++L++TL FG VGF DDY 
Sbjct: 57  SNGPTTHLCKAGTPTMGGALILVAIAAATLLWADLSNRYIWVVLVVTLLFGGVGFVDDYK 116

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D+ GL+ + +   + +IA+     L F ++        +T ++ PFF+D+ +++G
Sbjct: 117 KLLAKDSRGLTSRYKYFWQSVIALGVALFLYFTASVA-----AETELIVPFFKDVAVNLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +++    FV+V ++NAVNLTDGLDGLA++P ++   A    AY AG+   + YL + ++
Sbjct: 172 GYYVLLTYFVVVGSSNAVNLTDGLDGLAVLPTVLVGGALGIFAYAAGHSGFAQYLGIPYI 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GELVV   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L I+
Sbjct: 232 PEAGELVVFCGALVGAGLGFLWFNAYPAQVFMGDIGALALGAALGILAVLVRQELVLFIM 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVET+SV++QV  +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 292 GGVFVVETVSVMLQVASYKLTGRRIFRMAPLHHHFEIKGWPEPRVIVRFWIITVILVLIG 351

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 352 LATLKIR 358


>gi|170720127|ref|YP_001747815.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida W619]
 gi|229621798|sp|B1J3K9|MRAY_PSEPW RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|169758130|gb|ACA71446.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           putida W619]
          Length = 360

 Score =  278 bits (711), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYYI-ITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + +     V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFHKGFAVFQYLSLRGILGVLTALSLALWLGPWMIRTLQIRQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V  +L++TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSAIGISTLLWADLSNRYVWTVLIVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + +T      +T+++ PF +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLTAAIFLYQTAPTT-----VETTLIVPFLKDVTIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGSGELIVFCGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGIFVMETLSVVIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|296116434|ref|ZP_06835048.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295977027|gb|EFG83791.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 363

 Score =  278 bits (711), Expect = 9e-73,   Method: Composition-based stats.
 Identities = 174/369 (47%), Positives = 250/369 (67%), Gaps = 9/369 (2%)

Query: 1   MFIQLAD--FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPV 58
           M   L     + +  + ++  Y+TFR+ AA  +A+++    G  +I  LR +Q   GQP+
Sbjct: 1   MLYDLFQRHAAGHVSVLNLFHYITFRAGAACLTALVLSLMLGNPLIARLRRIQRG-GQPI 59

Query: 59  RVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDD 117
           R      H   K  TPTMGG++IL+ L+GS+LLWAD ++  V  ++ +TL+FG VGF DD
Sbjct: 60  RTLGPERHLVEKAGTPTMGGVLILVSLLGSTLLWADLTNGFVWAVMTITLAFGAVGFADD 119

Query: 118 YIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD 177
           Y+K++  +  G+S ++R+  EF ++++    +       L+  +    + FPF +D++L 
Sbjct: 120 YLKLSRRNTDGVSMRMRLGCEFAVSLIGGIWI-----EGLMPPDLANHLAFPFVKDLLLP 174

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +G  F  FA   I    NAVN TDGLDGLAIVPV IA++ F+ I+Y+ GN + + YLQ++
Sbjct: 175 LGYAFPVFAMITITGFGNAVNFTDGLDGLAIVPVTIAALVFALISYLVGNHIFADYLQLH 234

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
            VPG GEL +  SAL+GAG+GFLWFN  PA +FMGDTGSLALG  +G +AV+ KHE++L 
Sbjct: 235 AVPGTGELGIFCSALVGAGLGFLWFNAPPAAVFMGDTGSLALGGALGAVAVAVKHELVLC 294

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           I+GGLFV+ET SVI+QV ++K T +RVFLMAP+HHHFEKKGW E++IVIRFWI+S +  +
Sbjct: 295 IVGGLFVIETFSVIIQVFWYKRTGRRVFLMAPLHHHFEKKGWPESKIVIRFWIVSIVLGL 354

Query: 358 IGLLTLKMR 366
            GL TLK+R
Sbjct: 355 CGLATLKLR 363


>gi|197105788|ref|YP_002131165.1| UDP-N-acetylmuramyl pentapeptide
           phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
           transferase [Phenylobacterium zucineum HLK1]
 gi|229621794|sp|B4RFS3|MRAY_PHEZH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|196479208|gb|ACG78736.1| UDP-N-acetylmuramyl pentapeptide
           phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
           transferase [Phenylobacterium zucineum HLK1]
          Length = 369

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 191/370 (51%), Positives = 261/370 (70%), Gaps = 5/370 (1%)

Query: 1   MFIQLAD---FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQP 57
           MF  L +    S Y  I ++LKY TFR+  A F+A  +V A G + I  +++ Q   GQP
Sbjct: 1   MFYWLYEQFAASGYVPILNLLKYQTFRTGLAIFTAQFVVVAMGSRFIRWMQAKQGK-GQP 59

Query: 58  VRVPNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           +R   +  H   K  TPTMGG++IL GL+  +LLW+D S+ +V  ++L+T  +GL+GF D
Sbjct: 60  IRAEGIERHVIEKAGTPTMGGVMILAGLLVGTLLWSDLSNPYVWAVVLVTAGYGLLGFTD 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+T     G+SGK+R+ +E  IA+ AV  ++ ++       E  TS+ FP F+   +
Sbjct: 120 DYAKVTRQTTAGVSGKIRLALEAFIAMAAVLIIIVFAQKPPENPELLTSVTFPIFKQYFV 179

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
           D+   ++ F AF+IV  ANAVN TDGLDGLA VPVMIA+ A+  IAY+ GN + S+YLQ+
Sbjct: 180 DLSWGYLLFGAFIIVGAANAVNFTDGLDGLATVPVMIAAAAYGLIAYLVGNYVFSNYLQL 239

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           +FVPGVGE+ V   ALIG+G+GFLW+N  PA IFMGDTGSLALG  +G +AV+T+HEI+L
Sbjct: 240 HFVPGVGEIAVFCGALIGSGLGFLWYNAPPAKIFMGDTGSLALGGAVGAVAVATRHEIVL 299

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            IIGGLFV ETLSVI+QV +FK T +R+FLMAPIHHHFEK GW+E+ +VIRFWI++ + A
Sbjct: 300 AIIGGLFVAETLSVIIQVAWFKRTGRRIFLMAPIHHHFEKLGWSESTVVIRFWIVAIMLA 359

Query: 357 VIGLLTLKMR 366
           ++GL TLK+R
Sbjct: 360 LVGLATLKLR 369


>gi|307294499|ref|ZP_07574341.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingobium
           chlorophenolicum L-1]
 gi|306878973|gb|EFN10191.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingobium
           chlorophenolicum L-1]
          Length = 357

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 182/366 (49%), Positives = 243/366 (66%), Gaps = 9/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA   ++  + ++++Y++FR+ AA  +A++I    GP+ I  LR  Q   GQP+R 
Sbjct: 1   MLYWLAQTMDFAGVFNLIRYLSFRAGAAIATALVIGLVIGPRFIGWLRVRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  ++ S LLW D SS++V   L +TL FG +GF DDY K
Sbjct: 60  DGPQTHLAKRGTPTMGGLMILTSMVSSVLLWMDLSSIYVWACLFVTLGFGAIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     GLSGK+R+  EF+IA  A   ++             T++  PF+    +++G 
Sbjct: 120 VTKASHKGLSGKMRLAFEFLIAGFAAWLIV--------SQHGNTALYVPFYNGPAIELGP 171

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAAFVIVA  NAVNLTDGLDGLA +PV+IA +AF+ I Y+ G    ++YL +  VP
Sbjct: 172 FYFLFAAFVIVAFGNAVNLTDGLDGLATMPVIIACLAFTAIVYLVGRADFANYLGIPHVP 231

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G G L ++  A+IGAG+ FLWFN  PA +FMGDTGSLALG  IG IAV+  HEI+L +IG
Sbjct: 232 GAGNLTILCGAIIGAGLAFLWFNAPPAAVFMGDTGSLALGGTIGVIAVTAHHEIVLGVIG 291

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SVI+QV ++K T KRVF MAPIHHHFE+ GW E  +VIRFWIISF+ A+ GL
Sbjct: 292 GLFVVEAMSVIIQVFFYKRTGKRVFKMAPIHHHFEQLGWAEPTVVIRFWIISFVLALAGL 351

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 352 ATLKLR 357


>gi|85714970|ref|ZP_01045955.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrobacter sp.
           Nb-311A]
 gi|85698167|gb|EAQ36039.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrobacter sp.
           Nb-311A]
          Length = 368

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 200/374 (53%), Positives = 264/374 (70%), Gaps = 14/374 (3%)

Query: 1   MFIQLADFSEYYIIT-------HVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           MF  L D S             +V +Y+TFR+  A  +  L VF FGP +ID LR  Q  
Sbjct: 1   MFYWLIDLSNTVPGLGIFKPLLNVFRYITFRTGGAVVTGALFVFLFGPWIIDNLRLRQGK 60

Query: 54  RGQPVRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLV 112
            GQP+RV     H   K  TPTMGG++IL GL+ S++LWA+  + +V I+L +TL FG +
Sbjct: 61  -GQPIRVDGPQSHLVSKKGTPTMGGLMILSGLVVSTVLWANPLNPYVWIVLAVTLGFGFI 119

Query: 113 GFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFR 172
           GFYDDY+K+T     G +G+ R+L+E +I++ A      Y+ + L      T++V PFF+
Sbjct: 120 GFYDDYLKVTKQTHAGFAGRTRLLLELLISLAAC-----YALTRLGREPFSTALVIPFFK 174

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
           D++LD+G FF+ F +F+IV   NAVNLTDGLDGLAIVPVMIA+ +F+ IAY+AGN + + 
Sbjct: 175 DVVLDLGWFFLAFGSFIIVGAGNAVNLTDGLDGLAIVPVMIAAASFAMIAYLAGNAVFAD 234

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YLQ+N+V G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KH
Sbjct: 235 YLQINYVAGAGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKH 294

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI+L +IGGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFE+ GWTE QIVIRFWIIS
Sbjct: 295 EIVLAVIGGLFVLEAVSVIVQVASFKLTGKRIFKMAPIHHHFEQLGWTEPQIVIRFWIIS 354

Query: 353 FIFAVIGLLTLKMR 366
            + A++GL TLK+R
Sbjct: 355 VMLALLGLSTLKLR 368


>gi|307824828|ref|ZP_07655051.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacter
           tundripaludum SV96]
 gi|307734186|gb|EFO05040.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacter
           tundripaludum SV96]
          Length = 360

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 167/367 (45%), Positives = 246/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M +  AD+   +     V  Y+TFR+     ++++I F  GP +I  L   +   GQ +R
Sbjct: 1   MLLYFADYLMTFDGGFRVFHYLTFRAILGALTSLVISFIIGPVMIRKLSRNK--IGQSIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD  + ++ +ILL+T+ +G++GF DDY 
Sbjct: 59  ELGPQSHYEKAGTPTMGGALILVAIAISTLLWADLGNRYIWVILLVTMGYGIIGFVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+  G++ GLS K +   + +I ++A   L   +      +  +T ++ PFF+D++L+MG
Sbjct: 119 KVIKGNSDGLSAKAKYSWQSVIGLMAAVFLYKTA-----ILPAETQLIVPFFKDVMLNMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +I    FVIV T+NAVNLTDGLDGLAI+P ++ +      AY++G++  S YL + ++
Sbjct: 174 WIYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAAGLGIFAYLSGHVTFSQYLAIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL+V  +AL+GAG+GFLWFN  PA++FMGD G+LALGA +G +AV  + EI+L+I+
Sbjct: 234 PNAGELIVFCAALVGAGLGFLWFNAYPAMVFMGDVGALALGAALGVLAVLVRQEIVLMIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FKMT KRVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETVSVIIQVASFKMTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|307544548|ref|YP_003897027.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Halomonas
           elongata DSM 2581]
 gi|307216572|emb|CBV41842.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Halomonas
           elongata DSM 2581]
          Length = 360

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 160/367 (43%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LADF   +    +V  Y+T R      +A+++    GP VI  L   Q   GQ VR
Sbjct: 1   MLLFLADFLAQFQSAFNVFNYLTLRMILGTLTALILCLWLGPVVIRRLVERQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +ILM +  S+LLW D ++ +V I+L +TL FG +G+ DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGAMILMAIAVSTLLWGDLANHYVWIVLAVTLGFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  I + A   L   + S       +TS++ P F+D +L +G
Sbjct: 119 KVVEKNPRGLPARWKYFWQSAIGLAAAVILYVTAAS-----PVETSLIVPLFKDFVLPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F++  +  VIV ++NAVNLTDGLDGLAI+P ++ ++  +  AY +GN + + YLQ+  +
Sbjct: 174 VFYVLLSYLVIVGSSNAVNLTDGLDGLAIMPTVLVAMGLAVFAYASGNAVFAEYLQIPMI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V  + + GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELAVFCATIAGAGLGFLWFNTYPAQVFMGDVGALALGAALGVVAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QVG +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGIFVMETVSVILQVGSYKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVVLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|330721152|gb|EGG99274.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium IMCC2047]
          Length = 360

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y     V +Y+T R      +A+ I    GP +I  L   Q   GQ VR
Sbjct: 1   MLVSLAEYLSQYISFFGVFQYLTLRGILGVITALAISLLVGPVMIRRLSFHQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ S+LLW D S+ +V +++ +T  FG VG+ DDY 
Sbjct: 59  DDGPESHLSKRGTPTMGGALILIAIMISTLLWGDLSNRYVWVVIGVTFIFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL G+ + L + +  + A   L + + +       +T ++ PFF+D+ + +G
Sbjct: 119 KVVEKNSRGLPGRWKYLWQSVGGLAAASFLYYSATT-----PAETELIVPFFKDVAIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +F+I F  FVIV T+NAVNLTDGLDGLAI+P ++   A    AY++G+   + YL + ++
Sbjct: 174 IFYIVFTYFVIVGTSNAVNLTDGLDGLAILPTVLVGAALGIFAYLSGHTQFADYLNIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+   A++GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L I+
Sbjct: 234 PGAGELVIFCGAIVGAGLGFLWFNTYPAQVFMGDVGALALGAALGVVAVIVRQEFVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T KR+F MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETVSVILQVASFKLTGKRIFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LSTLKLR 360


>gi|158426165|ref|YP_001527457.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Azorhizobium
           caulinodans ORS 571]
 gi|172047922|sp|A8HZ57|MRAY_AZOC5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|158333054|dbj|BAF90539.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Azorhizobium
           caulinodans ORS 571]
          Length = 361

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 201/367 (54%), Positives = 271/367 (73%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA   + +   +V +Y+TFR+  A  +A+L VF FGP +I  LR L++ +GQP+R 
Sbjct: 1   MLQWLAQLHDTFPAFNVFRYITFRTGGAIVTAVLFVFLFGPGIISTLR-LKQGKGQPIRA 59

Query: 61  PNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                H   K  TPTMGG++I  GLI ++LLWA+ S+L+V ++L +T  FGL+GFYDDY+
Sbjct: 60  DGPQSHLLTKKGTPTMGGLMIFSGLIVATLLWANLSNLYVWVVLFVTTGFGLIGFYDDYL 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T     G SGK R+ IE +IA +AV  ++    +        +S+ FPFF+D++LD+G
Sbjct: 120 KVTRQSHAGFSGKARLAIEALIAGIAVVLMINAGRAG-----LSSSVAFPFFKDLLLDLG 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F AFVIVA  NAVNLTDGLDGLAIVPVMIA+ +F  I+Y++GN++ + YLQ+++V
Sbjct: 175 WFFVVFGAFVIVAAGNAVNLTDGLDGLAIVPVMIAAASFGMISYLSGNVVFADYLQIHYV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL V+  A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+TKHEI+L +I
Sbjct: 235 AGVGELAVICGAIIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGSIAVATKHEIVLAVI 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFV+E +SVI+QV  F++T KRVF MAPIHHHFE+ GWTE+Q+VIRFWII+ + A++G
Sbjct: 295 GGLFVLEAVSVIVQVISFRLTGKRVFRMAPIHHHFEQLGWTESQVVIRFWIIAVVLALLG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LATLKLR 361


>gi|85858523|ref|YP_460725.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Syntrophus
           aciditrophicus SB]
 gi|97179717|sp|Q2LR51|MRAY_SYNAS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|85721614|gb|ABC76557.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Syntrophus
           aciditrophicus SB]
          Length = 359

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 171/368 (46%), Positives = 241/368 (65%), Gaps = 11/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L       Y   +V +Y+TFR+  A  +A++I F  GP +I  LR L+   GQ +R
Sbjct: 1   MLYHLLYPLHTTYSYFNVFRYITFRTIYAAITALIICFLLGPWLIRKLRELK--MGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++I+  ++ S+LLWA+ +  +V ++L++TL +GL+GF DDY 
Sbjct: 59  DDGPEAHLSKQGTPTMGGVLIIFAVVVSTLLWANLTIDYVWLVLMVTLGYGLIGFADDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T   + G+SGKVR+  E  IA+L    L              ++I  PFF+ ++ D+G
Sbjct: 119 KLTRQSSRGVSGKVRLACEVCIALLVSVVLYAKPG-------FNSTIAIPFFKTVLPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +I  + F+IV  ANAVNLTDGLDGLAI P +   + +   AY AGN  ++ YLQ+  V
Sbjct: 172 WGYIFLSTFIIVGAANAVNLTDGLDGLAIGPAITCFMTYLLFAYFAGNFKIASYLQIPGV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL +   A++GAGIGFLW+N  PA +FMGDTGSL+LG  +G +A+ TK EILL I+
Sbjct: 232 AGVGELSIFCGAIVGAGIGFLWYNTYPAQVFMGDTGSLSLGGALGCLAIVTKQEILLAIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+ET SVI QVG+FK++  KR+F MAPIHHHFE KGW E ++++RFWIIS + A++
Sbjct: 292 GGIFVLETFSVIFQVGWFKLSHGKRIFRMAPIHHHFELKGWAEPKVIVRFWIISILLALL 351

Query: 359 GLLTLKMR 366
            + TLK+R
Sbjct: 352 AISTLKLR 359


>gi|161830315|ref|YP_001596094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii RSA 331]
 gi|189082226|sp|A9NA35|MRAY_COXBR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|161762182|gb|ABX77824.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Coxiella
           burnetii RSA 331]
          Length = 361

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 167/368 (45%), Positives = 248/368 (67%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +F  +++    V  Y+TFRS  +  +A+++V +  P++I  L SLQ   GQ VR
Sbjct: 1   MLLWLTNFLSQHFHAFRVFNYLTFRSIVSALTALILVLSLSPRLIKYLVSLQ--VGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++I++ ++ S LLW D S+  + +ILL+T++F  +G+ DDY 
Sbjct: 59  NDGPQTHLKKSGTPTMGGVLIIVAIVISVLLWGDLSNRFIWVILLVTVAFSAIGWMDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   ++ GLS + + L++ II  LA   L F + +       +T++V PF ++++ ++G
Sbjct: 119 KIIRKNSKGLSARSKYLLQSIIGALAAVYLYFSATTG-----AETALVIPFLKNVLPNLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  A FVIV ++NAVNLTDGLDGLA++P ++   A    AY   N   + YL + ++
Sbjct: 174 LFYIVLAYFVIVGSSNAVNLTDGLDGLALMPTVMIGAALGVFAYTTRNHFFAQYLAIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+VV  SAL+GAG+GFLW+N  PA +FMGD GSL LGA +G  AV  + E++  ++
Sbjct: 234 PGAGEVVVFCSALVGAGLGFLWYNTYPAQVFMGDVGSLGLGAALGVTAVVVRQELVYFLM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV ETLSVI+QVGYFK++  KR+F MAP+HHHFE KGW E ++++RFWII+FI  + 
Sbjct: 294 GGIFVAETLSVILQVGYFKLSGGKRIFRMAPLHHHFELKGWPEPKVIVRFWIITFILVLC 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|167647632|ref|YP_001685295.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Caulobacter sp.
           K31]
 gi|189082222|sp|B0T834|MRAY_CAUSK RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167350062|gb|ABZ72797.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Caulobacter sp.
           K31]
          Length = 371

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 182/372 (48%), Positives = 256/372 (68%), Gaps = 7/372 (1%)

Query: 1   MFIQLADFS-----EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRG 55
           M   L D+      E+  + ++LKY+TFR+  +  +A ++  A G + I  +++ Q   G
Sbjct: 1   MLYFLYDWLSRGGHEHVPVLNLLKYLTFRTGMSMLTAYVVAVAMGSRFIRWMKAKQGK-G 59

Query: 56  QPVRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGF 114
           QP+R   +  H   K  TPTMGG +IL GL   SLL+AD  ++HV ++L +T SFG++GF
Sbjct: 60  QPIRADGIARHVVEKAGTPTMGGFMILAGLFVGSLLFADLKNVHVWVVLGITGSFGVLGF 119

Query: 115 YDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDI 174
            DDY K+T     GLS   +++ +FII+ILA   L+ ++  +   +  +TS+VFP  +++
Sbjct: 120 MDDYAKVTKQTTAGLSSSQKLIAQFIISILAAVVLIIFAPKSPTTVGLETSVVFPILKNL 179

Query: 175 ILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYL 234
           ++++G F++ FAA  I   +NAVNLTDGLDGLAIVPVM A+  F  IAY+ GN+  + YL
Sbjct: 180 VINLGWFYVAFAAITIAGFSNAVNLTDGLDGLAIVPVMFAASTFGLIAYLVGNVKFADYL 239

Query: 235 QVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEI 294
            +++VP VGEL VV  A+IG G+GFLW+N  PA IFMGDTGSLALG  +G IAV  KHE+
Sbjct: 240 NLHYVPSVGELAVVCGAIIGGGMGFLWYNAPPAKIFMGDTGSLALGGALGSIAVCAKHEL 299

Query: 295 LLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFI 354
           +L I+GGLFV E LSV++QV YFK T KR+FLMAPIHHHFEK GW E+ +VIRFWI++ +
Sbjct: 300 VLGIVGGLFVAEALSVMIQVAYFKKTGKRIFLMAPIHHHFEKLGWAESTVVIRFWIVAMM 359

Query: 355 FAVIGLLTLKMR 366
            + +GL TLK+R
Sbjct: 360 LSFVGLATLKLR 371


>gi|75675241|ref|YP_317662.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrobacter
           winogradskyi Nb-255]
 gi|97176800|sp|Q3STT1|MRAY_NITWN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|74420111|gb|ABA04310.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrobacter
           winogradskyi Nb-255]
          Length = 368

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 199/374 (53%), Positives = 258/374 (68%), Gaps = 14/374 (3%)

Query: 1   MFIQLADFSEYYIIT-------HVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           MF  L D S             +V +Y+TFR+  A  +  L VF FGP +ID LR  Q  
Sbjct: 1   MFYWLIDLSNTVPGLGIFKPLLNVFRYITFRTGGAVVTGALFVFLFGPWIIDNLRLRQGK 60

Query: 54  RGQPVRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLV 112
            GQP+R      H   K  TPTMGG++IL GL+ S++LWA+  + +V I+L +TL FGL+
Sbjct: 61  -GQPIRADGPQSHLVSKKGTPTMGGLMILSGLVVSTVLWANPLNPYVWIVLAVTLGFGLI 119

Query: 113 GFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFR 172
           GFYDDY+K+T     G SG+ R+L+      L +     Y+ + L      T++V PFF+
Sbjct: 120 GFYDDYLKVTKQTHAGFSGRTRLLL-----ELLIALAACYALTRLGREPFSTALVIPFFK 174

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
           D+ LD+G FF+ F AF+IV   NAVNLTDGLDGLAIVPVMIA+ +F+ IAY+AGN + + 
Sbjct: 175 DVALDLGWFFLGFGAFIIVGAGNAVNLTDGLDGLAIVPVMIAAASFAMIAYLAGNAVFAD 234

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YLQ+N++ G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KH
Sbjct: 235 YLQINYIAGAGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKH 294

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI+L +IGGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFE+ GWTE QIVIRFWIIS
Sbjct: 295 EIVLAVIGGLFVLEAVSVIVQVASFKLTGKRIFKMAPIHHHFEQLGWTEPQIVIRFWIIS 354

Query: 353 FIFAVIGLLTLKMR 366
            + A+ GL TLK+R
Sbjct: 355 VMLALAGLSTLKLR 368


>gi|225077136|ref|ZP_03720335.1| hypothetical protein NEIFLAOT_02191 [Neisseria flavescens
           NRL30031/H210]
 gi|224951547|gb|EEG32756.1| hypothetical protein NEIFLAOT_02191 [Neisseria flavescens
           NRL30031/H210]
          Length = 360

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 237/366 (64%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSTNNIL----IVPFFKQVALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYASGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|15889381|ref|NP_355062.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Agrobacterium
           tumefaciens str. C58]
 gi|22095884|sp|Q8UDM5|MRAY_AGRT5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|15157231|gb|AAK87847.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Agrobacterium
           tumefaciens str. C58]
          Length = 366

