Query         gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 598
No_of_seqs    193 out of 6051
Neff          6.9 
Searched_HMMs 39220
Date          Tue May 31 16:02:26 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781103.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR02214 spoVD_pbp stage V sp 100.0       0       0 1008.7  25.9  521   73-597     1-589 (660)
  2 TIGR03423 pbp2_mrdA penicillin 100.0       0       0  920.2  35.1  501   72-587     1-590 (592)
  3 PRK10795 penicillin-binding pr 100.0       0       0  872.6  34.9  511   63-589    10-614 (619)
  4 COG0768 FtsI Cell division pro 100.0       0       0  855.5  32.7  525   64-596     7-598 (599)
  5 pfam00905 Transpeptidase Penic 100.0       0       0  555.9  16.6  292  284-584     1-296 (296)
  6 TIGR02074 PBP_1a_fam penicilli 100.0       0       0  467.9  12.3  313  251-588   239-699 (700)
  7 PRK11636 mrcA peptidoglycan sy 100.0       0       0  429.3  15.5  269  283-593   426-791 (850)
  8 PRK09506 mrcB penicillin-bindi 100.0       0       0  421.2  15.2  302  252-595   432-757 (839)
  9 COG5009 MrcA Membrane carboxyp 100.0       0       0  411.7   9.2  266  283-591   420-723 (797)
 10 PRK11240 penicillin-binding pr 100.0       0       0  384.2  15.4  296  253-588   269-566 (770)
 11 COG0744 MrcB Membrane carboxyp 100.0       0       0  377.9  15.4  302  250-594   293-604 (661)
 12 TIGR02073 PBP_1c penicillin-bi 100.0       0       0  357.1  12.9  304  254-591   254-575 (786)
 13 TIGR02071 PBP_1b penicillin-bi 100.0       0       0  347.8  11.4  297  249-587   371-694 (742)
 14 COG4953 PbpC Membrane carboxyp 100.0       0       0  320.3  14.2  300  252-591   263-565 (733)
 15 pfam03717 PBP_dimer Penicillin 100.0 1.4E-28 3.7E-33  200.4  11.1  137  112-249     1-158 (165)
 16 COG2602 Beta-lactamase class D  99.6 3.4E-15 8.8E-20  115.4  11.2  251  258-595     4-254 (254)
 17 pfam00768 Peptidase_S11 D-alan  98.6 4.2E-08 1.1E-12   70.3   3.2  213  281-560    10-239 (241)
 18 PRK10001 D-alanyl-D-alanine ca  98.4 2.7E-07 6.8E-12   65.2   4.3  113  280-413    36-166 (400)
 19 PRK11669 pbpG D-alanyl-D-alani  98.4 6.2E-07 1.6E-11   62.9   5.8  109  281-413    38-158 (308)
 20 COG2367 PenP Beta-lactamase cl  97.8 5.8E-05 1.5E-09   50.3   6.2  253  279-589    60-323 (329)
 21 PRK11397 dacD D-alanyl-D-alani  97.8 5.8E-06 1.5E-10   56.7   0.9  112  281-413    36-165 (390)
 22 PRK10793 D-alanyl-D-alanine ca  97.8 4.7E-06 1.2E-10   57.3   0.3  111  282-413    45-173 (403)
 23 COG1686 DacC D-alanyl-D-alanin  97.6   2E-05   5E-10   53.4   1.6  119  280-420    35-172 (389)
 24 PRK10662 beta-lactamase/D-alan  97.6  0.0037 9.3E-08   38.9  12.4   79  265-354    32-113 (377)
 25 pfam00144 Beta-lactamase Beta-  96.2  0.0044 1.1E-07   38.4   3.2  100  272-389     5-107 (327)
 26 PRK12357 glutaminase; Reviewed  96.2   0.022 5.5E-07   34.0   6.7  107  444-583   205-317 (326)
 27 PRK00971 glutaminase; Provisio  96.1   0.043 1.1E-06   32.1   7.9  215  324-581    58-297 (308)
 28 PRK12356 glutaminase; Reviewed  95.7   0.085 2.2E-06   30.2   8.0  216  324-584    62-303 (319)
 29 pfam04960 Glutaminase Glutamin  95.6   0.068 1.7E-06   30.8   7.2   98  444-579   175-273 (286)
 30 PRK11289 ampC beta-lactamase;   95.4   0.028 7.2E-07   33.3   4.6   81  263-354    32-115 (387)
