RPSBLAST alignment for GI: 254781101 and conserved domain: pfam02875

>gnl|CDD|145824 pfam02875, Mur_ligase_C, Mur ligase family, glutamate ligase domain. This family contains a number of related ligase enzymes which have EC numbers 6.3.2.*. This family includes: MurC, MurD, MurE, MurF, Mpl and FolC. MurC, MurD, Mure and MurF catalyse consecutive steps in the synthesis of peptidoglycan. Peptidoglycan consists of a sheet of two sugar derivatives, with one of these N-acetylmuramic acid attaching to a small pentapeptide. The pentapeptide is is made of L-alanine, D-glutamic acid, Meso-diaminopimelic acid and D-alanyl alanine. The peptide moiety is synthesized by successively adding these amino acids to UDP-N-acetylmuramic acid. MurC transfers the L-alanine, MurD transfers the D-glutamate, MurE transfers the diaminopimelic acid, and MurF transfers the D-alanyl alanine. This family also includes Folylpolyglutamate synthase that transfers glutamate to folylpolyglutamate. Length = 87
 Score = 47.3 bits (113), Expect = 1e-05
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 8/71 (11%)

Query: 334 LNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGDMCEMGELSQSFHIDLA 393
            N G   + D  Y  NP +++AA+  L ++    +GR I V G     G+    FH  L 
Sbjct: 10  ENNGVLVIDD--YAHNPDALEAALQALKEL---FDGRLILVFGA---GGDRDAEFHALLG 61

Query: 394 EVLSLYNISHV 404
            + +      +
Sbjct: 62  ALAAALADVVI 72