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 206/354 (58%), Positives = 268/354 (75%), Gaps = 2/354 (0%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M I L + S+   + ++ +Y+TFR+ AA F++ LIVF FGP +I+ LR  Q   GQP+R 
Sbjct: 1   MLIWLVELSDKVQLFNLFRYITFRAGAAMFTSALIVFLFGPAIINSLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++G SLLW D S+++V  +L++TL FG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILAGILGGSLLWGDLSNVYVVAVLMVTLGFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYS-NSTLLGIETKTSIVFPFFRDIILDMG 179
           +T     G SGK R+ IEF+IA +AV  ++  +  S   G    +SI FPFF++ ++++G
Sbjct: 120 VTKQSDKGFSGKARLGIEFLIAAIAVFFMMKMALASAPHGGTLGSSIAFPFFKEFVINLG 179

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+ F AFVIV   NAVNLTDGLDGLAIVPVMIA+  F  IAY+AGN + ++YLQ+NFV
Sbjct: 180 YFFVLFGAFVIVGAGNAVNLTDGLDGLAIVPVMIAAATFGVIAYLAGNAVFANYLQINFV 239

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V++ A+IGAG+GFLWFN  PA IFMGDTGSLALG  IG IAV+TKHEI+++I+
Sbjct: 240 PGTGELAVIVGAVIGAGLGFLWFNAPPAAIFMGDTGSLALGGLIGSIAVATKHEIVMVIV 299

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISF 353
           GGLFV+ETLSVI+QV +FK T +RVFLMAPIHHHFEKKGWTE+Q+VIRFWIIS 
Sbjct: 300 GGLFVMETLSVIIQVFWFKRTGRRVFLMAPIHHHFEKKGWTESQVVIRFWIISV 353


>gi|198282528|ref|YP_002218849.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667704|ref|YP_002424718.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226700975|sp|B5ELC6|MRAY_ACIF5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226709926|sp|B7J3V5|MRAY_ACIF2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|198247049|gb|ACH82642.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519917|gb|ACK80503.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 360

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLA-DFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L       Y   +V +Y+T R   A  +A+++    GP  I  LR  +   GQ VR
Sbjct: 1   MLYALFMQLGSLYHGFYVFQYLTLRGVLATLTALVLSLFIGPFFIARLRRYK--IGQMVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +I ++LLW+D  +  V + +L TL+FG +GF DD+ 
Sbjct: 59  NDGPETHLIKQGTPTMGGALILLVVILTTLLWSDLGNPLVWVAVLTTLAFGAIGFVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GLS + +  ++ ++A  A   L   +++       +TS++ PF   +++ MG
Sbjct: 119 KLRRQNSKGLSARAKYGLQSLVAFAAGGVLYALASN-----PVETSLILPFIPHVLIPMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FI F+ FVIV T+NAVNLTDGLDGLAIVP ++ + A    AYV+GN + + YL V +V
Sbjct: 174 AGFIVFSYFVIVGTSNAVNLTDGLDGLAIVPTVMVAGALGVFAYVSGNAVFARYLDVPWV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG G++++   AL+GAG+GFLWFN  PA +FMGDTG+LALGA +  +A+  + E++L I+
Sbjct: 234 PGSGQMLIFCGALVGAGLGFLWFNTYPADVFMGDTGALALGAALAIVAIVARQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QV  F++T KRVF MAP+HHHFEKKGW E ++ +RFWII+ I  ++G
Sbjct: 294 GGVFVVETLSVIIQVVSFRLTGKRVFRMAPLHHHFEKKGWPEPRVAVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L +LK+R
Sbjct: 354 LSSLKIR 360


>gi|220933946|ref|YP_002512845.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thioalkalivibrio
           sp. HL-EbGR7]
 gi|254813262|sp|B8GMM6|MRAY_THISH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|219995256|gb|ACL71858.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thioalkalivibrio
           sp. HL-EbGR7]
          Length = 360

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 247/367 (67%), Gaps = 8/367 (2%)

Query: 1   MFIQLADF-SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +F SEYY   +V +Y+T R+     +A++I F  GP +I  L   +   GQ VR
Sbjct: 1   MLLSLFEFLSEYYRGFNVFQYLTLRAILGVLTALIIAFLVGPAMIRRLSLYK--IGQQVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW+D S+  V ++L++TL FGL+G  DDY 
Sbjct: 59  TDGPQTHLTKAGTPTMGGALILVAVAVSTLLWSDLSNRFVWVVLMVTLLFGLIGGIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+  G++ GLS + +   + ++       L + + +       +T+   P F+D+ + +G
Sbjct: 119 KLRYGNSKGLSARTKFFWQSVVGFATAILLYYTAQA-----PVETTFFVPLFKDVAIQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +FI    FVIV  +NAVNLTDGLDGLAI+P ++ + AF   AY++G+ + ++YL + +V
Sbjct: 174 PWFILLTWFVIVGASNAVNLTDGLDGLAIMPTVLVAGAFGVFAYLSGHAVFANYLGIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVG+LVV   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV T+ EI+L+I+
Sbjct: 234 PGVGDLVVFTGALVGAGLGFLWFNAYPAQVFMGDVGALALGAALGVLAVVTRQEIVLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVIMQV  +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ I  ++G
Sbjct: 294 GGVFVVETLSVIMQVVSYKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|332187127|ref|ZP_08388867.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingomonas sp.
           S17]
 gi|332012827|gb|EGI54892.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Sphingomonas sp.
           S17]
          Length = 356

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 181/366 (49%), Positives = 239/366 (65%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   +A+   +  + ++++Y++FRS AA  +A+LI    GP+ I  LR  Q   GQP+R 
Sbjct: 1   MLYWIAEHLGFPGLLNLIRYLSFRSGAAIATALLIGLIIGPRFIGWLRVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  +  S LLW D S+  V   L +TL FG +GF DDY K
Sbjct: 60  DGPQTHLAKRGTPTMGGLMILTSMALSILLWMDLSNPFVWACLFVTLGFGAIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +      G+SG+ R+L+EF+IA +A   ++          +  T +  PF   + +D+G+
Sbjct: 120 VRKASTAGVSGRTRLLLEFLIAGIAAWIIM---------GQNGTPLYLPFTTRMYIDLGI 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAAF IVA  NAVNLTDGLDGLA +PV+IASVAF  I Y+ GN+  + YL +  VP
Sbjct: 171 FYPVFAAFTIVAFGNAVNLTDGLDGLATMPVIIASVAFLVIVYLVGNVKFADYLGIPHVP 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
             GEL +   A+IGAG+ FLWFN  PA +FMGDTGSLALG  +G IAV   HEI+L IIG
Sbjct: 231 RAGELAIFCGAVIGAGLAFLWFNAPPAAVFMGDTGSLALGGALGTIAVVAHHEIVLGIIG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSVI+QV ++K T KRVF MAPIHHHFE+ GW+E  +VIRFWII+ +  + GL
Sbjct: 291 GLFVVEALSVIIQVFFYKRTGKRVFRMAPIHHHFEQLGWSEPTVVIRFWIIALVLMLAGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 STLKLR 356


>gi|313667813|ref|YP_004048097.1| phopho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           lactamica ST-640]
 gi|313005275|emb|CBN86708.1| phopho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           lactamica 020-06]
          Length = 360

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 237/366 (64%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + + ++   I     IV  F +  +     
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAVIAGLALFYLAANSANNIL----IVPFFKQIALPLGVA 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|145630235|ref|ZP_01786017.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae R3021]
 gi|145637114|ref|ZP_01792777.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittHH]
 gi|148828295|ref|YP_001293048.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittGG]
 gi|229844910|ref|ZP_04465048.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 6P18H1]
 gi|229846166|ref|ZP_04466278.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 7P49H1]
 gi|260580219|ref|ZP_05848049.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae RdAW]
 gi|319776624|ref|YP_004139112.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Haemophilus
           influenzae F3047]
 gi|329124137|ref|ZP_08252684.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           aegyptius ATCC 11116]
 gi|166220386|sp|A5UIQ9|MRAY_HAEIG RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|144984516|gb|EDJ91939.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae R3021]
 gi|145269768|gb|EDK09708.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittHH]
 gi|148719537|gb|ABR00665.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittGG]
 gi|229811170|gb|EEP46887.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 7P49H1]
 gi|229812291|gb|EEP47982.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 6P18H1]
 gi|260093503|gb|EEW77436.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae RdAW]
 gi|301169875|emb|CBW29479.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Haemophilus
           influenzae 10810]
 gi|317451215|emb|CBY87448.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Haemophilus
           influenzae F3047]
 gi|327467562|gb|EGF13060.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           aegyptius ATCC 11116]
          Length = 360

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|325578824|ref|ZP_08148871.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           parainfluenzae ATCC 33392]
 gi|325159648|gb|EGC71780.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           parainfluenzae ATCC 33392]
          Length = 360

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ +V I L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLTNPYVWICLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAIIWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GAG+GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|145635586|ref|ZP_01791284.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittAA]
 gi|145641279|ref|ZP_01796859.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae R3021]
 gi|145267148|gb|EDK07154.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittAA]
 gi|145274116|gb|EDK13982.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 22.4-21]
          Length = 360

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGTIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|241760215|ref|ZP_04758311.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           flavescens SK114]
 gi|319639037|ref|ZP_07993795.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria mucosa
           C102]
 gi|241319326|gb|EER55791.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           flavescens SK114]
 gi|317399941|gb|EFV80604.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria mucosa
           C102]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 158/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A++     GP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALVFSLLLGPWTIRKLTALK--VGQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S++LW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLIKNGTPTMGGSLILTAITVSTILWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLATNSANNIL----IVPFFKQVALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIIRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAISVMLQVGWYKRTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|28871546|ref|NP_794165.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|66047332|ref|YP_237173.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. syringae B728a]
 gi|213966570|ref|ZP_03394721.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato T1]
 gi|301384715|ref|ZP_07233133.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato Max13]
 gi|302059797|ref|ZP_07251338.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato K40]
 gi|302131744|ref|ZP_07257734.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|302185272|ref|ZP_07261945.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. syringae 642]
 gi|37999566|sp|Q87WY2|MRAY_PSESM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|75500771|sp|Q4ZNY7|MRAY_PSEU2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|28854797|gb|AAO57860.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato str. DC3000]
 gi|63258039|gb|AAY39135.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [Pseudomonas
           syringae pv. syringae B728a]
 gi|213928420|gb|EEB61964.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tomato T1]
 gi|330877136|gb|EGH11285.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. morsprunorum str. M302280PT]
 gi|330895230|gb|EGH27568.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. japonica str. M301072PT]
 gi|330938045|gb|EGH41813.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. pisi str. 1704B]
 gi|330964054|gb|EGH64314.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. actinidiae str. M302091]
 gi|330973390|gb|EGH73456.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. aceris str. M302273PT]
 gi|330981220|gb|EGH79323.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. aptata str. DSM 50252]
 gi|331016731|gb|EGH96787.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. lachrymans str. M302278PT]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+T  FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTFLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S      T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLCAAIFLYTTAPSA-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L I+
Sbjct: 234 PGAGELIVFSGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEMVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|145627897|ref|ZP_01783698.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 22.1-21]
 gi|145639345|ref|ZP_01794951.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittII]
 gi|144979672|gb|EDJ89331.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 22.1-21]
 gi|145271648|gb|EDK11559.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittII]
 gi|309751219|gb|ADO81203.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase E [Haemophilus
           influenzae R2866]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSL+LG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLSLGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|285019576|ref|YP_003377287.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           albilineans GPE PC73]
 gi|283474794|emb|CBA17293.1| probable phospho-n-acetylmuramoyl-pentapeptide-transferase protein
           [Xanthomonas albilineans]
          Length = 361

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 236/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA +      +  +  Y+TFR   A  +++ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLRQLDSVFGLFGYLTFRGILAALTSLFLSLWLGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ S LLW D  + +V ++L++ L+FG++G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVLLSVLLWGDLRNRYVWLVLVVMLAFGVIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A   IV  +NAVNLTDGLDGLAI+P +  + A    AY +GN++ S YL++  
Sbjct: 174 GISFVTIAYLWIVGFSNAVNLTDGLDGLAIMPTVFVACALGVFAYASGNVVFSDYLKIPA 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GELV++ +++ GAG+GFLWFN  PA++FMGD G+LALGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELVIICTSIAGAGLGFLWFNTYPAMVFMGDIGALALGAVLGTIAVIVRQELVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|240116309|ref|ZP_04730371.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID18]
 gi|268601976|ref|ZP_06136143.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID18]
 gi|268586107|gb|EEZ50783.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID18]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 161/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAVIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+IIG
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIIG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|167856475|ref|ZP_02479192.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           parasuis 29755]
 gi|219870388|ref|YP_002474763.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           parasuis SH0165]
 gi|254813240|sp|B8F3B3|MRAY_HAEPS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|167852398|gb|EDS23695.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           parasuis 29755]
 gi|219690592|gb|ACL31815.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           parasuis SH0165]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 243/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    +V+ Y+TFRS  A  +A++I    G  VI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVQYNTAFNVVSYITFRSIMALLTALIIGLWIGSTVIRRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGGI+IL  +  S+LLWAD  + +V  +L +   +G+VGF DDY 
Sbjct: 59  HDGPESHYKKRGTPTMGGIMILFAIGVSTLLWADLRNPYVWFVLFILFGYGVVGFVDDYW 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   +  GL  + +     +IA+++   +      T       T +V PFF+D++  +G
Sbjct: 119 KIARKNTDGLIARWKYFWLSVIALVSAFGMYAIGKDT-----AATQLVVPFFKDVMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV T+NAVNLTDGLDGLAIVP+++ + AF+ IA+  GN   + YL + ++
Sbjct: 174 LFYIVLTYFVIVGTSNAVNLTDGLDGLAIVPLIMVAGAFALIAWATGNYNFAQYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GELV++ +A++GAG+GFLWFN  PA +FMGD GSL+LG  +G IAV  + E+LL+++
Sbjct: 234 KYSGELVILCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGGALGVIAVLVRQELLLVVM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ +KR+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGVFVVEALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLMLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|315498852|ref|YP_004087656.1| phospho-n-acetylmuramoyl-pentapeptide-transferase [Asticcacaulis
           excentricus CB 48]
 gi|315416864|gb|ADU13505.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Asticcacaulis
           excentricus CB 48]
          Length = 369

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 185/370 (50%), Positives = 260/370 (70%), Gaps = 5/370 (1%)

Query: 1   MFIQLADF---SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQP 57
           MF  L +     +++ + ++LKY T R   A  ++ L+    G + I  +R+ Q   GQP
Sbjct: 1   MFYFLYEHFAALDHWPLLNLLKYQTVRVGLAIITSYLVAVGLGSRFIRWMRAKQGK-GQP 59

Query: 58  VRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           +R      H   K  TPTMGG++IL G++ ++LLWAD  S+ V ++L +T+ +GL+GF D
Sbjct: 60  IREDGPQSHLLTKKGTPTMGGLMILAGILVATLLWADLRSVTVWVVLGVTMIYGLLGFMD 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+T   + GLSG  +++ +FI+A +A   L+++   +       TS+  P F++++ 
Sbjct: 120 DYAKVTKQTSAGLSGSQKLIAQFIVAGIAAALLVYFGPQSPTSSGLSTSLAVPIFKNVLF 179

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
           ++G F+I FAA VIV  +NAVNLTDGLDGLAIVPVMIA+  F  I+Y  GN + ++YL V
Sbjct: 180 NLGFFYIVFAAVVIVGASNAVNLTDGLDGLAIVPVMIAAGTFGIISYAVGNYVFANYLNV 239

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           +FVPG GE+ V ++A+IG G+GFLW+N  PA IFMGDTGSLALG  +G  AV+ KHEI+L
Sbjct: 240 HFVPGSGEVAVFLAAVIGGGMGFLWYNAPPAKIFMGDTGSLALGGGLGMTAVAIKHEIVL 299

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            I+GGLFVVE LSV++Q+GYFK+T KRVFLMAPIHHHFEKKGW E+ +VIRFWI++ I A
Sbjct: 300 AIVGGLFVVEALSVMIQIGYFKLTGKRVFLMAPIHHHFEKKGWAESTVVIRFWIVAGILA 359

Query: 357 VIGLLTLKMR 366
           ++GL TLK+R
Sbjct: 360 MVGLATLKLR 369


>gi|59801873|ref|YP_208585.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae FA 1090]
 gi|194099351|ref|YP_002002451.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae NCCP11945]
 gi|240017231|ref|ZP_04723771.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae FA6140]
 gi|240113344|ref|ZP_04727834.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae MS11]
 gi|240118596|ref|ZP_04732658.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID1]
 gi|240124139|ref|ZP_04737095.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID332]
 gi|240128809|ref|ZP_04741470.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|254494323|ref|ZP_05107494.1| phopho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae 1291]
 gi|260439874|ref|ZP_05793690.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae DGI2]
 gi|268595419|ref|ZP_06129586.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae 35/02]
 gi|268597243|ref|ZP_06131410.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae FA19]
 gi|268599418|ref|ZP_06133585.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae MS11]
 gi|268604307|ref|ZP_06138474.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID1]
 gi|268682764|ref|ZP_06149626.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID332]
 gi|268684826|ref|ZP_06151688.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268687191|ref|ZP_06154053.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|291043150|ref|ZP_06568873.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae DGI2]
 gi|293398486|ref|ZP_06642664.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae F62]
 gi|75355606|sp|Q5F6L4|MRAY_NEIG1 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621788|sp|B4RQC9|MRAY_NEIG2 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|59718768|gb|AAW90173.1| putative phopho-N-acetylmuramoyl-pentapeptide-transferase
           [Neisseria gonorrhoeae FA 1090]
 gi|193934641|gb|ACF30465.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae NCCP11945]
 gi|226513363|gb|EEH62708.1| phopho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae 1291]
 gi|268548808|gb|EEZ44226.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae 35/02]
 gi|268551031|gb|EEZ46050.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae FA19]
 gi|268583549|gb|EEZ48225.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae MS11]
 gi|268588438|gb|EEZ53114.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID1]
 gi|268623048|gb|EEZ55448.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae PID332]
 gi|268625110|gb|EEZ57510.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae SK-92-679]
 gi|268627475|gb|EEZ59875.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae SK-93-1035]
 gi|291012756|gb|EFE04739.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae DGI2]
 gi|291610957|gb|EFF40054.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           gonorrhoeae F62]
 gi|317164860|gb|ADV08401.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAVIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|51246752|ref|YP_066636.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfotalea
           psychrophila LSv54]
 gi|61214073|sp|Q6AJ51|MRAY_DESPS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|50877789|emb|CAG37629.1| probable phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Desulfotalea psychrophila LSv54]
          Length = 359

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 164/368 (44%), Positives = 234/368 (63%), Gaps = 11/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           MF  L       +   +V +Y+T RS  A   A L+V   GP  I  ++ LQ   GQ VR
Sbjct: 1   MFYHLLYPLHTAFAGFNVFRYITLRSIGAAVCAFLLVLFLGPLFIRTMQRLQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K   PTMGG++IL+ +  S+LLWA   +  + ++LL+TL FG++G YDDY 
Sbjct: 59  EDGPETHFKKKGVPTMGGLLILLSVTVSTLLWARLDNPLIWLVLLVTLFFGMIGAYDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI+   + GLS K ++L++   A++    +  +             +  PF +++  D+G
Sbjct: 119 KISKKTSEGLSAKGKLLLQIAGALIVGFFVYLHPG-------YDGQLSIPFMKNVQPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I FA  VIV  +NAVNLTDGLDGLA  P++++S  +   AY+AGN++L++YL + +V
Sbjct: 172 WFYIVFAVIVIVGASNAVNLTDGLDGLAAGPMVVSSAVYLLFAYLAGNVVLANYLHIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL +    L GA +GFLWFN  PA +FMGD GSLALG  +G IA+  K E LL I+
Sbjct: 232 AGSGELAIFCGTLFGACLGFLWFNAHPAQMFMGDVGSLALGGALGSIAIIIKQEFLLAIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+E LSV++QVGYF+M+  KR+FLMAP HHHFEKKGW+E ++V+RFWI+S I  + 
Sbjct: 292 GGVFVMEALSVMLQVGYFRMSKGKRIFLMAPFHHHFEKKGWSEPKVVVRFWIVSIILGLF 351

Query: 359 GLLTLKMR 366
            + TLK+R
Sbjct: 352 AIATLKLR 359


>gi|301155883|emb|CBW15352.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Haemophilus
           parainfluenzae T3T1]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 166/367 (45%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ +V I L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYVWICLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAIIWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GAG+GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|325923950|ref|ZP_08185540.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           gardneri ATCC 19865]
 gi|325545576|gb|EGD16840.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           gardneri ATCC 19865]
          Length = 361

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 161/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLG--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKAVALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQELVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSVI+QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVIIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|237799287|ref|ZP_04587748.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. oryzae str. 1_6]
 gi|331022143|gb|EGI02200.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. oryzae str. 1_6]
          Length = 360

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+T  FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTFLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S      T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLGAAIFLYTTAPSA-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L I+
Sbjct: 234 PGAGELIVFSGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEMVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|94970659|ref|YP_592707.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Koribacter versatilis Ellin345]
 gi|166218997|sp|Q1IKG7|MRAY_ACIBL RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|94552709|gb|ABF42633.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Koribacter versatilis Ellin345]
          Length = 379

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 151/381 (39%), Positives = 225/381 (59%), Gaps = 17/381 (4%)

Query: 1   MFIQL----ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQ 56
           M   L    A     +    + +Y+TFR++ A  +A+ +    GP V+  LR  Q   GQ
Sbjct: 1   MLYWLLYEKAFLLHNFTPFRIFRYLTFRTAFASLTALFMGLIIGPAVVRRLREFQ--IGQ 58

Query: 57  PVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
            +R      H +K  TPTMGG++I + +I  +LLWAD S+  V I +L T++FG +GF D
Sbjct: 59  YIREEGPKSHQKKSGTPTMGGVLITIAIIVPTLLWADLSNKFVWIAMLATIAFGAIGFTD 118

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY+K+      GL+ + ++ ++ ++AIL   +L+                +  F  D+ +
Sbjct: 119 DYLKVANRRNLGLTARAKMGLQILVAILVAISLVLVQRHGHYNTHLIVPFIKSFHPDLEI 178

Query: 177 DMGLFFIPFAAFVIV-----------ATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVA 225
                +        +            ++NAVNLTDGLDGLAI   +IA+ A + + YV+
Sbjct: 179 SKLATYPHIWIIAYIPFLAFVAIVLVGSSNAVNLTDGLDGLAIGCTVIAAGALTVLTYVS 238

Query: 226 GNILLSHYLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGG 285
           G+   + YL ++ +P VGEL +   A++G+ IGFLW+N  PA +FMGD GSLALG  IG 
Sbjct: 239 GHAQFADYLGLSRMPEVGELSIFCGAMVGSAIGFLWYNAHPAEVFMGDVGSLALGGAIGT 298

Query: 286 IAVSTKHEILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIV 345
           +AV  K E+LL  IGG+FV+E LSVI+QVG +K+ KKR+F MAP+HHHFE  GW+E++I+
Sbjct: 299 VAVIIKQELLLPFIGGVFVLEALSVILQVGSYKLRKKRIFKMAPLHHHFELLGWSESKII 358

Query: 346 IRFWIISFIFAVIGLLTLKMR 366
           +RFWI S +FA+  L TLK+R
Sbjct: 359 VRFWIASLVFALFALTTLKLR 379


>gi|226941972|ref|YP_002797046.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Laribacter
           hongkongensis HLHK9]
 gi|254813241|sp|C1D5M0|MRAY_LARHH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|226716899|gb|ACO76037.1| MraY [Laribacter hongkongensis HLHK9]
          Length = 361

 Score =  276 bits (706), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 166/368 (45%), Positives = 232/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD+  EY    +V  YVT R+  A  +A+ I  A GP VI  L  L+   GQ VR
Sbjct: 1   MLLWLADWLGEYVRAFNVFNYVTLRAVLASLTALGIGLALGPWVIRKLAELK--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD ++ +V ++L +    G +GFYDD+ 
Sbjct: 59  TDGPQTHLVKTGTPTMGGTLILLSIGITTLLWADLTNKYVWLLLAVLFGTGAIGFYDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM- 178
           K+   D  G+S + ++  +  IAI A   L+     +   +   T ++ PFF+ +I    
Sbjct: 119 KVVYKDPKGISARAKMFWQSAIAIFAGIYLI-----STASLPAATELIVPFFKHVIYPFG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + F     FVIV T+NAVNLTDGLDGLA +PV++ S A +  AYVAGN + + YL +  
Sbjct: 174 VVGFCILTYFVIVGTSNAVNLTDGLDGLAAMPVVMVSAALAVFAYVAGNSVFASYLSLPH 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG  E+ V  +A+ GA + FLWFN  PA +FMGD G+LALGA +G +AV  + EI+L +
Sbjct: 234 IPGAHEVAVFCAAMAGACLAFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEIVLFV 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+E LSV++QV  FK+T KRVF MAP+HHHFE KGW E Q+V+RFWII+ +  + 
Sbjct: 294 MGGLFVMEALSVMIQVASFKLTGKRVFRMAPLHHHFELKGWKETQVVVRFWIITMMLVLA 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLSTLKLR 361