 31 PRK11113 D-alanyl-D-alanine ca  94.6   0.018 4.7E-07   34.5   1.9   34  516-560   413-447 (477)
 32 COG2066 GlsA Glutaminase [Amin  90.9     1.1 2.9E-05   23.1   6.8  105  445-587   199-304 (309)
 33 pfam02113 Peptidase_S13 D-Ala-  90.6    0.32 8.2E-06   26.6   3.5  123  378-558   235-382 (383)
 34 PRK13128 D-aminopeptidase; Rev  88.8     0.3 7.7E-06   26.7   2.3   75  268-353     9-86  (518)
 35 COG1680 AmpC Beta-lactamase cl  84.5     1.7 4.4E-05   21.9   4.3   60  325-390    87-149 (390)
 36 PRK03642 hypothetical protein;  83.1     1.3 3.4E-05   22.6   3.2   38  444-496   299-336 (432)
 37 TIGR00750 lao LAO/AO transport  77.3     2.2 5.6E-05   21.3   2.8   50  205-293    29-78  (333)
 38 pfam06089 Asparaginase_II L-as  69.3     2.5 6.4E-05   20.9   1.5   44  283-347    15-58  (325)
 39 KOG0506 consensus               67.2     4.2 0.00011   19.5   2.3   66  444-524   371-437 (622)
 40 COG2027 DacB D-alanyl-D-alanin  58.2      12 0.00031   16.5   5.3  134  378-560   299-443 (470)
 41 TIGR00666 PBP4 D-alanyl-D-alan  56.8     4.6 0.00012   19.2   0.9   33  516-559   393-425 (427)
 42 KOG0809 consensus               56.0     9.1 0.00023   17.3   2.3   13  327-339   228-240 (305)
 43 COG1946 TesB Acyl-CoA thioeste  52.4      10 0.00026   17.0   2.1   11  539-549   233-243 (289)
 44 pfam02438 Adeno_100 Late 100kD  50.5     9.5 0.00024   17.2   1.7   53  445-498   501-558 (583)
 45 TIGR00170 leuC 3-isopropylmala  46.6      19 0.00047   15.4   3.2   44  254-298   170-215 (472)
 46 KOG3285 consensus               45.9      19 0.00049   15.3   3.1   47  252-299    48-98  (203)
 47 COG5445 Predicted secreted pro  45.4     9.1 0.00023   17.3   0.9   73  328-406    57-129 (268)
 48 pfam00957 Synaptobrevin Synapt  45.0     9.3 0.00024   17.3   1.0   53   22-75     14-66  (89)
 49 TIGR01204 bioW 6-carboxyhexano  43.2      19 0.00049   15.3   2.3   39  260-299    85-124 (238)
 50 cd03444 Thioesterase_II_repeat  43.1      16  0.0004   15.8   1.9   18  115-132    83-100 (104)
 51 PTZ00112 origin recognition co  41.9      22 0.00056   14.9   2.6   10  120-129   113-122 (650)
 52 KOG2302 consensus               41.9      22 0.00056   14.9   2.6   14   79-92    217-230 (1956)
 53 COG5325 t-SNARE complex subuni  39.2      24 0.00062   14.6   3.6   11  327-337   205-215 (283)
 54 KOG0860 consensus               38.2      25 0.00064   14.6   3.0   47   43-89     60-111 (116)
 55 pfam06977 SdiA-regulated SdiA-  37.3      15 0.00038   16.0   1.0   72  217-300     3-83  (101)
 56 PRK10815 sensor protein PhoQ;   36.3      16  0.0004   15.8   1.0   21  116-136    83-103 (484)
 57 TIGR00065 ftsZ cell division p  35.9      21 0.00054   15.0   1.6  119  259-392    52-175 (365)
 58 pfam07423 DUF1510 Protein of u  34.5      29 0.00073   14.2   3.9   29   71-99     13-41  (214)
 59 pfam11189 DUF2973 Protein of u  33.5      27 0.00068   14.4   1.8   16  115-130    45-60  (65)
 60 pfam10307 DUF2410 Hypothetical  31.8      17 0.00044   15.6   0.6   17  455-471    20-36  (200)
 61 TIGR01215 minE cell division t  30.5      24 0.00061   14.7   1.2   22   57-78      5-27  (89)
 62 COG0851 MinE Septum formation   29.4      30 0.00077   14.0   1.5   22   57-78      5-26  (88)
 63 TIGR02832 spo_yunB sporulation  28.8      29 0.00074   14.2   1.3   29   71-99      3-31  (220)
