RPSBLAST alignment for GI: 254781100 and conserved domain: cd06854

>gnl|CDD|133464 cd06854, GT_WbpL_WbcO_like, The members of this subfamily catalyze the formation of a phosphodiester bond between a membrane-associated undecaprenyl-phosphate (Und-P) molecule and N-acetylhexosamine 1-phosphate, which is usually donated by a soluble UDP-N-acetylhexosamine precursor. The WbcO/WbpL substrate specificity has not yet been determined, but the structure of their biosynthetic end products implies that UDP-N-acetyl-D-fucosamine (UDP-FucNAc) and/or UDPN-acetyl-D-quinosamine (UDP-QuiNAc) are used. The subgroup of bacterial UDP-HexNAc:polyprenol-P HexNAc-1-P transferases includes the WbcO protein from Yersinia enterocolitica and the WbpL protein from Pseudomonas aeruginosa. These transferases initiate LPS O-antigen biosynthesis. Similar to other GlcNAc/MurNAc-1-P transferase family members, WbpL is a highly hydrophobic protein possessing 11 predicted transmembrane segments. Length = 253
 Score = 94.6 bits (236), Expect = 4e-20
 Identities = 62/220 (28%), Positives = 88/220 (40%), Gaps = 43/220 (19%)

Query: 72  TPTMGGIIILMGLIGSSLLWADFSSLHVSIILLLTLS---FGLVGFYDDYIKITTGDAGG 128
           TP  GGI  ++  + + LL A    L+    LLL +       VGF DD           
Sbjct: 15  TPRGGGIAFVLAFLLALLLAAAAGPLNDLSYLLLLIGLLLLAAVGFIDDLR--------S 66

Query: 129 LSGKVRILIEFIIAILAVCALLFYSNSTLLGIETKTSIVFPFFRDIILDMGLFFIPFAAF 188
           LS K+R+L++ + A LA+ AL                        +              
Sbjct: 67  LSPKIRLLVQLLAAALALYALGP-----------------LTSLLLNFLPPWLIALLLLL 109

Query: 189 VIVATANAVNLTDGLDGLAIVPVMIASVAFSFIAYVAGNILLSHYLQVNFVPGVGELVVV 248
            IV   N  N  DG+DGLA    ++  +A + + Y+AG                  L ++
Sbjct: 110 AIVWIINLYNFMDGIDGLAGGEALVVFLALALLGYLAGEP---------------ALALL 154

Query: 249 ISALIGAGIGFLWFNISPAVIFMGDTGSLALGAFIGGIAV 288
             AL GA +GFL FN  PA IFMGD GS  LG  +  + +
Sbjct: 155 ALALAGALLGFLPFNWPPAKIFMGDVGSTFLGFLLAALLL 194