>gi|330987131|gb|EGH85234.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. lachrymans str. M301315]
          Length = 360

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S+     T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLCAAIFLYTTAPSS-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELIVFSGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|311693452|gb|ADP96325.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine bacterium
           HP15]
          Length = 361

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 158/368 (42%), Positives = 233/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +  S+Y+    V +Y+T R      +A+LI    GP +I  L   Q   GQ VR
Sbjct: 1   MLLWLTEVLSQYFSALTVFQYLTLRGILGTLTALLISLIIGPVMIRKLSQYQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD  + +V + LL+TL FG +G+ DDY 
Sbjct: 59  DDGPQTHLSKAGTPTMGGALILVAIGISTLLWADLGNRYVWVTLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDI-ILDM 178
           K+   +  GL  + +   + +I   A   L F S      +  +TS+  PF + + +   
Sbjct: 119 KVVERNPRGLPARWKYFWQSVIGATAAVVLFFSSA-----LPQETSLYVPFVKQVSLTLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + FI    FVIV ++NAVNLTDGLDGLAI+P ++ + A    AY++G+   ++YL +  
Sbjct: 174 PVLFILLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVAGALGIFAYLSGHAQFANYLLIPH 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+V   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 LPGTGELIVFCGALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGVVAVIVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ET+SVI+QV  F++T +R+F MAP+HHHFE KGW E ++++RFW+I+ +  +I
Sbjct: 294 MGGVFVMETVSVILQVASFRLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWVITVVLVLI 353

Query: 359 GLLTLKMR 366
           G+ +LK+R
Sbjct: 354 GIASLKLR 361


>gi|308388620|gb|ADO30940.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis alpha710]
 gi|325130844|gb|EGC53577.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis OX99.30304]
          Length = 360

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 239/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +A++A  AL + + ++   I     IV  F + ++    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAVIAGLALFYLAANSANNIL----IVPFFKQIVLPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|294012782|ref|YP_003546242.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Sphingobium
           japonicum UT26S]
 gi|292676112|dbj|BAI97630.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Sphingobium
           japonicum UT26S]
          Length = 357

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 182/366 (49%), Positives = 241/366 (65%), Gaps = 9/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M   LA   ++  + ++++Y++FR+ AA  +A++I    GP+ I  LR  Q   GQP+R 
Sbjct: 1   MLYWLAQTMDFAGVFNLIRYLSFRAGAAIATALVIGLLIGPRFIGWLRVRQGK-GQPIRD 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  ++ S LLW D SS++V   L +TL FG +GF DDY K
Sbjct: 60  DGPQTHLAKRGTPTMGGLMILTSMVSSVLLWMDLSSIYVWACLFVTLGFGAIGFLDDYDK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     GLSGK+R+  EF+IA  A   ++             T++  PF+    +++G 
Sbjct: 120 VTKASHKGLSGKMRLAFEFLIAGFAAWLIV--------SQHGNTALYVPFYNGPAIELGP 171

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           F+  FAAFVIVA  NAVNLTDGLDGLA +PV+IA +AF  I Y+ G    + YL +  VP
Sbjct: 172 FYFLFAAFVIVAFGNAVNLTDGLDGLATMPVIIACMAFMAIVYLVGRADFAGYLGIPHVP 231

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G G L ++  A+IGAG+ FLWFN  PA +FMGDTGSLALG  IG IAV+  HEI+L +IG
Sbjct: 232 GAGNLTILCGAIIGAGLAFLWFNAPPAAVFMGDTGSLALGGTIGVIAVTAHHEIVLGVIG 291

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SVI+QV ++K T KRVF MAPIHHHFE+ GW E  +VIRFWIISF+ A+ GL
Sbjct: 292 GLFVVEAMSVIIQVFFYKRTGKRVFKMAPIHHHFEQLGWAEPTVVIRFWIISFVLALAGL 351

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 352 ATLKLR 357


>gi|92114315|ref|YP_574243.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Chromohalobacter
           salexigens DSM 3043]
 gi|122419686|sp|Q1QVG4|MRAY_CHRSD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|91797405|gb|ABE59544.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Chromohalobacter
           salexigens DSM 3043]
          Length = 360

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 157/367 (42%), Positives = 235/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD   ++    +V  Y+T R      +A+++    GP+VI  L   Q   GQ VR
Sbjct: 1   MLLFLADLLAHFQSAFNVFNYLTLRVILGTLTALMLCLWLGPQVIRRLVERQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW D ++ +V ++L +TL FG +G+ DDY 
Sbjct: 59  DDGPQSHLSKAGTPTMGGAMILIAIAVSTLLWGDLTNHYVWLVLAVTLGFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   +  I + A   L   + S       + S++ P F+D+++ +G
Sbjct: 119 KVVEKNPRGLPARWKYFWQSAIGLGAAVTLYLTAAS-----PVEVSLIVPLFKDVVVPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV ++NAVNLTDGLDGLAI+P ++ ++  +  AY +GN + + YL +  V
Sbjct: 174 LFYIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVLVAMGLAIFAYASGNTVFAQYLHIPLV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V    + GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELAVFCGTIAGAGLGFLWFNTYPAQVFMGDVGALALGAALGVVAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QVG +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVMETVSVMLQVGSYKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWIITVVLVLLG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|161870656|ref|YP_001599829.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis 053442]
 gi|189082235|sp|A9M2H7|MRAY_NEIM0 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|161596209|gb|ABX73869.1| phopho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis 053442]
 gi|325134885|gb|EGC57518.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis M13399]
 gi|325198900|gb|ADY94356.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis G2136]
 gi|325203525|gb|ADY98978.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis M01-240355]
          Length = 360

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 161/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|288939891|ref|YP_003442131.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Allochromatium
           vinosum DSM 180]
 gi|288895263|gb|ADC61099.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Allochromatium
           vinosum DSM 180]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 159/367 (43%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L D+  EYY    V +Y+T R+     +A+ I    G  +I  LR+ +   GQ VR
Sbjct: 1   MLLYLTDWLTEYYNGFSVFRYLTLRAILGVLTALTIALLVGRPMIRRLRAYK--IGQTVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLW+D  + +V I+LL T++FGLVG  DDY 
Sbjct: 59  DDGPQSHLSKSGTPTMGGALILVAVGIATLLWSDLENRYVWIVLLTTMAFGLVGLVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + +    A  AL   +NS       +T+++ P+ +++ + +G
Sbjct: 119 KLVKRDPRGLIARWKYFWQTVFGFAAAVALYVTANS-----PAETALLIPYAKNLSIQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +FI    FVIV ++NAVNLTDGLDGLAI+P ++ + A +   Y AG+  +++YL + ++
Sbjct: 174 PWFILLTYFVIVGSSNAVNLTDGLDGLAIMPTVLVAGALTIFVYAAGHAQIANYLLIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P VGELV+  SAL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV+ + E++L I+
Sbjct: 234 PEVGELVIFCSALVGAGLGFLWFNAYPAQVFMGDVGALALGAALGVVAVAARQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV ET+SV++QV  FK+T KR+F MAP+HHHFE +GW E ++++RFWI++ +  +IG
Sbjct: 294 GGVFVAETISVMLQVMSFKLTGKRIFRMAPLHHHFELQGWPEPRVIVRFWIMTVVLVLIG 353

Query: 360 LLTLKMR 366
           L +LK+R
Sbjct: 354 LASLKIR 360


>gi|261379341|ref|ZP_05983914.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           subflava NJ9703]
 gi|284797781|gb|EFC53128.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           subflava NJ9703]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 158/366 (43%), Positives = 237/366 (64%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+      GP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLLLGPWTIRKLTALK--VGQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S++LW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLIKNGTPTMGGSLILTAITVSTILWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLATNSANNIL----IVPFFKQVALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIIRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAISVMLQVGWYKRTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|145633135|ref|ZP_01788867.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 3655]
 gi|144986361|gb|EDJ92940.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 3655]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETTFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGTIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|296313580|ref|ZP_06863521.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           polysaccharea ATCC 43768]
 gi|296839881|gb|EFH23819.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           polysaccharea ATCC 43768]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 237/366 (64%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYASGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|218768814|ref|YP_002343326.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis Z2491]
 gi|254805550|ref|YP_003083771.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis alpha14]
 gi|304386672|ref|ZP_07368954.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis ATCC 13091]
 gi|22095907|sp|Q9JSZ3|MRAY_NEIMA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|121052822|emb|CAM09169.1| phopho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis Z2491]
 gi|254669092|emb|CBA07653.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis alpha14]
 gi|261391932|emb|CAX49394.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           (UDP-MurNAc-pentapeptide phosphotransferase) [Neisseria
           meningitidis 8013]
 gi|304339257|gb|EFM05335.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis ATCC 13091]
 gi|325132964|gb|EGC55641.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis M6190]
 gi|325138952|gb|EGC61502.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis ES14902]
 gi|325142972|gb|EGC65329.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis 961-5945]
 gi|325144957|gb|EGC67240.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis M01-240013]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|90416333|ref|ZP_01224265.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine gamma
           proteobacterium HTCC2207]
 gi|90332058|gb|EAS47272.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine gamma
           proteobacterium HTCC2207]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  ++Y     +KY+T R   +  +A+ I +  GP++I  L SLQ   GQ +R
Sbjct: 1   MLVWLAEYLSQFYSPFSAVKYLTLRGIFSVITALTICWMLGPRMIALLNSLQ--MGQAIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +ILM +  S+LLWA+  +++V ++L +T SFGL+G+ DDY 
Sbjct: 59  SDGPQSHLSKAGTPTMGGALILMAMFISTLLWANLENVYVWVVLAVTFSFGLIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +  + A   L  Y+ S       +  ++ PFF+++ +++G
Sbjct: 119 KVVHKNPRGLPARWKYFWQSLCGLAAAVFLFSYAQSA-----AELDLIVPFFKNVAINLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I F  FVIV T+NAVNLTDGLDGLAI+P ++ + A   +AY+ GN   + YL + ++
Sbjct: 174 PFYILFTYFVIVGTSNAVNLTDGLDGLAILPTVLVAGALGIMAYLTGNYQFASYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL++   AL GAG+GFLWFN  PA++FMGD GSLALGA +G IAV  + E++L I+
Sbjct: 234 SGAGELLIFTGALCGAGLGFLWFNTYPAMVFMGDVGSLALGAALGVIAVIIRQEVVLAIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSVI+QV  FK+T KR+F MAP+HHH+E KGW E ++++RFWII+ +  ++G
Sbjct: 294 GGVFVIETLSVILQVASFKLTGKRIFRMAPLHHHYELKGWPEPRVIVRFWIITVVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|192359109|ref|YP_001983388.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Cellvibrio
           japonicus Ueda107]
 gi|229621249|sp|B3PCM3|MRAY_CELJU RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|190685274|gb|ACE82952.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Cellvibrio
           japonicus Ueda107]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LA++  EY     V +Y+T R+  +  +A+ I    GP VI  L  +    GQ VR
Sbjct: 1   MLYWLAEYLQEYMRGFAVFQYLTVRAILSVLTALGISLLLGPWVIRRLTEM--RIGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLW+DF + +V ++L++T  FG VG+ DDY 
Sbjct: 59  SDGPQTHLSKSGTPTMGGALILSAMFISTLLWSDFGNRYVWVVLIVTAIFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  + +   + I    A   L   + +       +T +  PFF+++ L+MG
Sbjct: 119 KVAKRDPKGLPARWKYFWQSIAGFGAAVFLFCTAQA-----PAETQLFIPFFKNVALNMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I F  FVIV T+NAVNLTDGLDGLAI+P ++ + A + IAY+AG+   + YL + ++
Sbjct: 174 LFYIIFTYFVIVGTSNAVNLTDGLDGLAIMPSVMVAGALALIAYLAGHSQFAQYLHIAYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  +HE +L I+
Sbjct: 234 PGAGELAVFCCALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGLVAVIVRHEFVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T +R+F MAPIHHHFE KGW E ++++RFWII+ +  +IG
Sbjct: 294 GGIFVLETVSVILQVASFKLTGRRIFRMAPIHHHFELKGWPEPRVIVRFWIITLVLVLIG 353

Query: 360 LLTLKMR 366
           L TLK R
Sbjct: 354 LATLKFR 360


>gi|16273061|ref|NP_439293.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae Rd KW20]
 gi|1171016|sp|P45062|MRAY_HAEIN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|1574690|gb|AAC22790.1| phospho-N-acetylmuramoyl-pentapeptide-transferase E (mraY)
           [Haemophilus influenzae Rd KW20]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R++ A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRANLALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|325136985|gb|EGC59582.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis M0579]
 gi|325202771|gb|ADY98225.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis M01-240149]
 gi|325208767|gb|ADZ04219.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis NZ-05/33]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 162/366 (44%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +     
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVA 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|254671175|emb|CBA08286.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis alpha153]
 gi|309379064|emb|CBX22366.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 360

 Score =  276 bits (705), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 161/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV+G+   S YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|21230197|ref|NP_636114.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66769813|ref|YP_244575.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188993028|ref|YP_001905038.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. campestris str. B100]
 gi|24212031|sp|Q8PCK2|MRAY_XANCP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|81304233|sp|Q4UQW8|MRAY_XANC8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|229621805|sp|B0RVA7|MRAY_XANCB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|21111735|gb|AAM40038.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66575145|gb|AAY50555.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167734788|emb|CAP52998.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. campestris]
          Length = 361

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 159/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKAIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G +AV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTVAVIVRQELVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|120555366|ref|YP_959717.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinobacter
           aquaeolei VT8]
 gi|166221324|sp|A1U3G1|MRAY_MARAV RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|120325215|gb|ABM19530.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinobacter
           aquaeolei VT8]
          Length = 361

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 155/368 (42%), Positives = 234/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +  S+Y+    V +Y+T R+     +A+LI    GP +I  L   Q   GQ VR
Sbjct: 1   MLLWLTEILSQYFSSLTVFQYLTLRAILGILTALLISLVIGPVMIRKLSQYQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD ++ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  DDGPQTHLSKAGTPTMGGALILVAIAISTLLWADLTNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPF-FRDIILDM 178
           K+   +  GL  + +   + +I   A   L   +      +  +TS+  PF     +   
Sbjct: 119 KVVERNPRGLPARWKYFWQSVIGATAAIVLYVTA-----SMPQETSLYLPFLKNVSLTLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + FI    FVIV ++NAVNLTDGLDGLAI+P ++ + A +  AY++G+   ++YL +  
Sbjct: 174 PVLFILLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVAGALAIFAYLSGHAQFANYLLIPH 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL++   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 LPGTGELIIFCGALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGTVAVIVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ET+SVI+QV  F++T +R+F MAP+HHHFE KGW E ++++RFW+++ +  +I
Sbjct: 294 MGGVFVMETISVILQVASFRLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWVVTVVLVLI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLASLKIR 361


>gi|330957973|gb|EGH58233.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. maculicola str. ES4326]
          Length = 360

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+T  FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTFLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S      T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLCAAIFLYMTAPSA-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L I+
Sbjct: 234 PGAGELIVFSGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEMVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|71734379|ref|YP_276233.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|257483450|ref|ZP_05637491.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
 gi|289624979|ref|ZP_06457933.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|298488532|ref|ZP_07006562.1| Phospho-N-acetylmuramoyl-pentapeptide-transferas e [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|97176865|sp|Q48EF5|MRAY_PSE14 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|71554932|gb|AAZ34143.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. phaseolicola 1448A]
 gi|298156873|gb|EFH97963.1| Phospho-N-acetylmuramoyl-pentapeptide-transferas e [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|320322453|gb|EFW78546.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. glycinea str. B076]
 gi|320330078|gb|EFW86065.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. glycinea str. race 4]
 gi|330868712|gb|EGH03421.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. aesculi str. 0893_23]
 gi|330874997|gb|EGH09146.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 360

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 165/367 (44%), Positives = 237/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S      T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLCAAIFLYTTAPSA-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELIVFSGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|302338063|ref|YP_003803269.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Spirochaeta
           smaragdinae DSM 11293]
 gi|301635248|gb|ADK80675.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Spirochaeta
           smaragdinae DSM 11293]
          Length = 359

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 166/362 (45%), Positives = 234/362 (64%), Gaps = 8/362 (2%)

Query: 4   QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNL 63
            L      +   +V +Y+TFRS+ A  +A+ I F FGP +I  L++ +    Q +R    
Sbjct: 5   LLLPLVSRFSAFNVFQYITFRSAYAAVTALFISFLFGPWLIRKLKNRKAE--QVIREDGP 62

Query: 64  PIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITT 123
             H  K  TPTMGG++IL+ L  S LLW D S+    I L+  L FGL+GF DDY+KI  
Sbjct: 63  ATHLAKSGTPTMGGLMILLSLSVSVLLWQDISNSFTWIALISLLGFGLIGFVDDYLKIFR 122

Query: 124 GDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFI 183
             + GL  + +   + ++++L +  L    N+        T +  PF ++ +LDMGLF+I
Sbjct: 123 KSSEGLQARFKFSAQVLLSLLIMVVLYINGNAHT------TLLYLPFLKNPVLDMGLFYI 176

Query: 184 PFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVG 243
           PF   ++V T+NAVNLTDGLDGLA   +++  + F+ I+Y++G    + YLQ+ ++P   
Sbjct: 177 PFGMLILVGTSNAVNLTDGLDGLASGLILLVGLPFAAISYISGRADFAAYLQIPYLPESA 236

Query: 244 ELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLF 303
           EL V+  AL GA IGFLW+N  PA IFMGDTGSL+LG  IG IA+ TK EILL+IIGG+F
Sbjct: 237 ELTVLCFALAGASIGFLWYNAHPAEIFMGDTGSLSLGGVIGVIALMTKKEILLVIIGGVF 296

Query: 304 VVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTL 363
           V+E LSVI+QV +FK+  KRVF MAP+HHHFEKKGW E ++V+RFWI+  +F ++ L TL
Sbjct: 297 VLEALSVIIQVVFFKLRGKRVFRMAPLHHHFEKKGWDETKVVVRFWILGGLFTILSLSTL 356

Query: 364 KM 365
           K+
Sbjct: 357 KI 358


>gi|15676330|ref|NP_273466.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis MC58]
 gi|121635448|ref|YP_975693.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis FAM18]
 gi|22095910|sp|Q9K0Y6|MRAY_NEIMB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|166221334|sp|A1KVL7|MRAY_NEIMF RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|7225641|gb|AAF40856.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis MC58]
 gi|120867154|emb|CAM10921.1| phopho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis FAM18]
 gi|254673381|emb|CBA08665.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis alpha275]
 gi|316984927|gb|EFV63883.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis H44/76]
 gi|319411053|emb|CBY91453.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           (UDP-MurNAc-pentapeptide phosphotransferase) [Neisseria
           meningitidis WUE 2594]
 gi|325140933|gb|EGC63440.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis CU385]
 gi|325199606|gb|ADY95061.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Neisseria
           meningitidis H44/76]
          Length = 360

 Score =  275 bits (704), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIASLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|256830374|ref|YP_003159102.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e
           [Desulfomicrobium baculatum DSM 4028]
 gi|256579550|gb|ACU90686.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e
           [Desulfomicrobium baculatum DSM 4028]
          Length = 358

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 166/368 (45%), Positives = 248/368 (67%), Gaps = 12/368 (3%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    S+   + +V +Y+TFRS  A  +A+++    GP  I  LR L+   GQ ++
Sbjct: 1   MIYHLLYPLSDQVSMLNVFRYITFRSIYAMLTALILSIIIGPICIRWLRRLK--FGQYIK 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++    ++ S  LW+D ++ ++ + +L+ L FG VGF DDYI
Sbjct: 59  EGGPD-HQAKSGTPTMGGLLFGFCMLVSVFLWSDLTNKYIWLTVLVFLGFGAVGFVDDYI 117

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GLS ++++L + I+++ AV  L+ +        E  T ++ PFF++   D+ 
Sbjct: 118 KVVRRHNDGLSPRIKLLGQLIVSVGAVSLLVSFP-------EYSTKLMVPFFKNFNPDLT 170

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F++PF  FV++  +N VNLTDGLDGLAI P ++++  F+   YVAG++ L++YLQV+++
Sbjct: 171 WFYVPFGLFVMIGASNGVNLTDGLDGLAIGPAVVSAGCFALFVYVAGHVNLANYLQVSYI 230

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGE+ V+  A++GAG+GFLWFN  PA +FMGD GSL++G  +G IA+  K E+LL+I+
Sbjct: 231 AGVGEVTVICGAMVGAGLGFLWFNAFPAQVFMGDVGSLSIGGTLGFIAILCKQELLLVIV 290

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFVVETLSVI+QVGYFK++  KR+F MAP+HHHFEKKG  E++I+IRFWI+S + AV+
Sbjct: 291 GGLFVVETLSVILQVGYFKVSGGKRIFRMAPLHHHFEKKGIHESKIIIRFWILSLLLAVM 350

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 351 ALGTLKLR 358


>gi|119944900|ref|YP_942580.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Psychromonas
           ingrahamii 37]
 gi|166221344|sp|A1SU16|MRAY_PSYIN RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|119863504|gb|ABM02981.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Psychromonas
           ingrahamii 37]
          Length = 360

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+     +   +VL Y++ R+  A  +A+     FGPK+I  L+  Q   GQ VR
Sbjct: 1   MIVWLAELLSSQFTFLNVLTYLSVRTVMAVLTALAFSLFFGPKLIRFLQKFQ--IGQIVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+IL  +  SSLLWA   + +V I+L  TL+FG +GF DDY+
Sbjct: 59  QDGPESHFSKAGTPTMGGILILGAITFSSLLWARLDNSYVWIVLFTTLAFGAIGFMDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GL  + +   + + A++    L   + +       + + V PFF+  +  +G
Sbjct: 119 KVVRKHPDGLIARWKYFWQSVTALVLAVVLFLSATT-----PAELTFVMPFFKQYMPYLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L FIP   F +V ++NAVNLTDGLDGLAI+P ++ + AF+ IAY+  ++  +HYL + ++
Sbjct: 174 LAFIPLVYFTVVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLTSHVNYAHYLYIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P   ELVV+   ++GAG+GFLWFN  PA +FMGD GSLALGA +G IAV  + EILL+I+
Sbjct: 234 PKASELVVICGTIVGAGLGFLWFNTYPAQVFMGDVGSLALGALLGVIAVLVRQEILLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVETLSVI+QVG +KM K+R+F MAPIHHH+EKKGW E ++++RFWII+ +  +IG
Sbjct: 294 GGIFVVETLSVILQVGSYKMRKRRIFRMAPIHHHYEKKGWPEPRVIVRFWIITIVLVLIG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKVR 360


>gi|315186404|gb|EFU20164.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Spirochaeta
           thermophila DSM 6578]
          Length = 360

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 232/367 (63%), Gaps = 10/367 (2%)

Query: 1   MF-IQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L    +Y+   ++ +Y+TFR++ A  +A+LI F  GP VID LR L+   G+ VR
Sbjct: 1   MLKELLYPLVKYFTPFNIFQYITFRAAYAAVTALLISFVLGPMVIDWLRRLKA--GEEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG  I+  ++ S LLW D  + +  I+LL  + FGL+GF DDY+
Sbjct: 59  EDGPSTHRAKSGTPTMGGTFIIFSILISVLLWQDLRNPYTWIMLLSVVGFGLLGFVDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL   V+ + +       V +LL        G E  T +  PFF++ +LD+ 
Sbjct: 119 KVFKKNRTGLRAGVKFIGQI------VLSLLILFFILRQGNEYTTLLYIPFFKNPVLDLS 172

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            ++IPFA   IV  +NAVNLTDGLDGLA   V++  +A +  AY++G +  S YLQ+ ++
Sbjct: 173 YWYIPFAVIFIVGYSNAVNLTDGLDGLATGLVIMVGLAVAVFAYLSGRVDFSEYLQIPYL 232

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V  +AL+GA IGFLWFN  PA + MGDTGSL+LG  +  + +  K EILL+I+
Sbjct: 233 PGSGELAVFATALVGASIGFLWFNAHPAEVMMGDTGSLSLGGTLAVLGILLKKEILLLIV 292

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+ET SVI+QV  +K+   KR+F MAP+HHHFE  GW E+++VIR WI+  +FA+I
Sbjct: 293 GGVFVLETASVILQVLSYKLRGGKRIFRMAPLHHHFELSGWPESKVVIRMWILGGLFAII 352

