HHsearch alignment for GI: 254781103 and conserved domain: TIGR02073

>TIGR02073 PBP_1c penicillin-binding protein 1C; InterPro: IPR011815 This entry contains penicillin binding proteins includes the member from Escherichia coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this entry are presumed to have the same basic function..
Probab=100.00  E-value=0  Score=357.09  Aligned_cols=304  Identities=19%  Similarity=0.234  Sum_probs=250.0

Q ss_pred             CCCEEEEHHHHHHHHHHHHHHHCCCCCCC---CCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             67425552576777776442100113234---311122302320321112100147311134443232222233245664
Q gi|254781103|r  254 QPIRLALDLRIQNIVHQELVENKKKYNAE---SVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG  330 (598)
Q Consensus       254 ~dI~lTID~~lQ~~~e~~l~~~~~~~~a~---~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePG  330 (598)
T Consensus       254 s~i~sTlD~~LQ~~~E~~~~~~~~~l~~~gi~~~A~lVvD~~s~~V~A~vGS~df~d--~---~~~gqVD-~v~A~RSpG  327 (786)
T TIGR02073       254 SKIVSTLDADLQRRLEELARRYLSALRPRGISNLAILVVDNRSGAVLAYVGSADFFD--D---SNAGQVD-GVRAIRSPG  327 (786)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCEEEEEECCCCCC--C---CCCEEEE-EEECCCCCC
T ss_conf             736762474479999999999998618688302578899717982699982456766--1---3050461-476676678


Q ss_pred             CCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCC----CCCCCCCC-CCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHH
Q ss_conf             320123565443024032044213367632221----01123454-3230039998550367123543202333320011
Q gi|254781103|r  331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK----HVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF  405 (598)
Q Consensus       331 StfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~----~~i~~~~~-~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~  405 (598)
T Consensus       328 StLKPFlYaLald~G~~~p~slL~D~-P~~fg~~SG~Y~P~Nf~~~F~G~V~v~~AL~~SLNiPAV~ll~~~g~~~f~~~  406 (786)
T TIGR02073       328 STLKPFLYALALDDGLIHPDSLLKDV-PLRFGDVSGLYAPENFDKTFHGPVPVREALARSLNIPAVRLLERLGPPRFASF  406 (786)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHC-CHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCHHHHHHHHCCHHHHHHH
T ss_conf             64318999856565211201010101-21014723332678877764677639998643067148999974292689999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCC------
Q ss_conf             01222576344686542111122335544100114687521300100221100110782301089998630788------
Q gi|254781103|r  406 LYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE------  479 (598)
Q Consensus       406 ~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~------  479 (598)
T Consensus       407 L~~~G~~~~~------------~~~~-~~yGLSL~LG-G~e~tL~dLa~lY~~LA~~G~~~plr~~~~~~~~~~~~~~ke  472 (786)
T TIGR02073       407 LRQAGLKLLK------------PKSR-DYYGLSLILG-GAEITLQDLANLYAMLANQGLSGPLRFLQADAKRPEREESKE  472 (786)
T ss_pred             HHHHCCCCCC------------HHHH-CCCCCEEEEC-CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             9970565578------------0000-2576013123-017448999999999974266657421335456764124666


Q ss_pred             -CCCCCCCCHHHHHHHHHHHHHHHCC-CCEE-E-CCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEE
Q ss_conf             -5032018999999999999987338-8464-1-0479735766724035126887668862179999974288809999
Q gi|254781103|r  480 -KVSRIVLKKNTVKTMRSLLREGVTG-GSGR-R-AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVL  555 (598)
Q Consensus       480 -~~~~~vis~~~a~~l~~~l~~vv~~-GTg~-~-a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~  555 (598)
T Consensus       473 Gnf~~rll~~~aa~~~~diL~~~~~p~~~~~~~~~~~~~~~~AwKTGTSy---------G~RDAWa~G~~~----~Yti~  539 (786)
T TIGR02073       473 GNFGTRLLSPGAAWIVLDILKDRPRPEDTLPKSSALSTRLPLAWKTGTSY---------GFRDAWAAGVSG----RYTIG  539 (786)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEECCCC---------CCCCCEEEECCC----CEEEE
T ss_conf