HHsearch alignment for GI: 254781103 and conserved domain: COG2066

>COG2066 GlsA Glutaminase [Amino acid transport and metabolism].
Probab=90.85  E-value=1.1  Score=23.11  Aligned_cols=105  Identities=15%  Similarity=0.192  Sum_probs=70.3

Q ss_pred             CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECCE
Q ss_conf             2130010022110011078230108999863078850320189999999999999873-388464104797357667240
Q gi|254781103|r  445 LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGT  523 (598)
Q Consensus       445 ~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTGT  523 (598)
T Consensus       199 i~~~~~dLA~~g~~LA~~G~~-------------p~tge~v~~~~~ar~i~alM~TcGmYd~sG~fa~rVGlP--~KSGV  263 (309)
T COG2066         199 IEMNCVDLARLGLFLANGGVN-------------PLTGERVVPADQARQINALMLTCGMYDASGEFAYRVGLP--AKSGV  263 (309)
T ss_pred             HHHHHHHHHHHHHHHHCCCCC-------------CCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHCCCC--CCCCC
T ss_conf             883399999988998669908-------------887885777788899999998703623300147630885--33676


Q ss_pred             EEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             3512688766886217999997428880999999807888888874321467899999999999
Q gi|254781103|r  524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA  587 (598)
Q Consensus       524 Aq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~  587 (598)
T Consensus       264 g--------------GGI~AvvPg---~~gIav~s--P~L----d~~GNSv~G~~~le~Ls~~~  304 (309)
T COG2066         264 G--------------GGIMAVVPG---EMGIAVWS--PAL----DEAGNSVAGIAALEQLSQQL  304 (309)
T ss_pred             C--------------CEEEEEECC---CCEEEEEC--CCC----CCCCCCHHHHHHHHHHHHHH
T ss_conf             6--------------605898068---73789877--766----87788359999999999984