Query: 359 GLLTLKM 365
           GL TLK+
Sbjct: 353 GLSTLKI 359


>gi|10719754|gb|AAG22121.1| MraY [Pseudomonas aeruginosa]
          Length = 360

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 161/367 (43%), Positives = 238/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ +  Y    V +Y+T R   +  +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEYLQQFYKGFGVFQYLTLRGILSVLTALSLSLWLGPWMIRTLQIPQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++L++TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKKGTPTMGGALILTAIAISTLLWADLSNRYVWVVLVVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  I A   L   + +       +T+++ P  + + + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGIGAAVFLYMTAET-----PIETTLIVPMLKSVEIQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FF+    FVIV ++NAVNLTDGLDGLAI+P ++ + A     Y++GN+  + YL +  V
Sbjct: 174 IFFVVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVAGALGIFCYLSGNVKFAEYLLIPNV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V  +AL+GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I+
Sbjct: 234 PGAGELIVFCAALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGTIAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW + ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVMIQVASFKLTGRRVFRMAPIHHHFELKGWPDPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|238022294|ref|ZP_04602720.1| hypothetical protein GCWU000324_02201 [Kingella oralis ATCC 51147]
 gi|237866908|gb|EEP67950.1| hypothetical protein GCWU000324_02201 [Kingella oralis ATCC 51147]
          Length = 360

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 157/366 (42%), Positives = 231/366 (63%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + LA  S +    ++ +Y TFR+  A  +A+      GP  I  L +L+   GQ VR 
Sbjct: 1   MLLWLAHLSNWISALNIFQYTTFRAVMAALTALAFSLLLGPWTIRKLTALK--VGQAVRS 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLWA+ ++ ++ I+L++ L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITLSTLLWANLANPYIWILLIVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S + +++ +  +A+ A  AL F + +    I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSARFKMVWQSTVALGAGFALFFLAKNDANNIL----IVPFFKQVALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            FI      IV T+NAVNLTDGLDGLA  PV++ +      +YV G+   + YLQ+ FV 
Sbjct: 175 GFIVLTYLTIVGTSNAVNLTDGLDGLAAFPVVLVAGGLGVFSYVTGHYKFAEYLQLPFVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+ +  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVAIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIIRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+E +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVMEAISVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|325128834|gb|EGC51693.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis N1568]
          Length = 360

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 159/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G ++V  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVSVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|289647037|ref|ZP_06478380.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. aesculi str. 2250]
          Length = 360

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLGEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S      T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLCAAIFLYTTAPSA-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   ALIGAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELIVFSGALIGAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|222053878|ref|YP_002536240.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter sp.
           FRC-32]
 gi|221563167|gb|ACM19139.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter sp.
           FRC-32]
          Length = 358

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 233/367 (63%), Gaps = 10/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +  Y + +V KY+TFR+  A  +A+++ F  GP +I  L  LQ    Q +R
Sbjct: 1   MLYHLLYPLASDYRLFNVFKYLTFRTIYAMITALVVAFILGPWLIRKLEKLQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG++IL  +I  +LLWAD ++  V + L +   +G++GF+DDY 
Sbjct: 59  TDGPESHLKKQGTPTMGGVLILAAIIIPTLLWADLTNAFVWLTLFIIGGYGVIGFFDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++A      L      +         + FPFF+ +  D+G
Sbjct: 119 KVVEKNPKGLSPRQKMFWQILLATGVGIFLFVMPGFSK-------ELFFPFFKRLHPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FIPF   VIV  +NAVNLTDGLDGLAI PV I +  +    Y+AGN  LS YLQ+ +V
Sbjct: 172 ILFIPFITLVIVGASNAVNLTDGLDGLAIGPVSINAATYLLFTYIAGNARLSGYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V+  A++GAG+GFLW+N  PA +FMGD GSL+LG  +G +AV TK EILL+I+
Sbjct: 232 PGSGELAVLCGAMVGAGLGFLWYNSYPAEVFMGDVGSLSLGGGLGTLAVITKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV E LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+FI A++ 
Sbjct: 292 GGVFVTEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITFILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|320352819|ref|YP_004194158.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfobulbus
           propionicus DSM 2032]
 gi|320121321|gb|ADW16867.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfobulbus
           propionicus DSM 2032]
          Length = 359

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 165/368 (44%), Positives = 233/368 (63%), Gaps = 11/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           MF   L  F       +V +Y+TFRS     +A L+V   GP+ I  L+  Q   GQ +R
Sbjct: 1   MFYNFLYPFHTELSWLNVFRYITFRSIGCAVTAFLLVVIIGPRFIAWLQKKQ--IGQVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K   PTMGG++IL  +  SSLLW D  S  V +++ ++L FGL+G  DD  
Sbjct: 59  DDGPETHFSKKGVPTMGGVLILFAVTASSLLWTDLRSGLVWLLIGISLFFGLIGSMDDIK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI  G++ GLS + ++ ++ + A +    LL       +       +  PF +    D+G
Sbjct: 119 KIRKGNSRGLSPREKLALQVLGAAVVGIFLLLTPGYDGI-------LSIPFIKSYQPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +++PFA  VIV  +NAVNLTDGLDGLA  P++I +  +   +YVAGN +++ YLQ+ +V
Sbjct: 172 WWYLPFAVLVIVGASNAVNLTDGLDGLAAGPIVITASTYLIFSYVAGNAVVASYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+ +   A++GA +GFLWFN  PA IFMGD GSL+LG  +G +++ TK E LL+I+
Sbjct: 232 PGAGEVTIFCGAMVGACLGFLWFNCYPAEIFMGDVGSLSLGGTLGVVSIITKQEFLLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+E +SVI+QVGYFKMT  +R+FLMAP HHHFEKKGW E ++V+RFWI+S I  +I
Sbjct: 292 GGIFVMEAISVILQVGYFKMTGGRRIFLMAPFHHHFEKKGWLEPKVVVRFWIVSIILGLI 351

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 352 ALATLKLR 359


>gi|74316134|ref|YP_313874.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thiobacillus
           denitrificans ATCC 25259]
 gi|97179771|sp|Q3SMH6|MRAY_THIDA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|74055629|gb|AAZ96069.1| Phospho-N-acetylmuramoyl-pentapeptide transferase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 361

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 164/368 (44%), Positives = 229/368 (62%), Gaps = 9/368 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L     E     +V  Y+T R+  A  +A+ I F  GP VI  L +L+   GQ VR
Sbjct: 1   MLLWLFQQLGEDIRAFNVFNYLTLRAVLAALTALTISFIVGPAVIRKLTALK--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ +V + L+  L FG++G+ DD+ 
Sbjct: 59  SDGPQTHLVKAGTPTMGGALILVSVAVTTLLWADLSNDYVWLALMTLLGFGVIGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD-M 178
           K+   ++ GL+ + +   +  I ++    L   +      +   T ++ PF +       
Sbjct: 119 KVVEKNSRGLASRWKYFWQSAIGLVVAVYLWQTA-----SLPAHTELIIPFLKQATFGLS 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              FI    FVIV  +NAVNLTDGLDGLAI+P ++ + A +  AYVAGN + S YL V F
Sbjct: 174 AAAFIALTYFVIVGASNAVNLTDGLDGLAILPTVMVASALAIFAYVAGNAVFSKYLGVPF 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL +  +A+ GAG+ FLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 VPGAGELAIFCAAMAGAGLAFLWFNAYPAEVFMGDVGALALGAALGVVAVVVRQEIILFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           + G+FV+ETLSV++QV  FK+T KRVF MAPIHHH+E KGW ENQ+V+RFWIIS +  +I
Sbjct: 294 MCGVFVMETLSVMIQVASFKLTGKRVFRMAPIHHHYELKGWKENQVVVRFWIISMMLVLI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLSSLKLR 361


>gi|319897398|ref|YP_004135595.1| phospho-n-acetylmuramoyl-pentapeptide transferase [Haemophilus
           influenzae F3031]
 gi|317432904|emb|CBY81270.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Haemophilus
           influenzae F3031]
          Length = 360

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYTTVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGVLGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|68249684|ref|YP_248796.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 86-028NP]
 gi|260581816|ref|ZP_05849612.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae NT127]
 gi|81335886|sp|Q4QLG1|MRAY_HAEI8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|68057883|gb|AAX88136.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae 86-028NP]
 gi|260095009|gb|EEW78901.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae NT127]
 gi|309973398|gb|ADO96599.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase E [Haemophilus
           influenzae R2846]
          Length = 360

 Score =  275 bits (703), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+  A  +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILALLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANSYIWVCLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|21241547|ref|NP_641129.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|294627722|ref|ZP_06706304.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|325925689|ref|ZP_08187067.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           perforans 91-118]
 gi|24212034|sp|Q8PPB0|MRAY_XANAC RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|21106898|gb|AAM35665.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|292598074|gb|EFF42229.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|325543905|gb|EGD15310.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           perforans 91-118]
          Length = 361

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVKRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|325915637|ref|ZP_08177945.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538197|gb|EGD09885.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 361

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +++ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTSLFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + L FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMLCFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|126665249|ref|ZP_01736232.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinobacter sp.
           ELB17]
 gi|126630619|gb|EBA01234.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinobacter sp.
           ELB17]
          Length = 361

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 161/368 (43%), Positives = 237/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L +  S+Y+    V +Y+T R      +A+LI    GP +I  L   Q   GQ VR
Sbjct: 1   MLLWLTEILSQYFTSLTVFQYLTLRGILGTLTALLISLLVGPVMIRKLAQYQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD S+ +V I LL+TL FG +G+ DDY 
Sbjct: 59  DDGPQTHLSKAGTPTMGGALILVAIAVSTLLWADLSNRYVWITLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDI-ILDM 178
           K+   +  GLS + +   + ++   A  AL   +      +  +TS+  PFF+ + +   
Sbjct: 119 KVVERNPRGLSARWKYFWQSVVGAGAAIALFMTA-----SLPQETSLYLPFFKQVSLTMG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + FI    FVIV T+NAVNLTDGLDGLAI+P ++ + A    AY++G++  ++YL +  
Sbjct: 174 PVLFILLTYFVIVGTSNAVNLTDGLDGLAIMPTVMVAAALGIFAYLSGHVQFANYLLIPR 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+V   A++GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 LPGTGELIVFCGAIVGAGLGFLWFNTYPAQVFMGDVGALALGAALGIVAVIVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ET+SVI+QV  F++T +R+F MAP+HHHFE KGW E ++++RFW+I+ +  +I
Sbjct: 294 MGGVFVMETVSVILQVASFRLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWVITVVLVLI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLASLKLR 361


>gi|258542967|ref|YP_003188400.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256634045|dbj|BAI00021.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637105|dbj|BAI03074.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640157|dbj|BAI06119.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643214|dbj|BAI09169.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646269|dbj|BAI12217.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649322|dbj|BAI15263.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652308|dbj|BAI18242.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655366|dbj|BAI21293.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 364

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 173/370 (46%), Positives = 243/370 (65%), Gaps = 10/370 (2%)

Query: 1   MFIQLADFS---EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQP 57
           M   L   +    +  I ++L+Y+TFR+  A  +A+ I    G  +I  LR +Q   GQP
Sbjct: 1   MLYMLISHAAHDGHITILNLLRYITFRAGCACMTALGISLLLGRPLIRTLRRIQ-REGQP 59

Query: 58  VRVPNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           +R      H   K  TPTMGG++IL+ L+ S L+W D  +  V  ++L TL FG +GF D
Sbjct: 60  IRAVGPERHILEKTGTPTMGGVLILISLVISMLIWGDLENGFVWAVMLTTLGFGAIGFAD 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+   +  GLS + R+  EF I+++    L +      +  E    + FPF +D++L
Sbjct: 120 DYRKLARRNTDGLSKRARLGGEFGISLICGLWLQYL-----MPPELANHLAFPFVKDLLL 174

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
            +G+ +  FA  VI    NAVN TDGLDGLAI PV++AS+ F+ ++Y+ GN + + YLQ+
Sbjct: 175 PLGILYPVFAMIVITGFGNAVNFTDGLDGLAIGPVIVASLVFAILSYLVGNHVFADYLQI 234

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           + VPG GEL V  +AL+GAG+GFLWFN  PA +FMGDTGSL+LG  +G +AV+ KHE++L
Sbjct: 235 HAVPGTGELAVFCAALVGAGLGFLWFNAPPASVFMGDTGSLSLGGALGSLAVAIKHELVL 294

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            I+GGLFV ETLSV++QV ++K T +RVFLMAP HHHFEKKGW E++IVIRFWI+S +  
Sbjct: 295 CIVGGLFVAETLSVVIQVFWYKRTGRRVFLMAPFHHHFEKKGWAESKIVIRFWIVSIVLG 354

Query: 357 VIGLLTLKMR 366
           + GL TLK+R
Sbjct: 355 LCGLATLKLR 364


>gi|254491371|ref|ZP_05104551.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylophaga
           thiooxidans DMS010]
 gi|224463500|gb|EEF79769.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylophaga
           thiooxydans DMS010]
          Length = 357

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 158/359 (44%), Positives = 239/359 (66%), Gaps = 7/359 (1%)

Query: 8   FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA 67
            S+++   +V +Y+T R+     +A+ I    GP +I  L   Q   GQ VR      H 
Sbjct: 6   LSQFHSGFNVFQYLTLRAILGVITALGIALIIGPTMIRHLSFKQ--IGQVVRQDGPESHF 63

Query: 68  RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAG 127
            K  TPTMGG +IL+ +  S+LLWAD S+ +V ++L++TL+FG++GF DDYIK+   D  
Sbjct: 64  SKSGTPTMGGSLILVAIAVSTLLWADLSNRYVWVVLIVTLAFGVIGFVDDYIKLVRQDPR 123

Query: 128 GLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAA 187
           GL  + +   + +    A   L F +      +  +T ++ PFF++I++ +G +++    
Sbjct: 124 GLLSRYKYFWQSLFGAGAAVFLYFTA-----SVPAETQLIVPFFKEIVISLGAWYMLLTY 178

Query: 188 FVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVV 247
            V+V ++NAVNLTDGLDGLAI+P ++ + A    +YV G+   ++YLQ+ F+P  GEL V
Sbjct: 179 LVVVGSSNAVNLTDGLDGLAIMPTVMVAAALGLFSYVGGHFEFANYLQIPFIPNAGELTV 238

Query: 248 VISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVET 307
             +A++GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L+I+GG+FV+ET
Sbjct: 239 FCAAIVGAGLGFLWFNTYPAQVFMGDVGALALGAALGIVAVLVRQELVLLIMGGVFVIET 298

Query: 308 LSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           LSV++QVG +K+  KRVFLMAPIHHH+E KGW E +I++RFWII+    ++GL TLK+R
Sbjct: 299 LSVMIQVGSYKLRGKRVFLMAPIHHHYELKGWPEPRIIVRFWIITVFLVLVGLATLKIR 357


>gi|289671022|ref|ZP_06492097.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 361

 Score =  275 bits (702), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 236/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  ++A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLVAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|253997372|ref|YP_003049436.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylotenera
           mobilis JLW8]
 gi|253984051|gb|ACT48909.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylotenera
           mobilis JLW8]
          Length = 367

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 161/374 (43%), Positives = 237/374 (63%), Gaps = 15/374 (4%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA +        +V  Y+T R+  A  +A++I    GP +I  L   Q   GQ VR
Sbjct: 1   MLLELAQWLAHDIRGFNVFNYITLRAVLATLTALVISLMVGPTLIRKLT--QYKVGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD S+  V ++L  TL FG++G+ DD+ 
Sbjct: 59  DDGPQTHLIKAGTPTMGGALILVSIAISTLLWADLSNRFVWVVLFTTLGFGVIGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS K +   + ++ +     L   + +       +T+++ PFF+++++ + 
Sbjct: 119 KVVHRNPKGLSAKEKYFWQSVVGLSVAVFLQQTAAT-----PAETTLLIPFFKNLVVPLS 173

Query: 180 L-FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              FI     V+V ++NAVNLTDGLDGLAI+P ++ + A +  AYV G++  S YL + +
Sbjct: 174 GLGFIVLTYLVVVGSSNAVNLTDGLDGLAIMPTVMVAGALAIFAYVTGHLYFSRYLSIAY 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL V  +A++GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L I
Sbjct: 234 VPGAGELTVFCAAMVGAGLGFLWFNAYPAEVFMGDVGALALGAALGIVAVVVRQEVILFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKM------TKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           +GG+FV+ETLSV  QV YFK       T KR+FLMAP+HHH+E+KGW E Q+V+RFWIIS
Sbjct: 294 MGGVFVMETLSVAAQVTYFKYTKYKTGTGKRIFLMAPLHHHYEQKGWKETQVVVRFWIIS 353

Query: 353 FIFAVIGLLTLKMR 366
            +  +IGL +LK+R
Sbjct: 354 MMLVLIGLASLKIR 367


>gi|188575295|ref|YP_001912224.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|229621806|sp|B2SNZ1|MRAY_XANOP RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|188519747|gb|ACD57692.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 361

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 161/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSVI+QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVIIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|331011574|gb|EGH91630.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Pseudomonas
           syringae pv. tabaci ATCC 11528]
          Length = 360

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 236/367 (64%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA+F +  Y    V +Y++ R      +A+ +    GP +I  L+  Q   GQ VR
Sbjct: 1   MLLLLAEFLQQFYKGFAVFQYLSLRGILGVLTALTLSLCLGPWMIRTLQMRQ--IGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL  +  S+LLWAD S+ +V ++LL+TL FG +G+ DDY 
Sbjct: 59  NDGPQSHLSKSGTPTMGGALILSSIGISTLLWADLSNRYVWVVLLVTLLFGAIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L   + S      T+T+++ P  +D+ + +G
Sbjct: 119 KVIEKNSRGLPSRWKYFWQSVFGLCAAIFLYTTAPSA-----TETTLIVPMLKDVRIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + FI    FVIV ++NAVNLTDGLDGLAI+P ++   A     Y++GN+  + YL + +V
Sbjct: 174 IGFIVLTYFVIVGSSNAVNLTDGLDGLAIMPTVMVGGALGIFCYLSGNVKFAEYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL+V   AL+ AG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELIVFSGALMAAGLGFLWFNTYPAQVFMGDVGALALGAALGTMAVIVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RVF MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGVFVMETLSVVIQVASFKLTGRRVFRMAPIHHHFELKGWPEPRVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|224826075|ref|ZP_03699178.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Lutiella
           nitroferrum 2002]
 gi|224601712|gb|EEG07892.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Lutiella
           nitroferrum 2002]
          Length = 361

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 166/368 (45%), Positives = 234/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LAD+  +Y     VL YVT R+  A  +++ I    GP VI  L  L+   GQ VR
Sbjct: 1   MLLWLADWLKDYVRAFSVLNYVTLRAVMAALTSLGISLLMGPWVIRRLTELK--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD+++ +V ++L +    G +GFYDD+ 
Sbjct: 59  SDGPQSHLVKTGTPTMGGTLILLAIGVTTLLWADWTNKYVWLLLAVLFGTGAIGFYDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD-M 178
           K+   D  G+S + ++  +  IAI A   L+     T   +   T  + PFF++++    
Sbjct: 119 KVVYRDPKGISARAKMFWQSAIAIGAGVFLI-----TTAKLPASTEFIVPFFKNVVYPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + F     FVIV T+NAVNLTDGLDGLA +P ++ S A +  AYVAGNI+ + YL +  
Sbjct: 174 AIGFCILTYFVIVGTSNAVNLTDGLDGLAALPTVLVSGALAIFAYVAGNIVFARYLGLPH 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG  E+VV  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 IPGAHEVVVFCAAICGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GGLFV+E LSV++QV  FK+T KRVF MAP+HHH+E KGW E Q+V+RFWII+ +  + 
Sbjct: 294 MGGLFVMEALSVMIQVASFKLTGKRVFRMAPLHHHYELKGWKETQVVVRFWIITMMLVLA 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLTTLKLR 361


>gi|78046384|ref|YP_362559.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|97179808|sp|Q3BXF4|MRAY_XANC5 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|78034814|emb|CAJ22459.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 361

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVKRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVVSFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|148826252|ref|YP_001291005.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittEE]
 gi|166220385|sp|A5UCX1|MRAY_HAEIE RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|148716412|gb|ABQ98622.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Haemophilus
           influenzae PittEE]
          Length = 360

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++   Y    + + Y+T R+     +A+ I    GPKVI  L+ L+   GQ VR
Sbjct: 1   MLVWLAEYLVRYETAFNAISYITVRAILTLLTALFISLWIGPKVIKRLQILK--FGQEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLWA+ ++ ++ + L +   +G +GF DD+ 
Sbjct: 59  NDGPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KIT  +  GL  + +     ++A++A+  L +  + T       T +V PFF+DI+  +G
Sbjct: 119 KITRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTD-----ATRLVIPFFKDIMPQLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I  + FVIV T NAVNLTDGLDGLAI+P  + + AF+ IA+  GN+  + YL + ++
Sbjct: 174 LFYIVLSYFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
               E+VV  +A++GA +GFLWFN  PA +FMGD GSLALG  +G +A+  + E LL+I+
Sbjct: 234 KYSSEVVVFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI+QVG +K+ K+R+F MAPIHHHFE KGW E +++IRFWIIS +  ++G
Sbjct: 294 GGVFVVEALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMG 353

Query: 360 LLTLKMR 366
           L+TLK+R
Sbjct: 354 LVTLKLR 360


>gi|166710650|ref|ZP_02241857.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           oryzae pv. oryzicola BLS256]
 gi|289663639|ref|ZP_06485220.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 361

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 235/368 (63%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +   
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLA 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|58583451|ref|YP_202467.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|84625263|ref|YP_452635.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|75434165|sp|Q5GW39|MRAY_XANOR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|97179837|sp|Q2NZB6|MRAY_XANOM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|58428045|gb|AAW77082.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|84369203|dbj|BAE70361.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
          Length = 361

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 161/368 (43%), Positives = 236/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +    +  +  Y+TFR   A  +A+ +    GP VI  L   Q   GQP+R
Sbjct: 1   MLLELARWLQQLESLFGLFNYLTFRGILAALTALFLSLWMGPAVIRKLA--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S LLW D  + +V ++L + + FG +G+YDD+I
Sbjct: 59  QDGPQTHFSKAGTPTMGGSLILLTVTLSVLLWGDLRNRYVWLVLAVMICFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++ I  + A   L + ++     +    +   P F    +  +
Sbjct: 119 KIVRRDPNGLKSRWKYLLQSIFGLAAGLFLYYTAD-----VPAAITFYIPMFKSIALPLV 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN++ + YL++  
Sbjct: 174 GVSFVVIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNVVFAEYLKIPL 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL+++ SA+ GAG+GFLWFN  PA++FMGD G+L+LGA +G IAV  + E++L+I
Sbjct: 234 IPGAGELIIICSAIAGAGLGFLWFNTYPAMVFMGDIGALSLGAVLGTIAVIVRQEMVLVI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSVI+QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  +I
Sbjct: 294 MGGVFVIETLSVIIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|307718583|ref|YP_003874115.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Spirochaeta
           thermophila DSM 6192]
 gi|306532308|gb|ADN01842.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Spirochaeta
           thermophila DSM 6192]
          Length = 360

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 236/367 (64%), Gaps = 10/367 (2%)

Query: 1   MF-IQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L    +Y+   ++ +Y+TFR++ A  +A+LI F  GP VID LR L+   G+ VR
Sbjct: 1   MLKELLYPLVKYFTPFNIFQYITFRAAYAAVTALLISFVLGPMVIDWLRRLKA--GEEVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG  I+  ++ S LLW D  + +  IILL  + FGL+GF DDY+
Sbjct: 59  EDGPSTHRAKSGTPTMGGTFIIFSILISVLLWQDLRNPYTWIILLSVVGFGLLGFVDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL   V+ + + ++++L +  ++   N      E  T +  PFF++ +LD+ 
Sbjct: 119 KVFKKNRTGLRAGVKFIGQIVLSLLILFFIVRQGN------EYTTLLYIPFFKNPVLDLS 172

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            ++IPFA   IV  +NAVNLTDGLDGLA   V++  +A +  AY++G +  S YLQ+ ++
Sbjct: 173 YWYIPFAVIFIVGYSNAVNLTDGLDGLATGLVIMVGLAVAVFAYLSGRVDFSEYLQIPYL 232

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V  +AL+GA IGFLWFN  PA + MGDTGSL+LG  +  + +  K EILL+I+
Sbjct: 233 PGSGELAVFATALVGASIGFLWFNAHPAEVMMGDTGSLSLGGTLAVLGILLKKEILLLIV 292

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FVVET SVI+QV  +K+   KR+F MAP+HHHFE  GW E+++VIR WI+  +FA+I
Sbjct: 293 GGVFVVETASVILQVLSYKLRGGKRIFRMAPLHHHFELSGWPESKVVIRMWILGGLFAII 352

