HHsearch alignment for GI: 254781103 and conserved domain: PRK10001

>PRK10001 D-alanyl-D-alanine carboxypeptidase fraction C; Provisional.
Probab=98.42  E-value=2.7e-07  Score=65.23  Aligned_cols=113  Identities=13%  Similarity=0.241  Sum_probs=78.4

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH---HHHCCCEECCCCCCCC
Q ss_conf             2343111223023203211121001473111344432322222332456643201235654---4302403204421336
Q gi|254781103|r  280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM---GIDSGLFTVKDLFDTR  356 (598)
Q Consensus       280 ~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aa---aLe~g~i~~~~~~~~~  356 (598)
T Consensus        36 ~i~A~sail~D~~TG~VLy~---------------------Kn~d~~~~pAS~TKlMTa~lv~eai~~g~i~ld~~v~vs   94 (400)
T PRK10001         36 SVDARAWILMDYASGKVLAE---------------------GNADEKLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVG   94 (400)
T ss_pred             CCCCEEEEEEECCCCCCHHH---------------------CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             74531899999999959453---------------------093998487799999999999999865999878647724


Q ss_pred             CCC-CCCCCCCCCC----CCCCCCCCHHH----HHHCCCCCEEEEEEECCCC------CCCHHHCCCCCCCC
Q ss_conf             763-2221011234----54323003999----8550367123543202333------32001101222576
Q gi|254781103|r  357 NPI-KVGKHVIHDY----HPQNRILTIPE----IFRYSSNIGAAQIADAMGI------QGHKEFLYRLGLLS  413 (598)
Q Consensus       357 ~~~-~~~~~~i~~~----~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~------~~~~~~~~~fG~g~  413 (598)
T Consensus        95 ~~a~~~~~~~~~g~S~~~l~~g~~~tv~dLL~~lli~SaNDAA~aLAe~i~Gs~~~Fv~~MN~kA~~LG~~n  166 (400)
T PRK10001         95 KDAWATGNPALRGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTN  166 (400)
T ss_pred             HHHHHHCCCCCCCCCEEEECCCCEEEHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             899852476556874244237989899999999877442599999997235568999999999999828987