Query: 359 GLLTLKM 365
           GL TLK+
Sbjct: 353 GLSTLKI 359


>gi|319408827|emb|CBI82484.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Bartonella
           schoenbuchensis R1]
          Length = 356

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 200/366 (54%), Positives = 271/366 (74%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M + L+  S++    +V +Y+TFR+  A  ++ LIVF FGP +I  L+  Q   GQP+R 
Sbjct: 1   MILLLSSLSDWLPGVNVFRYITFRTVLAMLTSGLIVFLFGPSIIASLKVRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H RK  TPTMGG++IL G++ S+LLW + S+ ++ + LL+ LSFG++GFYDDY+K
Sbjct: 60  DGPQTHFRKAGTPTMGGLMILSGIVASTLLWCNLSNAYLWVSLLVMLSFGVIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EF+IA  A   ++   +           +  PF +D  +++G 
Sbjct: 120 VTKQTDKGFSGKARLGLEFLIATTACVIIVKIGSPG---------LALPFVKDYFINLGW 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPF A VIV T NAVNLTDGLDGLAIVPVM+A+++F+ IAY++GNI  + YLQ+++V 
Sbjct: 171 FFIPFTACVIVGTGNAVNLTDGLDGLAIVPVMVAALSFALIAYLSGNINFADYLQIHYVS 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V++ A++GAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L +IG
Sbjct: 231 GAGELTVLLGAVVGAGLGFLWFNAPPAAIFMGDTGSLALGGLLGVVAVATKHEIVLAVIG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFV+ETLSVI+QVG+FK+T+KRVFLMAPIHHHFEKKGWTE+Q+V+RFWIIS + A+IGL
Sbjct: 291 GLFVLETLSVIIQVGWFKLTRKRVFLMAPIHHHFEKKGWTESQVVVRFWIISIVLALIGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 STLKLR 356


>gi|292490621|ref|YP_003526060.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           halophilus Nc4]
 gi|291579216|gb|ADE13673.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosococcus
           halophilus Nc4]
          Length = 358

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 164/367 (44%), Positives = 244/367 (66%), Gaps = 10/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L D+   +    +V +Y+T R+     +A++I F  GP +I  L+    F GQPVR
Sbjct: 1   MLLYLTDYLARFDSGFYVFQYLTLRAILGVLTALIISFVVGPAMIRRLK----FVGQPVR 56

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ +V ++L++TL FG VGF DDY 
Sbjct: 57  ANGPVTHLCKAGTPTMGGALILVAIAATTLLWADLSNRYVWVVLVVTLLFGGVGFIDDYK 116

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+ + +  GLSG  +   + +IA+     L F +  +      +T ++ PFF+++ +D+G
Sbjct: 117 KLVSQNPRGLSGWRKYFWQSVIALGVALFLYFTAQVS-----AETELIVPFFKNVAVDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            +++     V+V ++NAVNLTDGLDGLA++P ++   A    AY  G+   +HYL + ++
Sbjct: 172 GYYVLLTYLVVVGSSNAVNLTDGLDGLAVLPTVLVGGALGIFAYATGHSGFAHYLAIPYI 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGELVV   AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++L I+
Sbjct: 232 PGVGELVVFCGALVGAGLGFLWFNAYPAQVFMGDMGALALGAALGILAVLVRQELVLFIM 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVET+SVI+QV  +K+T +R+F MAP+HHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 292 GGVFVVETVSVILQVVSYKLTGRRIFRMAPLHHHFEIKGWPEPRVIVRFWIITVILVLIG 351

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 352 LATLKIR 358


>gi|332969032|gb|EGK08072.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Kingella kingae
           ATCC 23330]
          Length = 359

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 162/366 (44%), Positives = 238/366 (65%), Gaps = 7/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA  S++    +V +Y TFR+  A  +A++     GP  I  L  L+    QP+R 
Sbjct: 1   MFLWLAQLSDWISALNVFQYTTFRAVMAALTALMFSLLLGPWTIRQLTKLKMR--QPIRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K + PTMGG +IL  +  S+LLW ++++ ++ I+L +TL+ G +GFYDD+ K
Sbjct: 59  DGPKTHLVK-NVPTMGGSLILATIAISTLLWGNWANAYIWILLAVTLATGALGFYDDWRK 117

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ + ++A+ A  AL F + ++   I     IV  F +  +    +
Sbjct: 118 VVHRDPNGVSAKFKMVWQSVVALGAGLALFFLAENSANNIL----IVPFFKQVALPLGVV 173

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV G+   S YLQ+ +V 
Sbjct: 174 GFLILSYLTIVGTSNAVNLTDGLDGLASFPVVLVAGGLAIFAYVTGHAQFSSYLQLPYVA 233

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 234 GANEVVIFCAAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIIRQEFVLVIMG 293

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE LSV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ I  +IGL
Sbjct: 294 GLFVVEALSVMLQVGWYKRTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIILVLIGL 353

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 354 STLKIR 359


>gi|254449027|ref|ZP_05062481.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium HTCC5015]
 gi|198261421|gb|EDY85712.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [gamma
           proteobacterium HTCC5015]
          Length = 360

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 170/367 (46%), Positives = 250/367 (68%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSE-YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + YY    V +Y+T R      +A++I F  GP++ID L  L+   GQ VR
Sbjct: 1   MLLWLAEYLQQYYSAFGVFQYLTLRGILGALTALVISFVVGPRMIDWLTHLK--VGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW+D  +  + +++L TL+FGLVG+ DDY 
Sbjct: 59  DDGPQTHLAKTGTPTMGGALILVAIAISTLLWSDLGNRQMWVVILTTLAFGLVGWVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL+ + +   + +I ++A   + +   S     + + +++ P F+++ L++G
Sbjct: 119 KVALRDPKGLASRWKYFWQSVIGLVAAFTIFYLRES-----DAEITLLVPIFKELSLNLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+PFA FVIV ++NAVNLTDGLDGLAI+P ++ + A +  AYV GNI  + YL   F+
Sbjct: 174 WFFVPFAYFVIVGSSNAVNLTDGLDGLAILPCVLIAGALAVFAYVTGNIKFADYLGFAFL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GELVV  SAL+GAG+GFLWFN  PA++FMGD G+LALGA +G +A+  + E++L I+
Sbjct: 234 HGNGELVVFCSALMGAGLGFLWFNTHPAMVFMGDVGALALGAALGVLAILVRQELVLAIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FKMT +RVF MAP+HHH+E KGW E ++V+RFWII+ I  ++G
Sbjct: 294 GGVFVIETLSVMIQVASFKMTGRRVFRMAPLHHHYELKGWPEQRVVVRFWIITVILVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|329115574|ref|ZP_08244296.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Acetobacter
           pomorum DM001]
 gi|326695002|gb|EGE46721.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Acetobacter
           pomorum DM001]
          Length = 367

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 175/370 (47%), Positives = 241/370 (65%), Gaps = 10/370 (2%)

Query: 1   MFIQLADFS---EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQP 57
           M   L   +    +  I ++L+Y+TFRS  A  +A+ I    G  +I  LR +Q   GQP
Sbjct: 4   MLYMLISHAAHDGHITILNLLRYITFRSGCACMTALGISLLLGRPLIRMLRRIQ-REGQP 62

Query: 58  VRVPNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           +R      H   K  TPTMGG +IL+ L+ S L+W D  +  V  ++L TL FG +GF D
Sbjct: 63  IRAVGPERHILEKTGTPTMGGGLILISLVISMLIWGDLENGFVWAVMLTTLGFGAIGFAD 122

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+   +  GLS + R+  EF I+++    L +      +  E    + FPF +D++L
Sbjct: 123 DYRKLARRNTDGLSKRARLGGEFGISLICGLWLQYL-----MPPELANHLAFPFVKDLLL 177

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
            MG+ +  FA  VI    NAVN TDGLDGLAI PV++AS+ F+ ++Y+ GN + + YLQ+
Sbjct: 178 PMGILYPAFAMIVITGFGNAVNFTDGLDGLAIGPVIVASLVFAILSYLVGNHVFADYLQI 237

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           + VPG GEL V  +AL+GAG+GFLWFN  PA +FMGDTGSL+LG  +G +AV+ KHE++L
Sbjct: 238 HAVPGTGELAVFCAALVGAGLGFLWFNAPPASVFMGDTGSLSLGGALGSLAVAIKHELVL 297

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFA 356
            I+GGLFV ETLSV++QV ++K T +RVFLMAP HHHFEKKGW E +IVIRFWI+S +  
Sbjct: 298 CIVGGLFVAETLSVVIQVFWYKRTGRRVFLMAPFHHHFEKKGWAEPKIVIRFWIVSIVLG 357

Query: 357 VIGLLTLKMR 366
           + GL TLK+R
Sbjct: 358 LCGLATLKLR 367


>gi|319786250|ref|YP_004145725.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317464762|gb|ADV26494.1| phospho-N-acetylmuramoyl-pentapeptide-transferase
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 363

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 164/368 (44%), Positives = 238/368 (64%), Gaps = 7/368 (1%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA + +       +  Y+TFR   A  +A+ +    GP VI  L  L+   GQP+R
Sbjct: 1   MLLELARWLQGLENFFGLFAYLTFRGILAALTALFLSLWLGPAVIRRLGQLKG--GQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ ++ S LLW D  + +V  +LL+ L FG +G+YDD+I
Sbjct: 59  KDGPQSHFSKAGTPTMGGALILITVMLSVLLWGDLRNKYVWTVLLVMLCFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           KI   D  GL  + + L++   +I  + A L+        +   T+   P F    +  +
Sbjct: 119 KIVKRDPNGLKSRWKYLLQ---SIFGLAAGLYLYLYLYADVPAATTFYVPLFKSIALPLV 175

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G+ F+  A F IV  +NAVNLTDGLDGLAI+P ++ +VA    AY +G+ + ++YLQ+  
Sbjct: 176 GISFVAIAYFWIVGFSNAVNLTDGLDGLAIMPTVLVAVALGVFAYASGHAVFANYLQIPQ 235

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GELV++ +A+ GAG+GFLWFN  PA++FMGD G+LALGA +G IAV  + E++L++
Sbjct: 236 VPGAGELVIICAAIAGAGLGFLWFNTYPAMVFMGDIGALALGAVLGTIAVIVRQELVLVV 295

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSV++QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  ++
Sbjct: 296 MGGIFVIETLSVMIQVASFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLV 355

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 356 GLATLKVR 363


>gi|117924066|ref|YP_864683.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Magnetococcus
           sp. MC-1]
 gi|166221323|sp|A0L5N4|MRAY_MAGSM RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|117607822|gb|ABK43277.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Magnetococcus
           sp. MC-1]
          Length = 362

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 173/368 (47%), Positives = 246/368 (66%), Gaps = 8/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           MF  L     + + + ++ +YVTFR+  A  +A+LI F  GP +I  L+SLQ   GQP+R
Sbjct: 1   MFYHLLYPHHDLWSVLNLFQYVTFRTIMAILTALLISFVLGPWLIRKLQSLQSS-GQPIR 59

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG +IL+ ++ ++LLWA  ++  + + L  T  FG +GF+DD 
Sbjct: 60  KDGPERHIIEKAGTPTMGGTLILVAVLVATLLWAKLTNPFIWLTLAATFGFGAIGFWDDA 119

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
            K+   +  G+ G+ R L++ +I +    AL FY N  + G      + FP F+D+++D+
Sbjct: 120 EKLIHKNPKGVPGRTRFLLQTLIVLAIALALKFYVNPEVFG-----KLAFPVFKDLVIDL 174

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G++F PFA  VIV   NAVNLTDGLDGLAI P M  + AF+ I++ AG+   ++YL + F
Sbjct: 175 GIWFFPFAVIVIVGCGNAVNLTDGLDGLAIGPAMFTAAAFALISHAAGHYNFANYLGIPF 234

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG  EL +   A++GA +GFLWFN  PA +FMGD G+LALGA +G +A+ T+HE++L I
Sbjct: 235 IPGASELAIFCGAIVGAALGFLWFNTYPAQVFMGDVGALALGAALGSVALMTQHELVLAI 294

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           IGG+FV+ETLSVI+QV  FK+  KRVF MAP+HHHFE KGW E +I++RFWIIS I A++
Sbjct: 295 IGGVFVIETLSVIIQVASFKLIGKRVFRMAPLHHHFELKGWAEPKIIVRFWIISIILALV 354

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 355 GLATLKVR 362


>gi|58038640|ref|YP_190604.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Gluconobacter
           oxydans 621H]
 gi|61213884|sp|Q5FUJ8|MRAY_GLUOX RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|58001054|gb|AAW59948.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Gluconobacter
           oxydans 621H]
          Length = 363

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 176/369 (47%), Positives = 247/369 (66%), Gaps = 9/369 (2%)

Query: 1   MFIQLADFSE--YYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPV 58
           M   L    +  +    ++  Y+TFRS  A  +A++I  A G   I  L+ +Q   GQP+
Sbjct: 1   MLFNLIAAHDTSHGGFFNLFHYLTFRSGCACLTALVISLALGNPFIAQLKRIQ-REGQPI 59

Query: 59  RVPNLPIH-ARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDD 117
           R      H   K  TPTMGG++IL+ L  ++LLWAD ++  V  ++L T +FG VGF DD
Sbjct: 60  RTVGPERHILEKAGTPTMGGMLILIALFSATLLWADLTNGFVWAVMLTTAAFGAVGFADD 119

Query: 118 YIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD 177
           Y+K++  +  G+S + R+  EF+ +++A   L      +L   E +  + FPF +D++L 
Sbjct: 120 YLKLSKRNTTGVSKRTRLGCEFLASLIAGIWL-----QSLTPPELRNMVAFPFVKDVLLP 174

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +G  F  FA   I    NAVN TDGLDGLAIVPV+IA++ F+ I+Y+ GN + + YLQ++
Sbjct: 175 LGYAFPIFAMITITGFGNAVNFTDGLDGLAIVPVVIAALVFALISYLVGNHVFADYLQLH 234

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
            VPG GEL V  +ALIGAG+GFLWFN  PA +FMGDTGSL+LG  +G +AV+TKHE++L 
Sbjct: 235 PVPGTGELAVFCAALIGAGLGFLWFNAPPAAVFMGDTGSLSLGGALGAVAVATKHELVLC 294

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           I+GG+FV ETLSV++Q+ +FK T +RVFLMAP+HHHFEKKGW E +IVIRFWI+S +  +
Sbjct: 295 IVGGVFVAETLSVVIQIFWFKRTGRRVFLMAPLHHHFEKKGWQEPKIVIRFWIVSIVLGL 354

Query: 358 IGLLTLKMR 366
            GL TLK+R
Sbjct: 355 CGLATLKLR 363


>gi|92116832|ref|YP_576561.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrobacter
           hamburgensis X14]
 gi|122418260|sp|Q1QNU6|MRAY_NITHX RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|91799726|gb|ABE62101.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrobacter
           hamburgensis X14]
          Length = 368

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 196/374 (52%), Positives = 256/374 (68%), Gaps = 14/374 (3%)

Query: 1   MFIQLADFSEYYIIT-------HVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEF 53
           MF  L D S             +V +Y+TFR+  A  +  L VF FGP +ID LR  Q  
Sbjct: 1   MFYWLIDLSNTVPGLSIFKPMLNVFRYITFRTGGAMVTGALFVFLFGPWIIDNLRLRQGK 60

Query: 54  RGQPVRVPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLV 112
            GQP+R      H   K  TPTMGG++IL GL+ S++LWA+  + +V I+L +TL FG +
Sbjct: 61  -GQPIRADGPQSHLVSKKGTPTMGGLMILSGLVVSTVLWANPLNPYVWIVLAVTLGFGFI 119

Query: 113 GFYDDYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFR 172
           GFYDDY+K+T     G +G+ R+L+      L +     Y+   L      T++V PFF+
Sbjct: 120 GFYDDYLKVTKQTHAGFAGRTRLLL-----ELLIALAACYALIRLGREPFSTALVIPFFK 174

Query: 173 DIILDMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSH 232
           D+++D+G FF+ F AF+IV   NAVNLTDGLDGLAIVPVMIA+ +F  IAY+AGN + + 
Sbjct: 175 DVVVDLGWFFLAFGAFIIVGAGNAVNLTDGLDGLAIVPVMIAAASFGMIAYLAGNAVFAD 234

Query: 233 YLQVNFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKH 292
           YLQ+N++ G GEL V+  A++GAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+ KH
Sbjct: 235 YLQINYIAGTGELAVLCGAVLGAGLGFLWFNAPPASIFMGDTGSLALGGMLGSIAVAVKH 294

Query: 293 EILLIIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           EI+L +IGGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFE+ GWTE QIVIRFWIIS
Sbjct: 295 EIVLAVIGGLFVLEAVSVIVQVASFKLTGKRIFKMAPIHHHFEQLGWTEPQIVIRFWIIS 354

Query: 353 FIFAVIGLLTLKMR 366
            + A+ GL TLK+R
Sbjct: 355 VMLALAGLSTLKLR 368


>gi|325205488|gb|ADZ00941.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Neisseria
           meningitidis M04-240196]
          Length = 360

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 160/366 (43%), Positives = 238/366 (65%), Gaps = 6/366 (1%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MF+ LA FS +    ++ +Y TFR+  A  +A+     FGP  I  L +L+   GQ VR 
Sbjct: 1   MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIHRLTALKC--GQAVRT 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG +IL  +  S+LLW ++++ ++ I+L + L+ G +GFYDD+ K
Sbjct: 59  DGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +   D  G+S K +++ +  +AI+A  AL + + ++   I     IV  F +  +    +
Sbjct: 119 VVYKDPNGVSAKFKMVWQSSVAIIAGLALFYLAANSANNIL----IVPFFKQIALPLGVV 174

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AY +G+   + YLQ+ +V 
Sbjct: 175 GFLVLSYLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVA 234

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G  E+V+  +A+ GA +GFLWFN  PA +FMGD G+LALGA +G +AV  + E +L+I+G
Sbjct: 235 GANEVVIFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMG 294

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE +SV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IGL
Sbjct: 295 GLFVVEAVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGL 354

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 355 STLKIR 360


>gi|294788569|ref|ZP_06753811.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Simonsiella
           muelleri ATCC 29453]
 gi|294483446|gb|EFG31131.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Simonsiella
           muelleri ATCC 29453]
          Length = 361

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 159/367 (43%), Positives = 236/367 (64%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++ + Y    ++++Y TFR+  A  +A+      GP  I  L +L+    Q VR
Sbjct: 1   MLLYLAEYLQQYITGFNLVQYTTFRAVMATLTALAFSLMLGPWTIRKLMALKAE--QAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S+LLW D  + ++ I+L + L+ G +GFYDD+ 
Sbjct: 59  TDGPKTHLIKNGTPTMGGVLILTAITLSTLLWGDLDNAYIWILLGVMLATGALGFYDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  G+S K +++ + ++AI A  AL + + +    I     IV  F +  +    
Sbjct: 119 KVVYKDPNGVSAKFKMVWQTLVAIGAGFALFYMAKNNTNNIL----IVPFFKQVALPLGV 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+  +   IV T+NAVNLTDGLDGLA  PV++ +   +  AYV G+   + YLQ+ FV
Sbjct: 175 VGFMLLSYLTIVGTSNAVNLTDGLDGLAAFPVVLVAGGLAIFAYVTGHAQFAQYLQLPFV 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G  E+V+  +A+ GA +GFLWFN +PA +FMGD G+LALGA +G +AV  + E +L+++
Sbjct: 235 SGANEVVIFCTAMCGACLGFLWFNAAPAQVFMGDVGALALGAALGTVAVIIRQEFILVVM 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GGLFVVE LSV++QVG++K TKKR+FLMAPIHHH+E+KGW E Q+V+RFWII+ +  +IG
Sbjct: 295 GGLFVVEALSVMLQVGWYKHTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKIR 361


>gi|326795773|ref|YP_004313593.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinomonas
           mediterranea MMB-1]
 gi|326546537|gb|ADZ91757.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Marinomonas
           mediterranea MMB-1]
          Length = 360

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 239/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L A  S+Y+    V  Y++ R+     +A+ I    G +VI  L++LQ   GQ +R
Sbjct: 1   MLLFLTAYLSKYFTFFSVFNYLSLRAILGVLTALFISLLIGKRVIRLLQTLQ--IGQAIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +I+  +  S+LLW D ++ ++ I+LL TL+FGLVG+ DDY 
Sbjct: 59  SDGPQSHLSKAGTPTMGGALIIFSISISTLLWGDLTNEYIWIVLLTTLAFGLVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  K + L + +  + A   L   +++       +TS++ P F+D+ + +G
Sbjct: 119 KVVEKNPRGLPAKWKYLWQSVFGLGAALYLYMTAST-----PAETSLIVPVFKDVAIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            FF+    FVIV T+NAVNLTDGLDGLAI+P ++   A    AY+ GNI  + YL + +V
Sbjct: 174 AFFVVLTYFVIVGTSNAVNLTDGLDGLAILPTVLVGGALGVFAYLTGNIRFADYLLIPYV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GE++V  +AL+GAG+GFLWFN  PA IFMGD G+LALGA +G IAV  + E++L I+
Sbjct: 234 EGTGEIIVFCAALVGAGLGFLWFNTYPAQIFMGDVGALALGAALGTIAVIVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  +++TK+R+F MAPIHHHFE KGW E ++++RFWII+    ++G
Sbjct: 294 GGVFVMETVSVILQVASYRLTKRRIFRMAPIHHHFELKGWAEPKVIVRFWIITVCLVLVG 353

Query: 360 LLTLKMR 366
             TLK+R
Sbjct: 354 FATLKVR 360


>gi|83648525|ref|YP_436960.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hahella
           chejuensis KCTC 2396]
 gi|97176692|sp|Q2S9Y9|MRAY_HAHCH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|83636568|gb|ABC32535.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Hahella
           chejuensis KCTC 2396]
          Length = 360

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 157/367 (42%), Positives = 240/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + +ADF  +Y+ I  V +Y+T R+     +A+LI    GP +I  L   Q   GQ VR
Sbjct: 1   MLVWVADFLAQYFSIFSVFQYLTLRAILGVLTALLISLLVGPVMIRKLSYYQ--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD ++ +V I L +TL FG +G+ DD+ 
Sbjct: 59  DDGPESHFSKAGTPTMGGALILVAIAVSTLLWADLTNRYVLITLGVTLLFGAIGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GL  + +   + +    A   L   ++     +  +T+++ PFF+DI L +G
Sbjct: 119 KVVERNPKGLPARWKYFWQSVFGFGAAVLLFKTAH-----LPQETTLIVPFFKDITLALG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           + F+    FVIV  +NAVNLTDGLDGLAI+P ++   A +  AY++G++  + YL + ++
Sbjct: 174 VGFVLLTYFVIVGGSNAVNLTDGLDGLAIMPTVMVGGALAVFAYLSGHVKFAEYLHIPYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GELV+ + AL+GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + E++  ++
Sbjct: 234 PGTGELVIFLGALVGAGLGFLWFNTYPAQVFMGDVGALALGAALGVVAVIVRQELVFFVM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  +K+T +R+F MAP+HHHFE KGW E ++++RFW+I+ +  ++G
Sbjct: 294 GGVFVMETVSVILQVASYKLTGRRIFRMAPLHHHFELKGWPEPRVIVRFWVITVVLVLVG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKIR 360


>gi|83858917|ref|ZP_00952439.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853740|gb|EAP91592.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Oceanicaulis
           alexandrii HTCC2633]
          Length = 366

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 180/369 (48%), Positives = 254/369 (68%), Gaps = 6/369 (1%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L + F++ +   +++ Y+TFR+ AA  +A ++  A G   I  LR+      QP+R
Sbjct: 1   MLYLLLSPFADQFQALNLINYLTFRTGAAMMTAFILALAIGNPFIGWLRTKGS---QPIR 57

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H   K  TPTMGG IIL G++  +L+W D S+ ++ +++ +T  FG +GF DD+
Sbjct: 58  TDGPESHIVAKAGTPTMGGFIILAGILAGTLIWGDISNPYLWVVIFVTAGFGGIGFIDDW 117

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNS-TLLGIETKTSIVFPFFRDIILD 177
            K+T     GLSGK +++++F IA +AV A+++  ++         TS+  PFF+D+++ 
Sbjct: 118 RKVTKKSTEGLSGKGKLILQFAIAAVAVVAMVYLLDTAPDTPDNFATSVAVPFFKDLMVP 177

Query: 178 MGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVN 237
           +   F  F   VIV  +NAVNLTDGLDGLAIVPVMIA+ +F FIAY  G+ + S YL +N
Sbjct: 178 LSFAFYLFGMVVIVGASNAVNLTDGLDGLAIVPVMIAAGSFGFIAYFVGSSVYSEYLFLN 237

Query: 238 FVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLI 297
           F PG GEL V+  A+IGAG+GFLW+N  PA++FMGDTGSL+LG  +G IAV+ KHEI+L+
Sbjct: 238 FTPGTGELAVICGAMIGAGLGFLWYNAPPAMVFMGDTGSLSLGGALGTIAVAVKHEIVLV 297

Query: 298 IIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           IIGGLFV+E +SV++QV  FK+T KRVF MAPIHHH+EK GW E+ IV+RFWII+F+ A+
Sbjct: 298 IIGGLFVLEAVSVMVQVASFKLTGKRVFRMAPIHHHYEKLGWAESTIVVRFWIIAFVLAL 357

Query: 358 IGLLTLKMR 366
           IGL TLK+R
Sbjct: 358 IGLSTLKLR 366


>gi|170748778|ref|YP_001755038.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           radiotolerans JCM 2831]
 gi|229621784|sp|B1LXZ8|MRAY_METRJ RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|170655300|gb|ACB24355.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylobacterium
           radiotolerans JCM 2831]
          Length = 361

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 194/356 (54%), Positives = 247/356 (69%), Gaps = 7/356 (1%)

Query: 12  YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRVPNLPIHA-RKI 70
           +   +V +Y+TFR+  A F+A L VF FGP +I  LR  Q   GQP+R      H   K 
Sbjct: 12  FTPLNVFRYITFRTGGALFTAGLFVFWFGPWIISLLRIRQGK-GQPIREDGPQTHLLTKR 70

Query: 71  DTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIKITTGDAGGLS 130
            TPTMGG++IL G + + LLWA+  + +V + L +TL FG +GFYDDY+K+T     G S
Sbjct: 71  GTPTMGGLMILAGAVVAILLWANPRNHYVWVTLTVTLGFGAIGFYDDYLKVTKQSHKGFS 130

Query: 131 GKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAFVI 190
           GK R+ +E +IA+ A   +  YS +       +  + FP F+D +L++G F+  F AFVI
Sbjct: 131 GKFRLALEAVIAMAACVTIAVYSPAA-----LQNQLAFPVFKDALLNLGWFYPLFGAFVI 185

Query: 191 VATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVVIS 250
           V   N+VN+TDGLDGLAIVPVMIA   F FIAY+ GN   + YLQVN+V   GEL VV  
Sbjct: 186 VGAGNSVNMTDGLDGLAIVPVMIACGTFGFIAYLVGNSFTASYLQVNYVRDTGELAVVCG 245

Query: 251 ALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIGGLFVVETLSV 310
           A+IGAG+GFLWFN  PA IFMGDTGSLALG  +G IAV+TKHEI+L I+GGLFV+E +SV
Sbjct: 246 AVIGAGLGFLWFNAPPAQIFMGDTGSLALGGLLGSIAVATKHEIVLAIVGGLFVLEMMSV 305

Query: 311 IMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGLLTLKMR 366
           I+QV  FK+T KRVF MAPIHHHFE+KGW E Q+VIRFWII+ I A+ GL TLK+R
Sbjct: 306 IIQVASFKLTGKRVFRMAPIHHHFEQKGWKEPQVVIRFWIIAVILAMAGLATLKLR 361


>gi|261855068|ref|YP_003262351.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Halothiobacillus
           neapolitanus c2]
 gi|261835537|gb|ACX95304.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Halothiobacillus
           neapolitanus c2]
          Length = 360

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 162/367 (44%), Positives = 241/367 (65%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L D+  ++Y    V  Y+T R+     +A+++    GP +I  L+S++   GQP+R
Sbjct: 1   MLLILFDWLAKFYSPFGVFHYLTLRTMLGVLTALIVALWIGPPMIRWLQSIKA--GQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  + LLW D ++ +V I LL T  FGL+G  DDY+
Sbjct: 59  SDGPQSHLSKAGTPTMGGALILVAIGVAVLLWGDLTNRYVWIALLTTFGFGLIGGVDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K++  ++ GL+ + +   + +IA++    L       +     +T ++ P F+D+++ +G
Sbjct: 119 KLSKRNSKGLASRYKYFWQSVIALIVAVVLF-----NMAKTPQETGLIIPLFKDVLIPLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +I    FVIV ++NAVNLTDGLDGLAI+P ++ +   S  AYV GN+  + YL + FV
Sbjct: 174 FGYILLTYFVIVGSSNAVNLTDGLDGLAIMPTVLVAGGLSVFAYVTGNVKFAVYLGIPFV 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GEL V  +A++GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I+
Sbjct: 234 PGAGELAVFCAAIVGAGLGFLWFNSYPAQVFMGDIGALALGAALGVVAVMVRQEIVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SV++QV  FK+T KR+F MAPIHHHFE KGW E ++++RFWII+ I  +IG
Sbjct: 294 GGIFVLETVSVMLQVASFKLTGKRIFRMAPIHHHFELKGWPEPKVIVRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKVR 360


>gi|251772196|gb|EES52766.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Leptospirillum
           ferrodiazotrophum]
          Length = 357

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 163/366 (44%), Positives = 232/366 (63%), Gaps = 9/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M  QL        + +V +Y+TFRS  A  +A+ +V   GP +I  LR +Q   GQ VR 
Sbjct: 1   MLYQLFYLHHSLPVLNVFRYITFRSIYATLTALALVLLLGPSLIVMLRRMQ--IGQEVRD 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL  L+ S LLWAD S+ +V ++LL  L+ G +GF DDY+K
Sbjct: 59  DGPQSHFSKKGTPTMGGVLILGALLVSVLLWADLSNKYVWMVLLSLLANGGIGFVDDYLK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +    + GLS + + L++     L     +  +            I  PF + +  D+G+
Sbjct: 119 VIKKRSKGLSARQKFLLQLGAGTLLALWYMGVTG-------GDGRIGIPFMKSLNPDLGV 171

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
             +PF   VIV +ANAVNLTDGLDGLA+ P ++  + F  I+Y+ GN + + YL+V  VP
Sbjct: 172 LLLPFLVSVIVGSANAVNLTDGLDGLAVGPTIVVGLTFVVISYLVGNHVFASYLKVLEVP 231

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL VV+ AL+GA +GFLWFN  PA +FMGDTGSLA+G  IG  A+ T+ E+LL+++G
Sbjct: 232 GAGELAVVMGALVGAALGFLWFNTYPAQMFMGDTGSLAIGGVIGMTAIVTRQELLLLLVG 291

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           G+FV E +SVI+QVG +K+ KKR+F MAP+HHHFE  G TE ++++RFWI+S + A++ L
Sbjct: 292 GIFVAEAVSVILQVGSYKLRKKRIFRMAPLHHHFELGGLTEPKVIVRFWIVSVVLALMAL 351

Query: 361 LTLKMR 366
            T K+R
Sbjct: 352 STFKLR 357


>gi|239907966|ref|YP_002954707.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Desulfovibrio
           magneticus RS-1]
 gi|259496170|sp|C4XK72|MRAY_DESMR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|239797832|dbj|BAH76821.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Desulfovibrio
           magneticus RS-1]
          Length = 358

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 169/368 (45%), Positives = 243/368 (66%), Gaps = 12/368 (3%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L      ++   +V +Y+TFRS AA  +A+++   FGPK ID LR L+   GQ + 
Sbjct: 1   MIYYLLVPLVAHFSALNVFRYITFRSIAALLTALVLSIVFGPKFIDWLRRLK--FGQYIH 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
              +  H +K  TPTMGG++I   ++ S LLW D ++ +V + L + L FG +G+ DD+ 
Sbjct: 59  ED-VAAHKQKAGTPTMGGLLIAFCIVVSVLLWGDLANEYVWMTLFVFLGFGALGYVDDHA 117

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GL+ K ++L + +++ +A   L+       L  E  T +  PFF+ +  D+G
Sbjct: 118 KVVRKQNKGLTPKQKLLGQIVVSGVAAALLV-------LDPEYSTRLAVPFFKHLTPDLG 170

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           L+++PFA  V++  +NAVNLTDGLDGLAI P+++ +  F    YVAG+  ++ YLQV  V
Sbjct: 171 LWYLPFAMLVMIGASNAVNLTDGLDGLAIGPMIVNAAMFGLFIYVAGHAQMARYLQVMPV 230

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGE+ V   AL+GAG+GFLWFN  PA IFMGD GSL+LG  +G +AV  K E+LLI++
Sbjct: 231 SGVGEVTVFCGALVGAGLGFLWFNAYPAQIFMGDVGSLSLGGALGFLAVLCKQELLLIVV 290

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGL+V ET+SVI+QVGYFKMT  KR+F MAP+HHHFE  G  E++I+IRFWI+S + A++
Sbjct: 291 GGLYVAETVSVILQVGYFKMTGGKRIFRMAPLHHHFELMGVPESKIIIRFWILSILLALV 350

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 351 GLSTLKLR 358


>gi|42524583|ref|NP_969963.1| phospho-N-acetylmuramoyl-pentapeptide- transferase [Bdellovibrio
           bacteriovorus HD100]
 gi|61214134|sp|Q6MIF7|MRAY_BDEBA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|39576792|emb|CAE80956.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Bdellovibrio
           bacteriovorus HD100]
          Length = 358

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 172/367 (46%), Positives = 246/367 (67%), Gaps = 10/367 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   ++ +   +V +Y+T R+  AFF+A L+ + +GP  I  L+      GQ +R
Sbjct: 1   MLYQWLYSMADEFSPLNVFRYITVRTFIAFFTAFLLCWIWGPHFIKRLQLK--HFGQAIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG +IL+  +   LLW D  +  V  +L++T  FGL+G+ DD++
Sbjct: 59  DDGPQTHKKKAGTPTMGGGLILLSTLIPCLLWVDMMNPLVWGVLIVTWGFGLIGYMDDWL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K++  ++ GLSGK+R+  EF+I+ L V AL+ +           T++  PF + + +D+G
Sbjct: 119 KVSKKNSKGLSGKIRLAGEFLISGLVVAALVHFHG-------LSTAVTIPFMKSVSIDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F++ FAA V+V TANAVNLTDGLDGLAIVPVMI++      AYV G+  +++YLQ+  V
Sbjct: 172 YFYVIFAALVVVGTANAVNLTDGLDGLAIVPVMISAATLGLFAYVTGHFSIANYLQIPHV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL +V + ++ AG+GFLWFN  PA +FMGD GSL+LG F+G +AV T++E+L++++
Sbjct: 232 VGAGELSIVAATIVAAGMGFLWFNAYPAQVFMGDVGSLSLGGFLGSMAVITQNELLMLVL 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FVVE LSVI QV  FKMT KRVF MAPIHHHFE  G TE +I++RFWIIS + AV+ 
Sbjct: 292 GGVFVVEALSVITQVISFKMTGKRVFKMAPIHHHFELGGLTETKIIVRFWIISILLAVLS 351

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 352 LATLKLR 358


>gi|78484910|ref|YP_390835.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Thiomicrospira
           crunogena XCL-2]
 gi|97179758|sp|Q31I62|MRAY_THICR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|78363196|gb|ABB41161.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Thiomicrospira
           crunogena XCL-2]
          Length = 361

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 241/368 (65%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M I L D+   Y     V  Y+T R+  +  +A+LI F  GP+VI  L  L+   GQ +R
Sbjct: 1   MLIYLTDYLSQYISGFSVFHYITMRTIMSVLTALLISFVIGPRVIRWLIRLK--VGQSIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
           +     H  K  TPTMGG++IL  +  + LLW + ++ ++ I  L  L FG++GF DDY 
Sbjct: 59  LDGPETHLIKTGTPTMGGVMILFSVSSAILLWGNLTNHYLLIATLTMLGFGVIGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  G+  + +   + ++ ++A   L   +      +  +T ++ P+ +D  + +G
Sbjct: 119 KVVYKDPNGMRSRTKFFWQSVVGLVAAFTLYSLAK-----VPAETQLLIPYMKDTFIYLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            + +  A FVIV T+NAVNLTDGLDGLAI+P ++ + A    AY+ G++  S YLQ+ ++
Sbjct: 174 AWTVVLAYFVIVGTSNAVNLTDGLDGLAIMPTVMVAGALGVFAYMTGHLYFSDYLQIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGEL +  +AL+GAG+GFLWFN  PA +FMGD GSLA+GA +G +AV+ + E++L I+
Sbjct: 234 PGVGELAIFCAALVGAGLGFLWFNAHPAQVFMGDVGSLAIGAALGVVAVAVRQELVLFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV ETLSVI+QVG +K+   KR+FLMAP+HHHFE+KGW E+Q+++RFWII+ +  +I
Sbjct: 294 GGIFVAETLSVILQVGSYKLRNGKRIFLMAPLHHHFEQKGWHESQVIVRFWIITILLVLI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLASLKIR 361


>gi|189423742|ref|YP_001950919.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           lovleyi SZ]
 gi|229621764|sp|B3E3Y5|MRAY_GEOLS RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|189420001|gb|ACD94399.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Geobacter
           lovleyi SZ]
          Length = 358

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 169/367 (46%), Positives = 233/367 (63%), Gaps = 10/367 (2%)

Query: 1   MFIQLA-DFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    +    I ++ KY+TFR+  A  +A+++ F  GP +I  L  LQ    Q +R
Sbjct: 1   MLFHLFYPLASNLKILNIFKYLTFRTIYAMITALIVCFVLGPWIIRKLEGLQAR--QVIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG+IIL  +I  +LLWAD +++++ + L + + +GL+GF DDY+
Sbjct: 59  TDGPESHLEKQGTPTMGGLIILTAIILPTLLWADLTNVYIWLTLFIIVGYGLIGFMDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS + ++  + ++A      L        +       +  PFF++   D+G
Sbjct: 119 KVVKKNTKGLSARQKMFWQVLLAGGVAVFLYVTPGFNEM-------LYVPFFKNFHPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           +FFIPF   VIV  +NAVNLTDGLDGLAI PV I +  +   AYVAG+  LS YLQ+  V
Sbjct: 172 IFFIPFVTLVIVGASNAVNLTDGLDGLAIGPVAINAATYMLFAYVAGHATLSAYLQIPRV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GEL V+  A++GAG+GFLWFN  PA +FMGD GSL+LG  +G IAV TK EILL+I+
Sbjct: 232 VGAGELAVICGAMVGAGLGFLWFNSYPAEVFMGDVGSLSLGGTLGVIAVLTKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSVI QVG +K   KR+F MAPIHHHFE KG  E +I++RFWII+ I A++ 
Sbjct: 292 GGIFVIEALSVIFQVGSYKYRGKRIFRMAPIHHHFELKGVAEPKIIVRFWIITIILALVA 351

Query: 360 LLTLKMR 366
           + TLKMR
Sbjct: 352 ISTLKMR 358


>gi|329890504|ref|ZP_08268847.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brevundimonas
           diminuta ATCC 11568]
 gi|328845805|gb|EGF95369.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Brevundimonas
           diminuta ATCC 11568]
          Length = 369

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 173/355 (48%), Positives = 250/355 (70%), Gaps = 5/355 (1%)

Query: 1   MFIQLADF----SEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQ 56
           MF  L  +    ++ Y + H+++Y T R + A  +AM++  A G + I+ +R+ Q   GQ
Sbjct: 1   MFYLLYLYYADIAQEYPLLHLIQYQTVRVALAMATAMIVAVAMGSRFINWIRAKQGR-GQ 59

Query: 57  PVRVPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYD 116
           P+R      H  K+ TPTMGG++IL G+  + LLW D ++ ++ I+  +T +FG++GF D
Sbjct: 60  PIRDDGPVSHLSKVGTPTMGGLMILAGIGVAVLLWGDLTNPYIWIVSGVTAAFGVLGFID 119

Query: 117 DYIKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIIL 176
           DY K+T   + GL+ K ++L + ++A++A    + +   +      +TSI FPF + ++L
Sbjct: 120 DYAKVTKQTSAGLTSKQKLLAQTVVAVIAGVLTVLWMTHSPTSPGLETSIAFPFLKAVLL 179

Query: 177 DMGLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQV 236
           ++G F++ FAAF I+  +NAVNLTDGLDGLAIVPVM+A+ AF  I+Y+ GN L + YLQV
Sbjct: 180 NIGWFYVAFAAFTIIGFSNAVNLTDGLDGLAIVPVMMAAGAFGIISYLVGNFLFADYLQV 239

Query: 237 NFVPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILL 296
           + VPG GEL +  +A+IG G+GFLW+N  PA IFMGDTGSLALG  +G +AV+TKHE++L
Sbjct: 240 HHVPGAGELAIFCAAIIGGGMGFLWYNAPPAKIFMGDTGSLALGGALGSMAVATKHELVL 299

Query: 297 IIIGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWII 351
            I+GGLFVVE  SV++QVGYFK+T KR+FLMAPIHHHFEK GW E+ +VIRFWI+
Sbjct: 300 GIVGGLFVVEAASVMIQVGYFKLTGKRIFLMAPIHHHFEKMGWPESTVVIRFWIV 354


>gi|297569453|ref|YP_003690797.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296925368|gb|ADH86178.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 359

 Score =  272 bits (694), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 165/368 (44%), Positives = 233/368 (63%), Gaps = 11/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L     EY  + +V +Y+TFR   A  +A  +V   GP  I  L+S Q   GQ VR
Sbjct: 1   MLYHLLYPLHEYLSVLNVFRYITFRCIGAALTAFFMVMLLGPPFIAWLKSRQ--IGQVVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K   PTMGG++IL+ +  ++LLW D  +L V +IL + L FG +G YDD+ 
Sbjct: 59  EDGPESHYSKSGVPTMGGMLILVAVAVTTLLWVDLGNLFVWLILAVLLWFGAIGAYDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI   ++ GL  + ++L++   A  AV +L +              + FPFF++   D+G
Sbjct: 119 KIRKNNSRGLGVRGKLLLQAAGAGAAVASLFWLPG-------FDGHLSFPFFKEFRPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            ++  FA  V+V  +NAVNLTDGLDGL   PV+I    +   +Y+AG+ +L+ YLQ+  V
Sbjct: 172 AWYCLFALLVVVGASNAVNLTDGLDGLVTGPVVITGTVYLVFSYLAGHAVLASYLQIPHV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+ V   AL+GA +GFLWFN  PA +FMGDTGSLA+GA +G +A+ TK E LL ++
Sbjct: 232 PGAGEVAVFSGALVGACLGFLWFNTFPAQVFMGDTGSLAIGAALGMVAIITKQEFLLAMV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+E LSVI+QVG++K++  KR+FLMAP HHHFEKKGW E +IV+RFWIIS +  ++
Sbjct: 292 GGIFVLEALSVILQVGFYKLSGGKRIFLMAPFHHHFEKKGWQEPKIVVRFWIISIVLGLL 351

Query: 359 GLLTLKMR 366
            + TLK+R
Sbjct: 352 AIATLKLR 359


>gi|302344209|ref|YP_003808738.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Desulfarculus
           baarsii DSM 2075]
 gi|301640822|gb|ADK86144.1| phospho-N-acetylmuramoyl-pentapeptide-transferas e [Desulfarculus
           baarsii DSM 2075]
          Length = 360

 Score =  272 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 163/368 (44%), Positives = 228/368 (61%), Gaps = 10/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L     + ++  +V +Y+TFR+  A  +A++I +A GP +I  L+ +Q   GQ +R
Sbjct: 1   MLYHLLYPLRDVFVGFNVFRYITFRTIYAAITALVIAWALGPWIIAKLQQMQ--IGQHIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL  +  S LLW D  +  + + LL+T  FG VGF DDY+
Sbjct: 59  KLGPESHQAKAGTPTMGGVLILFSVAVSVLLWGDLGNFFLWMALLVTYGFGAVGFADDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K       G        +            L+            T +  PF + ++ D+G
Sbjct: 119 KKVRKSNEGGLSSRTKFLALTAVAAVAAVALYLHP------GYSTKLAVPFLKFVVPDLG 172

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             ++P A F++V  +NAVNLTDGLDGLA  PV+IA   +  ++Y+AGNI  + YLQ+ +V
Sbjct: 173 WGYVPLAMFILVGASNAVNLTDGLDGLAAGPVLIAMGTYLILSYLAGNIKSAEYLQIFYV 232

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL V   A++GA +GFLW+N  PA +FMGDTGSL+LG  +G +A+ TKHEILL ++
Sbjct: 233 HGVGELAVFCGAVVGAVLGFLWYNAYPAQVFMGDTGSLSLGGALGVVALCTKHEILLALV 292

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFVVE LSVIMQVG+FK+T  KR+F MAP+HHHFE KGW E ++++RFWIIS I  ++
Sbjct: 293 GGLFVVEALSVIMQVGFFKLTGGKRIFRMAPLHHHFELKGWPEPKVIVRFWIISIILGLL 352

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 353 ALSTLKLR 360


>gi|253998169|ref|YP_003050232.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylovorus sp.
           SIP3-4]
 gi|313200238|ref|YP_004038896.1| phospho-n-acetylmuramoyl-pentapeptide-transferase [Methylovorus sp.
           MP688]
 gi|253984848|gb|ACT49705.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylovorus sp.
           SIP3-4]
 gi|312439554|gb|ADQ83660.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Methylovorus sp.
           MP688]
          Length = 367

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 165/374 (44%), Positives = 235/374 (62%), Gaps = 15/374 (4%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA +  +     +V  Y+T R+  A  +A+ I F  GP +I  L   Q   GQ VR
Sbjct: 1   MLLELARWLAQDVRGFNVFNYITLRAVMATLTALAISFIVGPGLIRKLT--QYKVGQSVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLWAD ++  V ++L++TL FG+VG  DD+ 
Sbjct: 59  DDGPQTHLVKAGTPTMGGALILVAIGISTLLWADLTNRFVWVVLIVTLGFGIVGMVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRD-IILDM 178
           K+   +  GLS K +   + ++   A   L   S      I  +T+++FPFF+   +   
Sbjct: 119 KVVHRNPKGLSAKEKYFWQSLLGFGAAIYLWHTST-----IPAETTLIFPFFKTVTVPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              FI     VIV ++NAVNLTDGLDGLAI+P ++ + A +  AY AG++  S YL + +
Sbjct: 174 AASFIVLTYLVIVGSSNAVNLTDGLDGLAILPTVLVAGALAIFAYAAGHLYFSKYLGIPY 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG GEL V  +A+ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L I
Sbjct: 234 IPGAGELAVFCTAMAGAGLGFLWFNAYPAEVFMGDVGALALGAALGVVAVIVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKM------TKKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           +GG+FV+ETLSV  QV YFK       T +R+FLMAP+HHH+E+KGW E Q+V+RFWII+
Sbjct: 294 MGGVFVMETLSVAAQVTYFKYTKKRYGTGRRIFLMAPLHHHYEQKGWKETQVVVRFWIIT 353

Query: 353 FIFAVIGLLTLKMR 366
            +  ++GL TLK+R
Sbjct: 354 MMLVLVGLSTLKLR 367


>gi|317154471|ref|YP_004122519.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944722|gb|ADU63773.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 358

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 167/368 (45%), Positives = 239/368 (64%), Gaps = 12/368 (3%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   S    I +V +Y+TFRS  A  +A++I   FGP +I  L+ ++   GQ +R
Sbjct: 1   MIYNLLVPLSSDVGIFNVFRYITFRSVWALLTALIISIIFGPAMIRWLQRIKC--GQYIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+I++ +  S+LLWAD ++++V + LL+   FG VGF DDY+
Sbjct: 59  EDGPK-HQAKQGTPTMGGIMIIIAVCASTLLWADLANVYVWLTLLVFTGFGAVGFADDYL 117

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GLS K +   +  +A  A+  L+     +       T +  PFF++   D+G
Sbjct: 118 KVVKRQNKGLSAKAKFFFQCFVAAAAIALLIQEPAYS-------TQLAVPFFKNFNPDLG 170

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F++PFA  V+V  +NAVNLTDGLDGLAI P+++A   F+   YV+G+  ++ YL V  V
Sbjct: 171 WFYLPFALVVMVGASNAVNLTDGLDGLAIGPMVVAMACFAIFIYVSGHARMADYLAVPNV 230

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G+GE+ V   A++GAG+GFLWFN  PA +FMGD GSL+LG  +G +AV  K E+LL I+
Sbjct: 231 VGIGEVTVFCGAMVGAGLGFLWFNAHPAQVFMGDVGSLSLGGALGFVAVLAKQELLLAIV 290

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV ETLSVI+QVGYFK++  KR+F MAP+HHHFE KG  E++I++RFWI+S + A++
Sbjct: 291 GGVFVFETLSVILQVGYFKLSGGKRIFKMAPLHHHFELKGIPESKIIVRFWILSILMALM 350

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 351 ALSTLKLR 358


>gi|308271437|emb|CBX28045.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [uncultured
           Desulfobacterium sp.]
          Length = 359

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 173/368 (47%), Positives = 245/368 (66%), Gaps = 11/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L       Y + +V +Y+TFR++ A  +A LI F  GP VI  L  LQ   GQ +R
Sbjct: 1   MLYHLLYPLHSTYSVFNVFRYITFRTTYAVLTAFLICFLLGPWVIRKLAQLQ--IGQHIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG +I+  L  ++L+W++ S+ +V I+LL+T+ + L+GF DDY+
Sbjct: 59  EEGPKGHQKKTGTPTMGGTLIVFSLTVTTLMWSNLSNYYVWILLLVTIGYALIGFADDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K       GLS + + +++ ++A++    +    +         ++++FPF ++   D+G
Sbjct: 119 KQVKKQNMGLSPRNKFILQSLLALIVSTLIYICPD-------FSSTLIFPFLKNFSPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I FA+FVIV T+NAVNLTDGLDGLAI   +I +VA+   AYVAGNI ++ YLQ+ +V
Sbjct: 172 FFYIFFASFVIVGTSNAVNLTDGLDGLAIGSTIIVAVAYMIFAYVAGNIKIAEYLQIPYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GE+ +   +LIGAG+GFLWFN  PA IFMGD GSL+LG  IG +A+ TK EILL+I+
Sbjct: 232 AGSGEVAIFCGSLIGAGLGFLWFNAYPAEIFMGDVGSLSLGGIIGTVALITKQEILLVIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+E LSVI QVG+FK+T  KR+F MAP+HHHFE KGW E +++IRFWII+    +I
Sbjct: 292 GGLFVIEALSVIFQVGFFKLTKGKRMFRMAPLHHHFELKGWPEPKVIIRFWIIAIALLLI 351

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 352 SLSTLKLR 359


>gi|303246304|ref|ZP_07332584.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           fructosovorans JJ]
 gi|302492367|gb|EFL52239.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           fructosovorans JJ]
          Length = 358

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 169/368 (45%), Positives = 242/368 (65%), Gaps = 12/368 (3%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    + +    +V +Y+TFRS AA  +A+++   FGP+ I  L  L+   GQ + 
Sbjct: 1   MIYYLLVPLAAHLSALNVFRYITFRSIAALLTALVLSIVFGPRFIRGLTRLK--YGQYIH 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
              +  H RK  TPTMGG++I   ++ S LLW D ++ +V + + + L FG++GF DD+ 
Sbjct: 59  ED-VAAHQRKAGTPTMGGLLIAFCILVSVLLWGDLANTYVWMTIFVYLGFGVLGFIDDHA 117

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GL+ + ++L + I++ LA   LL          E  T +  PFF+ I  D+G
Sbjct: 118 KVVKKRNKGLTPRAKLLGQLIVSGLAAAVLL-------SDPEYSTRLAVPFFKHINPDLG 170

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+ PFA  V+VA +NAVNLTDGLDGLAI P+++ +  F+   YVAG+  ++ YLQV  V
Sbjct: 171 LFYFPFAMLVMVAASNAVNLTDGLDGLAIGPMIVNAAMFALFVYVAGHAQMARYLQVMPV 230

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGE+ V   A++GAG+GFLWFN  PA +FMGD GSL+LG  +G +AV  K E+LL+++
Sbjct: 231 SGVGEVTVFCGAMVGAGLGFLWFNAYPAQVFMGDVGSLSLGGALGFLAVLCKQELLLMVV 290

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGL+V ET+SVI+QVGYFKMT  KR+F MAP+HHHFE  G  E++I+IRFWI+S + A++
Sbjct: 291 GGLYVAETVSVILQVGYFKMTGGKRIFRMAPLHHHFELMGVPESKIIIRFWILSILLALV 350

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 351 GLSTLKLR 358


>gi|240850895|ref|YP_002972295.1| phospho-n-acetylmuramoyl-pentapeptide-transferase [Bartonella
           grahamii as4aup]
 gi|240268018|gb|ACS51606.1| phospho-n-acetylmuramoyl-pentapeptide-transferase [Bartonella
           grahamii as4aup]
          Length = 356

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 201/366 (54%), Positives = 272/366 (74%), Gaps = 10/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M +  + FS++    +V +Y+TFR+ AA  ++ LIVF FGP +I  L+  Q   GQP+R 
Sbjct: 1   MMLFFSSFSDWLPGVNVFRYITFRTIAAMLTSGLIVFLFGPSIIASLKLRQGK-GQPIRA 59

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H +K  TPTMGG++IL G++ S+ LW + S+++  + LL+ LSFG +GFYDDY+K
Sbjct: 60  DGPQTHFKKAGTPTMGGLMILTGIVVSAFLWCNLSNIYFWVSLLVMLSFGAIGFYDDYLK 119

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +T     G SGK R+ +EF +A +A   +L   +S             PF +D ++++G 
Sbjct: 120 VTKQTDKGFSGKARLSLEFCVAAIAAFVILQIGSSG---------FALPFLKDYLINLGW 170

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPF+AFVIVAT NAVNLTDGLDGLAIVPVM+A+++F+ IAY++GN+  + YLQ+++V 
Sbjct: 171 FFIPFSAFVIVATGNAVNLTDGLDGLAIVPVMVAALSFALIAYLSGNMNFADYLQIHYVS 230

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL V++ A++GAG+GFLWFN  PA IFMGDTGSLALG  +G +AV+TKHEI+L +IG
Sbjct: 231 GAGELAVLLGAVVGAGLGFLWFNAPPAAIFMGDTGSLALGGLLGTVAVATKHEIVLALIG 290

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVE  SV++QVGYFK+T+KRVFLMAPIHHHFEKKGWTE+Q+VIRFWIIS + A+IGL
Sbjct: 291 GLFVVEAFSVVIQVGYFKLTRKRVFLMAPIHHHFEKKGWTESQVVIRFWIISIVLALIGL 350

Query: 361 LTLKMR 366
            TLK+R
Sbjct: 351 STLKLR 356


>gi|71909113|ref|YP_286700.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Dechloromonas
           aromatica RCB]
 gi|97176658|sp|Q47AA1|MRAY_DECAR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|71848734|gb|AAZ48230.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Dechloromonas
           aromatica RCB]
          Length = 367

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 164/374 (43%), Positives = 243/374 (64%), Gaps = 15/374 (4%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA +  +     +V  Y+T R+  A  +A+L+  A GP VI  L + +   GQ VR
Sbjct: 1   MLLALAQWLAQDVRFFNVFNYITLRAVLAAMTALLLSLAAGPAVIRWLAAKK--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG++IL+ +  ++LLW D ++ +V  +L++TL +G+VG+YDD+ 
Sbjct: 59  NDGPQTHLVKSGTPTMGGVLILIAIGITTLLWGDLTNKYVWTVLVVTLGYGIVGWYDDWK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD-M 178
           K+   D  GL+ + +   + ++ I A   + F + S       +T ++ PFF+ +     
Sbjct: 119 KVVYRDPNGLASRWKFFWQSVLGIGAALFIAFSAKS-----PAQTELIIPFFKTMAYPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + FI    FVIV T+NAVNLTDGLDGLAI+P ++ + AF+ IAYV G+ + + YL + +
Sbjct: 174 VIGFITLTYFVIVGTSNAVNLTDGLDGLAIMPTVMIAAAFALIAYVTGHAVYAKYLLIPY 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           VPG GEL + + A+ GAG+GFLWFN  PA +FMGD G+LALGA +G +AV  + EI+L+I
Sbjct: 234 VPGAGELCIFLGAIAGAGLGFLWFNAYPAEVFMGDVGALALGAALGTVAVIVRQEIVLLI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMT------KKRVFLMAPIHHHFEKKGWTENQIVIRFWIIS 352
           +GG+FV+ETLSV++QVGYFK T       +R+  MAP+HHHFE+ GW E Q+V+RFWII+
Sbjct: 294 MGGVFVIETLSVMLQVGYFKYTKRKYGEGRRILRMAPLHHHFEQTGWKETQVVVRFWIIT 353

Query: 353 FIFAVIGLLTLKMR 366
            +  +IGL TLK+R
Sbjct: 354 IMLVLIGLSTLKLR 367


>gi|157825982|ref|YP_001493702.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia akari
           str. Hartford]
 gi|157799940|gb|ABV75194.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia akari
           str. Hartford]
          Length = 381

 Score =  270 bits (690), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 177/368 (48%), Positives = 248/368 (67%), Gaps = 9/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L        I ++  Y+TFRS  A    + + F  GP +I  LRSLQ   GQP+R
Sbjct: 21  MLYNLLLPHIHNSHIANLFHYITFRSGLAIIITLSLSFIMGPILIKFLRSLQ-KNGQPIR 79

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+I++    S+LL AD ++ ++ I L   +SFG++GF DDY 
Sbjct: 80  SDGPESHQTKAGTPTMGGIMIILSSGLSTLLLADLTNQYIWITLFGFISFGIIGFMDDYA 139

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+ GK +++++ II+++    L +   +          +  PFF+++ LD+G
Sbjct: 140 KVTKNNHYGVRGKSKLVLQGIISLIICVLLEYLDKNPSHL------LNVPFFKNLNLDLG 193

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I FA FVIV ++NAVNLTDGLDGLA VP+   + +F+ I+Y+ GN++ SHYLQ+ ++
Sbjct: 194 YFYIVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNLIYSHYLQLTYI 253

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL V+ + L+G+ +GFLWFN  PA +FMGDTGSL+LG  +G I+V TKHEI+L I+
Sbjct: 254 PNTGELTVLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIISVITKHEIVLAIV 313

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ET SVI+QV YFK T  KR+F MAP+HHHFEK GW E+++VIRFWIIS IFA+I
Sbjct: 314 GGLFVIETASVILQVYYFKATQGKRIFKMAPLHHHFEKHGWAESKVVIRFWIISVIFALI 373

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 374 GLSSLKLR 381


>gi|119478639|ref|ZP_01618542.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine gamma
           proteobacterium HTCC2143]
 gi|119448416|gb|EAW29667.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [marine gamma
           proteobacterium HTCC2143]
          Length = 360

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 168/367 (45%), Positives = 231/367 (62%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LADF   Y     V  Y+T R      +A+ I    GP +I  L   Q   GQ +R
Sbjct: 1   MLLLLADFLSQYIGAFQVFNYLTIRGILGVLTALAICLTCGPYMIRRLNYHQ--IGQSIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +I S+LLWAD  + +V  +L +T+ FG VG+ DDY 
Sbjct: 59  DDGPESHLSKSGTPTMGGALILVAIIFSTLLWADLQNAYVWTVLAVTIIFGAVGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   ++ GL  + +   + +  + A   L      +      +T +  PF +D  LD+G
Sbjct: 119 KVIEKNSRGLPARWKYFWQSVGGMGAAIFLY-----SNASTAAETQLFLPFLKDFALDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
           LF+I    FVIV ++NAVNLTDGLDGLAI+P ++   A   IAY+ GN+  S+YL + ++
Sbjct: 174 LFYIVLTYFVIVGSSNAVNLTDGLDGLAIMPSVMVGAALGIIAYLVGNVEFSNYLFIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            G GELVV   AL GAG+GFLWFN  PA IFMGD G+LALGA +G +AV T+HEI+  I+
Sbjct: 234 AGTGELVVFCGALAGAGLGFLWFNTYPAQIFMGDVGALALGAALGTVAVITRHEIVFFIM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ET+SVI+QV  FK+T +R+F MAPIHHHFE KGW E ++++RFWII+ +  + G
Sbjct: 294 GGIFVLETVSVILQVASFKLTGRRIFRMAPIHHHFELKGWPEPRVIVRFWIITVMLVLFG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|283850517|ref|ZP_06367805.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           sp. FW1012B]
 gi|283574088|gb|EFC22060.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           sp. FW1012B]
          Length = 358

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 172/368 (46%), Positives = 241/368 (65%), Gaps = 12/368 (3%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L    + +    +V +Y+TFRS AA  +A+++   FGP++I  L  L+   GQ + 
Sbjct: 1   MIYYLLVPLAAHLSALNVFRYITFRSIAALLTALVLSIVFGPRMIRALTRLK--FGQYIH 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
              +  H RK  TPTMGGI+I   ++ S LLW D ++ +V + + + L FG +GF DDY 
Sbjct: 59  ED-VEAHRRKAGTPTMGGILIAFCIVTSVLLWGDLANEYVWMTIFVYLGFGALGFVDDYA 117

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GLS + ++L + +++ +A   LL          E  T +  PFF+ I  D+G
Sbjct: 118 KVVKKRNKGLSARSKLLGQLLVSGVAAAVLL-------SDPEYSTRLALPFFKHITPDLG 170

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+ PFA  V++A +NAVNLTDGLDGLAI P+++ +  FS   YVAG+  ++ YLQV  V
Sbjct: 171 WFYFPFAMLVMIAASNAVNLTDGLDGLAIGPMIVNAAMFSLFVYVAGHAQMARYLQVVPV 230

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGE+ V   A++GAG+GFLWFN  PA IFMGD GSL+LG  +G +AV  K E+LLII+
Sbjct: 231 SGVGEVTVFCGAMVGAGLGFLWFNAYPAQIFMGDVGSLSLGGALGFLAVLCKQELLLIIV 290

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGL+V ET+SVI+QVGYFKMT  KR+F MAP+HHHFE  G  E++I+IRFWI+S + A++
Sbjct: 291 GGLYVAETVSVILQVGYFKMTGGKRIFRMAPLHHHFELMGVPESKIIIRFWILSILLALV 350

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 351 GLSTLKLR 358


>gi|15837397|ref|NP_298085.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Xylella
           fastidiosa 9a5c]
 gi|22095914|sp|Q9PF83|MRAY_XYLFA RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|9105691|gb|AAF83605.1|AE003919_16 phospho-N-acetylmuramoyl-pentapeptide-transferase [Xylella
           fastidiosa 9a5c]
          Length = 361

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 160/368 (43%), Positives = 236/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLADFSEYY-IITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M  +LA + + +  +  +  Y+TFRS  A  +A+ +    GP +I  L   Q   GQP+R
Sbjct: 1   MLFELARWLQQFESLFGLFNYLTFRSILAALTALFLSLWIGPVLIQKLS--QFKGGQPIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                +H  K  TPTMGG +ILM +  S LLW D  + +V ++L++ L+FG +G+YDD+I
Sbjct: 59  QDGPKMHFSKAGTPTMGGSLILMTVTLSVLLWGDLRNRYVWLVLVVMLAFGAIGWYDDWI 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFP-FFRDIILDM 178
           K+   D  GL  + + L++ I  + A   L F ++     +    +   P F    +   
Sbjct: 119 KLARRDPNGLKSRWKYLLQSIFGLAAGLFLYFTAD-----VPAAVTFYIPMFKSIALPLT 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
            + F+    F IV  +NAVNLTDGLDGLAI+P ++ + A    AY +GN L S YL++  
Sbjct: 174 SISFVAITYFWIVGFSNAVNLTDGLDGLAIMPTVLVACALGVFAYASGNTLFSSYLKIPT 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +PG G+L+++ +A+ GAG+GFLWFN  PA++FMGD G+LALGA +G IAV  + E++L++
Sbjct: 234 IPGAGDLIIICAAIAGAGLGFLWFNAYPAMVFMGDIGALALGAVLGTIAVIVRQELVLVV 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FV+ETLSVI+QV  FK+T KRVF MAPIHHHFE KGW E ++++RFWIIS +  ++
Sbjct: 294 MGGVFVIETLSVIIQVTSFKLTGKRVFRMAPIHHHFELKGWPEPRVIVRFWIISVVLVLV 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKVR 361


>gi|254781100|ref|YP_003065513.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040777|gb|ACT57573.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 366

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 366/366 (100%), Positives = 366/366 (100%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV
Sbjct: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
           PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK
Sbjct: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL
Sbjct: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
           FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP
Sbjct: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG
Sbjct: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL
Sbjct: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360

Query: 361 LTLKMR 366
           LTLKMR
Sbjct: 361 LTLKMR 366


>gi|328952333|ref|YP_004369667.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfobacca
           acetoxidans DSM 11109]
 gi|328452657|gb|AEB08486.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfobacca
           acetoxidans DSM 11109]
          Length = 359

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 177/368 (48%), Positives = 246/368 (66%), Gaps = 11/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L       +   +V +Y+TFRS  A  +A++I F  GP VI  LR  Q   GQ +R
Sbjct: 1   MLYHLLYPLKTVFGGFNVFRYLTFRSIYAILTALIIAFILGPWVIRQLRRHQ--IGQYIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+I+   IGS+LLWAD S+ +V +++ +TLSFG +GF DDY+
Sbjct: 59  EDGPASHLCKAGTPTMGGILIIAATIGSTLLWADLSNTYVWLLIFVTLSFGGIGFLDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+      GLSG+ +++ + I+A +    L             +T++  PFF+++  D+G
Sbjct: 119 KVIKKHNRGLSGRGKLVSQIIVAAVVAVWLYSLPG-------FETTLTLPFFKELNPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+P A FVIV  ANAVNLTDGLDGLAI PV IA+  F  +AY++GNI ++ YLQ+++V
Sbjct: 172 WGFLPLAVFVIVGAANAVNLTDGLDGLAIGPVTIAAAFFMILAYLSGNIKIADYLQISYV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGEL +   AL+G+GIGFLW+N  PA +FMGD G+LALG  +G IA++ K EILL I+
Sbjct: 232 RGVGELAIFCGALVGSGIGFLWYNSYPAEVFMGDVGALALGGILGTIAIAIKQEILLAIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FVVE LSVI+QV +FK+T  +R+F MAPIHHHFE KGW E ++++RFWI++ I  ++
Sbjct: 292 GGIFVVEALSVILQVSFFKVTNGRRIFRMAPIHHHFELKGWAEPKVIVRFWILAIILGLL 351

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 352 ALSTLKLR 359


>gi|206602135|gb|EDZ38617.1| Phospho-N-acetylmuramoyl-pentapeptide- transferase [Leptospirillum
           sp. Group II '5-way CG']
          Length = 357

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 159/366 (43%), Positives = 235/366 (64%), Gaps = 9/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M  QL    + Y   ++ +Y+TFR+  A  ++M+++   GP +I  LR LQ   GQ VR 
Sbjct: 1   MLYQLFHLHQEYPFFNIFRYITFRAIYATVTSMVLLLILGPWLIQWLRRLQ--IGQEVRD 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL+G+  S+LLWAD S  +V ++L    + G++GF DDY+K
Sbjct: 59  DGPKSHLAKQGTPTMGGVLILLGIFVSTLLWADLSDPYVWMVLGALGANGVIGFLDDYLK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +    + GL    +  ++ +  +L     L+ +++        T IV PF +++   +G+
Sbjct: 119 VLKKQSKGLLAWQKFTLQILSGVLLSLWYLWVNHAD-------TRIVVPFLKELNPALGI 171

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  V+  TANAVNLTDGLDGLA+ PV++ S+AF  I YV G+ L + YL +  VP
Sbjct: 172 LFLPFAVGVLSGTANAVNLTDGLDGLAVGPVIVVSLAFMGITYVTGHELFARYLAIIPVP 231

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +V  A++G+ +GFLWFN  PA IFMGD G+LALG  IG +A+ T+ E+LL+++G
Sbjct: 232 GAGELAIVCGAMVGSSLGFLWFNAYPASIFMGDVGALALGGGIGMMAIVTRQELLLLLLG 291

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           G+FV E +SVI QV  +K+ KKRV  MAP+HHH+E  G  E ++++RFWI+S I A++ L
Sbjct: 292 GIFVAEAVSVIAQVLSYKIRKKRVLRMAPLHHHYELGGVEEPKVIVRFWIVSIILALLSL 351

Query: 361 LTLKMR 366
            T K+R
Sbjct: 352 STFKLR 357


>gi|71082736|ref|YP_265455.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91762842|ref|ZP_01264807.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|97176841|sp|Q4FPK2|MRAY_PELUB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|71061849|gb|AAZ20852.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|91718644|gb|EAS85294.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 361

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 183/368 (49%), Positives = 251/368 (68%), Gaps = 9/368 (2%)

Query: 1   MFIQL-ADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   L     + Y   +V KY+TFR+  + F++M +V   G   I    + +     P+R
Sbjct: 1   MLYSLITQLIDQYSFLNVFKYLTFRTGLSMFTSMFVVLLIGTPFIKFFSARKILN--PIR 58

Query: 60  VPNLPIHA-RKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDY 118
                 H  +KI TPTMGG++IL+GL    LLW D S+ H+  +L +   FGL+G YDDY
Sbjct: 59  DDGPTEHIVKKIGTPTMGGVLILLGLFSGILLWGDLSNYHIWFLLFIVSGFGLLGAYDDY 118

Query: 119 IKITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDM 178
            KI   ++ G+S K +I+ + +IAI+ +  L   S +T L     T++ FPFF+++I+++
Sbjct: 119 KKIKFKNSSGVSFKFKIISQILIAIVGIYGLTQLSQNTEL-----TNLYFPFFKNLIINL 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
           G FFIPF+ F+IV ++NAVNLTDGLDGLA VPV++ +  F+FI+YV GNI+ S YL + +
Sbjct: 174 GWFFIPFSIFIIVGSSNAVNLTDGLDGLATVPVILVAACFAFISYVTGNIVFSEYLNIPY 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           + G+GE+ V   ++IGA +GFLWFN  PA IFMGDTGSLALG  +G I + TKHEI+L I
Sbjct: 234 LEGMGEVSVFCGSIIGACLGFLWFNAPPAKIFMGDTGSLALGGSLGAIGIITKHEIVLAI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
            GGLFV+E +SVI+QV  FK+T KR+F MAPIHHHFEKKGW E+ +VIRFWIIS I A+I
Sbjct: 294 TGGLFVLEAVSVIIQVFSFKLTGKRIFRMAPIHHHFEKKGWAESTVVIRFWIISIILAMI 353

Query: 359 GLLTLKMR 366
           GL TLK+R
Sbjct: 354 GLATLKLR 361


>gi|242278170|ref|YP_002990299.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           salexigens DSM 2638]
 gi|259496168|sp|C6BYG9|MRAY_DESAD RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|242121064|gb|ACS78760.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Desulfovibrio
           salexigens DSM 2638]
          Length = 359

 Score =  269 bits (687), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 165/368 (44%), Positives = 242/368 (65%), Gaps = 11/368 (2%)

Query: 1   MFIQ-LADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   S      +V +Y+TFRS  A  +A++I    GP ++  L+ ++   GQ ++
Sbjct: 1   MIYHFLVPLSAQIGALNVFRYITFRSIYALLTALVITIVLGPMMMRWLQKIKC--GQYIQ 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                +H  K  TPTMGG+++  G++ S+LLWAD ++++V + +L+   FGLVGF DDY 
Sbjct: 59  DEVGELHKCKAGTPTMGGLLLGFGVLVSTLLWADLTNIYVWLTMLVFAGFGLVGFVDDYT 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           KI      G+S K ++L + ++A  AV  L+     +       T +  PFF++   D+G
Sbjct: 119 KIRGKQNKGISPKAKLLGQLLVAGTAVGLLIMQPAYS-------TELAVPFFKNFTPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             ++PFA  V++  +N VNLTDGLDGLAI P + ++  ++F  Y+AG+I +++YL V  V
Sbjct: 172 WMYLPFALLVMIGASNGVNLTDGLDGLAIGPSITSATCYAFFIYIAGHIGMANYLNVPHV 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGE+ V   AL+GAG+GFLW+N  PA +FMGD GSL++G  +G IAV  K E+LLII+
Sbjct: 232 PGVGEVTVFCGALVGAGLGFLWYNAYPAQLFMGDVGSLSIGGVLGFIAVLCKQELLLIIV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV ET+SVIMQV YFK++  KR+F MAP+HHHFE KG  E++IVIRFW+IS + A++
Sbjct: 292 GGVFVFETISVIMQVSYFKVSGGKRIFRMAPLHHHFEHKGVPESKIVIRFWVISILMALM 351

Query: 359 GLLTLKMR 366
            L TLK+R
Sbjct: 352 ALSTLKIR 359


>gi|124515891|gb|EAY57400.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Leptospirillum
           rubarum]
          Length = 357

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 159/366 (43%), Positives = 235/366 (64%), Gaps = 9/366 (2%)

Query: 1   MFIQLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVRV 60
           M  QL    + Y   ++ +Y+TFR+  A  ++M+++   GP +I  LR LQ   GQ VR 
Sbjct: 1   MLYQLFHLHQEYPFFNIFRYITFRAIYATVTSMVLLLVLGPWLIQWLRRLQ--IGQEVRD 58

Query: 61  PNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYIK 120
                H  K  TPTMGG++IL+G+  S+LLWAD S  +V ++L    + G++GF DDY+K
Sbjct: 59  DGPKSHLAKQGTPTMGGVLILLGIFVSTLLWADLSDPYVWMVLGALGANGVIGFLDDYLK 118

Query: 121 ITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGL 180
           +    + GL    +  ++ +  +L     L+ +++        T IV PF +++   +G+
Sbjct: 119 VLKKQSKGLLAWQKFTLQILSGVLLSMWYLWVNHAD-------TRIVVPFLKELNPALGI 171

Query: 181 FFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVP 240
            F+PFA  V+  TANAVNLTDGLDGLA+ PV++ S+AF  I YV G+ L + YL +  VP
Sbjct: 172 LFLPFAVGVLSGTANAVNLTDGLDGLAVGPVIVVSLAFMGITYVTGHELFARYLTIIPVP 231

Query: 241 GVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIIIG 300
           G GEL +V  A++G+ +GFLWFN  PA IFMGD G+LALG  IG +A+ T+ E+LL+++G
Sbjct: 232 GAGELAIVCGAMVGSSLGFLWFNAYPASIFMGDVGALALGGGIGMMAIVTRQELLLLLLG 291

Query: 301 GLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIGL 360
           G+FV E +SVI QV  +K+ KKRV  MAP+HHH+E  G  E ++++RFWI+S I A++ L
Sbjct: 292 GIFVAEAVSVIAQVLSYKIRKKRVLRMAPLHHHYELGGVEEPKVIVRFWIVSIILALLSL 351

Query: 361 LTLKMR 366
            T K+R
Sbjct: 352 STFKLR 357


>gi|291288106|ref|YP_003504922.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290885266|gb|ADD68966.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 361

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 159/368 (43%), Positives = 231/368 (62%), Gaps = 9/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L   +++  I +V +Y+TFR++ A  +A+LI    GP  I  L+ +        +
Sbjct: 1   MLYNLLVPLADHLSILNVFRYITFRTAYAAITALLITLLIGPYAIRRLQEMSFNM--KSK 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGIII+   + S LLWAD  + ++ I L +  ++G +GF DDY 
Sbjct: 59  GYEPDRHKEKEGTPTMGGIIIVGSAVFSCLLWADLHNAYIWITLFVFTAYGFLGFVDDYK 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K    +  G+S K +   + ++A+ A   ++    S        T +  PFF++++ ++ 
Sbjct: 119 KTILKNPDGISAKAKFFGQLVVAVAATAMIMQVDTSGN-----STKLALPFFKNVVFELS 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+  FA FVI+ ++NAVNLTDGLDGLAI P +IA      +AY+ G++  + YLQ+ ++
Sbjct: 174 YFYFAFAVFVIIGSSNAVNLTDGLDGLAITPSVIAFATIGILAYMTGHVKFADYLQIMYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
              GEL +   A++GAG+GFLWFN  PA +FMGD GSL++G  +  +AV  KHEI+L I+
Sbjct: 234 RNAGELSIFCGAMVGAGLGFLWFNAHPASVFMGDVGSLSIGGALATVAVIAKHEIVLAIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GG+FV+ETLSVI+QVG+FKMT  +R+F MAPIHHHFE  GW+E +I IRFWIIS I A++
Sbjct: 294 GGIFVIETLSVILQVGFFKMTGGRRLFRMAPIHHHFELAGWSETKITIRFWIISIILALV 353

Query: 359 GLLTLKMR 366
            L TLKMR
Sbjct: 354 ALSTLKMR 361


>gi|301063219|ref|ZP_07203768.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [delta
           proteobacterium NaphS2]
 gi|300442647|gb|EFK06863.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [delta
           proteobacterium NaphS2]
          Length = 359

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 162/368 (44%), Positives = 238/368 (64%), Gaps = 11/368 (2%)

Query: 1   MFIQLADFSEY-YIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M  +L       Y   +V +Y+TFR+  +  + +L+ F  G   I  LR+LQ   G+ +R
Sbjct: 1   MIYKLIYLLHSDYSWLNVFRYITFRTILSSLTGLLLCFFVGAWGIKKLRALQ--IGEKIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
               P H  K  TPTMGG +IL  ++ ++L+WAD  + ++ + + + L FG +GF DDY 
Sbjct: 59  EDGPPDHQAKAGTPTMGGCLILPAIVVATLMWADPLNRYIQLAVFVVLFFGAIGFADDYS 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+S   +  ++ + A+L   AL  +        E  + +  PF + I  D+G
Sbjct: 119 KVTGKNRNGMSASTKFTLQIVGALLVATALYLFP-------EFDSRLNVPFLKHIAPDLG 171

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +IP A F+IV T+NAVNLTDGLDGLAI P+++A   +   AY+AGNI ++ YLQ+ ++
Sbjct: 172 WGYIPLAVFIIVGTSNAVNLTDGLDGLAISPLIVAFGCYLIFAYLAGNIKIASYLQIPYL 231

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PG GE+ ++  A +GAG+GFLW+N  PA IFMGD GSL LGA +G +AV TK E++LI++
Sbjct: 232 PGAGEISILCGAAVGAGLGFLWYNAYPAEIFMGDVGSLPLGALLGTVAVITKQELVLILV 291

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV E LSVI QV YF++T  +R+F MAPIHHHFE KGW E ++++RFWII+ I A++
Sbjct: 292 GGLFVFEALSVIFQVAYFRLTGGQRIFRMAPIHHHFELKGWPEPKVIVRFWIIAIILALL 351

Query: 359 GLLTLKMR 366
            + TLK+R
Sbjct: 352 SISTLKLR 359


>gi|97176775|sp|Q2Y635|MRAY_NITMU RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
          Length = 361

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 162/368 (44%), Positives = 239/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA  F+    + +V  Y+T R+  A  +A++I F  GP +I  L + +   GQ VR
Sbjct: 1   MLLELAQWFAGDIRLLNVFSYITLRTVLAALTALIISFIVGPAMIRKLTAYK--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ +V I+L+ TL FG++G+ DDY 
Sbjct: 59  DDGPQTHLVKAGTPTMGGALILVSIAITTLLWADLSNRYVWIVLITTLGFGMIGWVDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDI-ILDM 178
           K+   +  GLS + ++  +  IAIL    L+  +      +  +T+++ PFF+ + +   
Sbjct: 119 KVVYRNPKGLSARAKLFWQSAIAILVALYLVLTAE-----LPAQTTLIVPFFKQVAVPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              F+    FVIV T+NAVNLTDGLDGLAI+P ++ S A +  +YVAG+ + + YL +  
Sbjct: 174 VTGFVALTYFVIVGTSNAVNLTDGLDGLAIMPTVMISSALAIFSYVAGHAVFAKYLGMPH 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +P  GEL V   AL GAG+ FLWFN  PA +FMGD G+LALGA +G + V  + EI+++I
Sbjct: 234 IPQAGELAVFCGALAGAGLAFLWFNAYPAEVFMGDVGALALGAALGIVTVIVRQEIVMLI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FVVETLSV++QV  FK+  KR+F MAP+HHH+E KGW ENQ+V+RFWII+ +  + 
Sbjct: 294 MGGVFVVETLSVMLQVASFKLIGKRIFRMAPLHHHYELKGWKENQVVVRFWIITMMLVLF 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLSSLKLR 361


>gi|325980952|ref|YP_004293354.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosomonas sp.
           AL212]
 gi|325530471|gb|ADZ25192.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosomonas sp.
           AL212]
          Length = 361

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 231/367 (62%), Gaps = 7/367 (1%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + L+ +  +     +V  Y+T R+  A  +A++I F  GP +I  L + +   GQ +R
Sbjct: 1   MLLALSQWLAQDIRAFNVFSYITLRAVLATLTALVISFIIGPLMIRKLTAYK--IGQSIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K+ TPTMGG +ILM ++ ++LLW+D  + ++ ++LL TL FG++G+ DDY 
Sbjct: 59  DDGPQTHLVKMGTPTMGGALILMSILLTTLLWSDLGNRYIWLVLLTTLGFGVIGWIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   +  GLS K +   + + AI+       Y  ST         IV  F    I    
Sbjct: 119 KVVHRNPKGLSAKAKFFWQSVTAIVVAL----YLASTAEISAQTDMIVPFFKEVAIPLGF 174

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+    FVIV T+NAVNLTDGLDGLAI+P ++ S A +  AY AG+I+ + YL + ++
Sbjct: 175 TGFVVLTYFVIVGTSNAVNLTDGLDGLAIMPTVMISSALAIFAYAAGHIVFAKYLGIPYI 234

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL V   A+ GAG+ FLWFN  PA +FMGD G+LALGA +G + V  + EI+LII+
Sbjct: 235 PHAGELAVFCGAMSGAGLAFLWFNAYPAEVFMGDVGALALGAALGVVTVIVRQEIVLIIM 294

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+E LSV++QV  FK+  KRVF MAP+HHH+E KGW ENQ+V+RFWII+FI  +IG
Sbjct: 295 GGVFVMEALSVMLQVASFKLLGKRVFRMAPLHHHYELKGWKENQVVVRFWIITFILVLIG 354

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 355 LSTLKLR 361


>gi|258546149|ref|ZP_05706383.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Cardiobacterium
           hominis ATCC 15826]
 gi|258518574|gb|EEV87433.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Cardiobacterium
           hominis ATCC 15826]
          Length = 360

 Score =  268 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 152/367 (41%), Positives = 226/367 (61%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M   LAD+   ++   +   Y+T R      +A+L+   FG ++I  LR LQ   GQ VR
Sbjct: 1   MLYALADWLSNWFSPFNAFTYLTSRVIFGALTALLLSIGFGGRMIALLRRLQ--MGQYVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H +K  TPTMGG +I++ +  + LLWAD    +  I L + L FG+VG+ DDY 
Sbjct: 59  DDGPQTHLKKAGTPTMGGALIILSVCIAMLLWADLRVKYTWIALFVMLGFGVVGWIDDYR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+   D  GL  K +  +  ++++     L   + S       +T++  PFF+++   MG
Sbjct: 119 KLILKDPQGLRAKHKYALLSLVSLFTCIWLYASAAS-----PVETTLYVPFFKNLSWQMG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             F+PF  FV+   +NAVNLTDGLDGLAI+PV++ +   +  AY++G+   + YL    +
Sbjct: 174 WLFLPFVYFVLTGASNAVNLTDGLDGLAIMPVVLVAGGLAVFAYISGSPNYASYLHQPVL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           PGVGE+ V  +A+ GAG+GFLW+N  PA++FMGD G+L+LGA +  +AV+ + E++  ++
Sbjct: 234 PGVGEMAVFCAAIAGAGLGFLWYNAHPALVFMGDVGALSLGAALATVAVAIRQELVFALM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
            G+FV E LSV++QV  FK   KRVF MAP+HHHFE  GW E+++ IRFWII+ I  +IG
Sbjct: 294 SGIFVAEALSVMIQVVSFKTRGKRVFRMAPLHHHFELSGWPESRVTIRFWIITVILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LSTLKLR 360


>gi|91205669|ref|YP_538024.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia
           bellii RML369-C]
 gi|122425513|sp|Q1RI79|MRAY_RICBR RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|91069213|gb|ABE04935.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia
           bellii RML369-C]
          Length = 361

 Score =  268 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 173/368 (47%), Positives = 251/368 (68%), Gaps = 9/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L  +     I ++  Y+TFRS  A    + + F  GP++I  L++LQ   GQP+R
Sbjct: 1   MLYNLLLPYIHNSHIANLFHYITFRSGLAVLVTLSLSFLIGPRLIKFLQTLQ-KYGQPIR 59

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
           +     H  K  TPTMGGI+I++    S+LL AD ++ ++ I L   +SFG++GF DDY 
Sbjct: 60  LDGPESHQAKAGTPTMGGIMIILSSCFSTLLLADLTNKYIWITLFGFVSFGIIGFLDDYA 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+ GK ++L++ II+++    L +  +S          +  PFF+ + +D+G
Sbjct: 120 KVTKNNHYGVKGKSKLLLQGIISLIVCILLEYTIDSPSHM------LNVPFFKSLSMDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +I FA FVIV  +NAVNLTDGLDGLA VP+ + + +F+ I+Y+ GN++ S+YLQ+ ++
Sbjct: 174 YLYIFFAIFVIVGASNAVNLTDGLDGLATVPIALTAGSFALISYLVGNLIYSNYLQLTYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  ++++G+ +GFLWFN  PA +FMGDTGSL+LG  +G I+V TKHEI+L I+
Sbjct: 234 PNTGELTIFCASIVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIISVITKHEIVLGIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ET+SVIMQV YFK T  KR+F MAP+HHHFEK GWTE+++VIRFWIIS IF +I
Sbjct: 294 GGLFVIETISVIMQVYYFKATKGKRIFKMAPLHHHFEKSGWTESKVVIRFWIISLIFVLI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLSSLKLR 361


>gi|119897172|ref|YP_932385.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Azoarcus sp.
           BH72]
 gi|166219004|sp|A1K3U3|MRAY_AZOSB RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|119669585|emb|CAL93498.1| phospho-N-acetylmuramoyl-pentapeptide transferase [Azoarcus sp.
           BH72]
          Length = 362

 Score =  268 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 162/369 (43%), Positives = 225/369 (60%), Gaps = 10/369 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA +  +     +V  Y+T R+  A  +A+ I    GP VI  L + +   GQ VR
Sbjct: 1   MLLELALWLGQDIRGFNVFGYITLRTVLAALTALAISLTAGPGVIRWLAAKK--IGQAVR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  + LLW D  + +V + LL+TL FG VG+ DD+ 
Sbjct: 59  DDGPKSHLTKAGTPTMGGALILIAIGITILLWGDLRNAYVWVTLLVTLGFGAVGWVDDWR 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILD-M 178
           K+   D  GL+ + +      IA+ A   L   + +       +T ++ PFF+ +     
Sbjct: 119 KVVHRDPKGLASRWKYFWTSAIALGASIFLGLSATT-----PAETELIVPFFKAVAYPLG 173

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              FI    FVI  T++AVNLTDGLDGLAI+P ++ + A +  AYVAG+   S YL V +
Sbjct: 174 VYGFIALTYFVINGTSHAVNLTDGLDGLAIMPTVMVAGALAIFAYVAGHAGFSKYLGVPY 233

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           + G GEL V   A+ GAG+GFLWFN  PA +FMGD G+LALGA +G IAV  + EI+L I
Sbjct: 234 IAGAGELAVFCGAICGAGLGFLWFNAYPAEVFMGDVGALALGAALGTIAVVVRQEIVLFI 293

Query: 299 IGGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAV 357
           +GGLFV ETLSV++QV YFK +  KR+F MAP+HHH+E  GW E Q+V+RFWII+ +  +
Sbjct: 294 MGGLFVAETLSVMVQVLYFKASGGKRIFRMAPLHHHYELSGWKETQVVVRFWIITLMLVL 353

Query: 358 IGLLTLKMR 366
            GL TLK+R
Sbjct: 354 FGLSTLKLR 362


>gi|239947618|ref|ZP_04699371.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921894|gb|EER21918.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 361

 Score =  268 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 176/368 (47%), Positives = 247/368 (67%), Gaps = 9/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L        I ++  Y+TFRS  A    + + F  GP +I  LRSLQ   GQP+R
Sbjct: 1   MLYNLLLPHIHNSHIANLFHYITFRSGLAITITLSLSFITGPILIKFLRSLQ-KNGQPIR 59

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+I+     S+LL AD ++ ++ I L   +SFG++GF DDY 
Sbjct: 60  SDGPESHQTKAGTPTMGGIMIIFSSCLSTLLLADLTNKYIWITLFGFISFGIIGFMDDYA 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+ GK ++L++ II+++    L +   +          +  PFF+++ LD+G
Sbjct: 120 KVTKNNHYGVRGKSKLLLQGIISLIICVLLEYTDKNPSHL------LNVPFFKNLSLDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I FA FVIV ++NAVNLTDGLDGLA VP+   + +F+ I+Y+ GN++ S+YLQ+ ++
Sbjct: 174 YFYIVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNLIYSNYLQLTYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL V+ + L+G+ +GFLWFN  PA +FMGDTGSL+LG  +G I++ TKHEI+L I+
Sbjct: 234 PNTGELTVLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIISIITKHEIVLAIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ET SVI+QV YFK T  KR+F MAP+HHHFEK GW E+++VIRFWIIS IFA+I
Sbjct: 294 GGLFVIETASVILQVYYFKATKGKRIFRMAPLHHHFEKYGWAESKVVIRFWIISVIFALI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLSSLKLR 361


>gi|82703612|ref|YP_413178.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosospira
           multiformis ATCC 25196]
 gi|82411677|gb|ABB75786.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrosospira
           multiformis ATCC 25196]
          Length = 364

 Score =  268 bits (685), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 162/368 (44%), Positives = 239/368 (64%), Gaps = 9/368 (2%)

Query: 1   MFIQLAD-FSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M ++LA  F+    + +V  Y+T R+  A  +A++I F  GP +I  L + +   GQ VR
Sbjct: 4   MLLELAQWFAGDIRLLNVFSYITLRTVLAALTALIISFIVGPAMIRKLTAYK--IGQAVR 61

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  ++LLWAD S+ +V I+L+ TL FG++G+ DDY 
Sbjct: 62  DDGPQTHLVKAGTPTMGGALILVSIAITTLLWADLSNRYVWIVLITTLGFGMIGWVDDYR 121

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDI-ILDM 178
           K+   +  GLS + ++  +  IAIL    L+  +      +  +T+++ PFF+ + +   
Sbjct: 122 KVVYRNPKGLSARAKLFWQSAIAILVALYLVLTAE-----LPAQTTLIVPFFKQVAVPLG 176

Query: 179 GLFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNF 238
              F+    FVIV T+NAVNLTDGLDGLAI+P ++ S A +  +YVAG+ + + YL +  
Sbjct: 177 VTGFVALTYFVIVGTSNAVNLTDGLDGLAIMPTVMISSALAIFSYVAGHAVFAKYLGMPH 236

Query: 239 VPGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLII 298
           +P  GEL V   AL GAG+ FLWFN  PA +FMGD G+LALGA +G + V  + EI+++I
Sbjct: 237 IPQAGELAVFCGALAGAGLAFLWFNAYPAEVFMGDVGALALGAALGIVTVIVRQEIVMLI 296

Query: 299 IGGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           +GG+FVVETLSV++QV  FK+  KR+F MAP+HHH+E KGW ENQ+V+RFWII+ +  + 
Sbjct: 297 MGGVFVVETLSVMLQVASFKLIGKRIFRMAPLHHHYELKGWKENQVVVRFWIITMMLVLF 356

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 357 GLSSLKLR 364


>gi|157826874|ref|YP_001495938.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia
           bellii OSU 85-389]
 gi|166221349|sp|A8GVM4|MRAY_RICB8 RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|157802178|gb|ABV78901.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Rickettsia
           bellii OSU 85-389]
          Length = 361

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 172/368 (46%), Positives = 250/368 (67%), Gaps = 9/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L  +     I ++  Y+TFRS  A    + + F  GP++I  L++LQ   GQP+R
Sbjct: 1   MLYNLLLPYIHNSHIANLFHYITFRSGLAVLVTLSLSFLIGPRLIKFLQTLQ-KYGQPIR 59

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
           +     H  K  TPTMGGI+I++    S+LL AD ++ ++ I L   +SF ++GF DDY 
Sbjct: 60  LDGPESHQAKAGTPTMGGIMIILSSCFSTLLLADLTNKYIWITLFGFVSFSIIGFLDDYA 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+ GK ++L++ II+++    L +  +S          +  PFF+ + +D+G
Sbjct: 120 KVTKNNHYGVKGKSKLLLQGIISLIVCILLEYTIDSPSHM------LNVPFFKSLSMDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             +I FA FVIV  +NAVNLTDGLDGLA VP+ + + +F+ I+Y+ GN++ S+YLQ+ ++
Sbjct: 174 YLYIFFAIFVIVGASNAVNLTDGLDGLATVPIALTAGSFALISYLVGNLIYSNYLQLTYL 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL +  ++++G+ +GFLWFN  PA +FMGDTGSL+LG  +G I+V TKHEI+L I+
Sbjct: 234 PNTGELTIFCASIVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIISVITKHEIVLGIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ET+SVIMQV YFK T  KR+F MAP+HHHFEK GWTE+++VIRFWIIS IF +I
Sbjct: 294 GGLFVIETISVIMQVYYFKATKGKRIFKMAPLHHHFEKSGWTESKVVIRFWIISLIFVLI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLSSLKLR 361


>gi|187609690|sp|A8GP69|MRAY_RICAH RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
          Length = 361

 Score =  268 bits (685), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 177/368 (48%), Positives = 248/368 (67%), Gaps = 9/368 (2%)

Query: 1   MFI-QLADFSEYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M    L        I ++  Y+TFRS  A    + + F  GP +I  LRSLQ   GQP+R
Sbjct: 1   MLYNLLLPHIHNSHIANLFHYITFRSGLAIIITLSLSFIMGPILIKFLRSLQ-KNGQPIR 59

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGGI+I++    S+LL AD ++ ++ I L   +SFG++GF DDY 
Sbjct: 60  SDGPESHQTKAGTPTMGGIMIILSSGLSTLLLADLTNQYIWITLFGFISFGIIGFMDDYA 119

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+T  +  G+ GK +++++ II+++    L +   +          +  PFF+++ LD+G
Sbjct: 120 KVTKNNHYGVRGKSKLVLQGIISLIICVLLEYLDKNPSHL------LNVPFFKNLNLDLG 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
            F+I FA FVIV ++NAVNLTDGLDGLA VP+   + +F+ I+Y+ GN++ SHYLQ+ ++
Sbjct: 174 YFYIVFAIFVIVGSSNAVNLTDGLDGLATVPIAFTAGSFALISYLVGNLIYSHYLQLTYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
           P  GEL V+ + L+G+ +GFLWFN  PA +FMGDTGSL+LG  +G I+V TKHEI+L I+
Sbjct: 234 PNTGELTVLCAGLVGSCLGFLWFNAQPAEVFMGDTGSLSLGGVLGIISVITKHEIVLAIV 293

Query: 300 GGLFVVETLSVIMQVGYFKMT-KKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVI 358
           GGLFV+ET SVI+QV YFK T  KR+F MAP+HHHFEK GW E+++VIRFWIIS IFA+I
Sbjct: 294 GGLFVIETASVILQVYYFKATQGKRIFKMAPLHHHFEKHGWAESKVVIRFWIISVIFALI 353

Query: 359 GLLTLKMR 366
           GL +LK+R
Sbjct: 354 GLSSLKLR 361


>gi|88811841|ref|ZP_01127094.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrococcus
           mobilis Nb-231]
 gi|88790725|gb|EAR21839.1| phospho-N-acetylmuramoyl-pentapeptide-transferase [Nitrococcus
           mobilis Nb-231]
          Length = 360

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 163/367 (44%), Positives = 244/367 (66%), Gaps = 8/367 (2%)

Query: 1   MFIQLADFS-EYYIITHVLKYVTFRSSAAFFSAMLIVFAFGPKVIDCLRSLQEFRGQPVR 59
           M + LA++  +YY + +V++Y+TFR+     ++++I  A GP +I  L  +Q   GQ +R
Sbjct: 1   MLLVLAEWLAQYYGVFNVVQYLTFRAIVGALTSLIISLAVGPLLIRWL--VQYQVGQQIR 58

Query: 60  VPNLPIHARKIDTPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLSFGLVGFYDDYI 119
                 H  K  TPTMGG +IL+ +  S+LLW+D S+  V I+LL TL+FG VG  DDY+
Sbjct: 59  QDGPQTHFSKAGTPTMGGTLILLSIAVSTLLWSDLSNRFVWIVLLATLAFGAVGGVDDYL 118

Query: 120 KITTGDAGGLSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMG 179
           K+  G++ GLS +++   +  + +L    L   + +       +TS++ PFF+ + + + 
Sbjct: 119 KLVHGNSKGLSARIKYGWQSALGLLVALVLYATAQA-----PVETSLIVPFFKSVRISLD 173

Query: 180 LFFIPFAAFVIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFV 239
             FIP   FVIV ++NAVNLTDGLDGLAIVP ++   A +   Y  G+I  + YL + ++
Sbjct: 174 WLFIPLTYFVIVGSSNAVNLTDGLDGLAIVPTVLVGAALAVFVYATGHITFAQYLGIPYI 233

Query: 240 PGVGELVVVISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAVSTKHEILLIII 299
            GVGE VV   AL+GAG+GFLWFN  PA++FMGD G+LALGA +G +AV  + E++L ++
Sbjct: 234 QGVGEAVVFCGALVGAGLGFLWFNTYPAMVFMGDVGALALGAALGVLAVVVRQELVLFVM 293

Query: 300 GGLFVVETLSVIMQVGYFKMTKKRVFLMAPIHHHFEKKGWTENQIVIRFWIISFIFAVIG 359
           GG+FV+ETLSV++QV  FK+T +RV  MAP+HHHFE KG  E ++++RFWI++ I  +IG
Sbjct: 294 GGVFVIETLSVMVQVAAFKLTGQRVLRMAPLHHHFELKGCPEPRVIVRFWIVTIILVLIG 353

Query: 360 LLTLKMR 366
           L TLK+R
Sbjct: 354 LATLKLR 360


>gi|46397628|sp|Q9AKP2|MRAY_RICMO RecName: Full=Phospho-N-acetylmuramoyl-pentapeptide-transferase;
           AltName: Full=UDP-MurNAc-pentapeptide phosphotransferase
 gi|13235406|emb|CAC33606.1| Phospho-N-acetylmu