 64 pfam03356 Pox_LP_H2 Viral late  28.7      36 0.00091   13.6   3.0   50   74-123    27-93  (189)
 65 PRK10458 DNA cytosine methylas  28.4      35  0.0009   13.6   1.7   21  570-590   439-459 (470)
 66 cd03796 GT1_PIG-A_like This fa  27.0      35  0.0009   13.6   1.5   38  377-414   210-251 (398)
 67 COG1702 PhoH Phosphate starvat  26.6      31 0.00078   14.0   1.1   38  394-431   252-297 (348)
 68 KOG3547 consensus               25.0      28 0.00072   14.2   0.7   92   56-162    15-119 (450)
 69 cd04276 ZnMc_MMP_like_2 Zinc-d  24.5      20 0.00052   15.1  -0.1   12  287-298    80-91  (197)
 70 TIGR00381 cdhD CO dehydrogenas  23.2      43  0.0011   13.1   1.4   43  178-224    44-87  (401)
 71 pfam01011 PQQ PQQ enzyme repea  22.9      37 0.00095   13.5   1.0   19  281-299     7-25  (38)
 72 TIGR01312 XylB xylulokinase; I  22.5      16  0.0004   15.9  -1.0   44  114-157     9-55  (494)
 73 KOG4827 consensus               21.5      48  0.0012   12.7   1.3   80  257-341    60-153 (279)
 74 KOG3318 consensus               20.9      17 0.00044   15.6  -1.0   18  321-338    99-116 (178)
 75 pfam11119 DUF2633 Protein of u  20.8      28 0.00071   14.3  -0.0   22   76-97      9-30  (59)
 76 PRK00051 hisI phosphoribosyl-A  20.5      49  0.0013   12.7   1.2   23  278-300    13-36  (130)

No 1  
>TIGR02214 spoVD_pbp stage V sporulation protein D; InterPro: IPR011927    This entry describes the SpoVD family of homologs of the cell division protein FtsI, a penicillin binding protein. This family is restricted to Bacillus subtilis and related Gram-positive species with known or suspected endospore formation capability. In these species, the functional equivalent of FtsI is desginated PBP-2B, a paralog of SpoVD..
Probab=100.00  E-value=0  Score=1008.65  Aligned_cols=521  Identities=29%  Similarity=0.486  Sum_probs=483.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHEEEEEECCHHH-----HCEEEEEEECCCCCEEECCCCEEEEEEEEEEEEEEEHHHHCC--
Q ss_conf             7999999999999999864313434415323-----210004665179974576487081686977999997338099--
Q gi|254781103|r   73 RIGMTIVVCLVIYIILAIRIIQYGNIHPEPI-----APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVIS--  145 (598)
Q Consensus        73 Ri~il~~v~~ii~~il~~rl~~lq~~~~~~~-----~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i~i~P~~i~~--  145 (598)
                      |+.++++.+++||+++.+||+|+|++++..|     .++.+...+.|.||.||||||+.||.|..+|++.++|..|..  
T Consensus         1 r~~~~Li~~~~lf~~~~~rL~yv~v~~g~~y~~~A~d~W~~ei~~~A~RG~ILDRN~~eLAv~~~v~~V~~~l~~i~k~~   80 (660)
T TIGR02214         1 RLIVILISIVVLFLILSLRLFYVQVFRGSRYKEMAEDQWTREIKIEAKRGRILDRNGEELAVSKSVYRVDLDLATIRKSL   80 (660)
T ss_pred             CEEHHHHHHHHHHHHHHHHHEEEEEEECHHHHHHHHHHCCCCCEECCCCCCEECCCCCCEEEECCCCEEEECHHHHHCCC
T ss_conf             93134789999999987421037897144478887652013731244327441228850046235236873268852200


Q ss_pred             ------HHHHHHHHHHHHCCCCHHHHHHHHHCCC----CE--EEEECCCCHHHHHHHHH--HHCCCCEECCHHHHHHHHC
Q ss_conf             ------8999999988807999899999851367----62--89613799999999763--1013750120233332100
Q gi|254781103|r  146 ------PDEIIEKLQIVLPNLDSEMIRRKLSSET----KF--QWLRRKLSPQQQKRILS--FGLPGVGFRLEKSRFYPAA  211 (598)
Q Consensus       146 ------~~~~~~~L~~il~~~~~~~i~~~l~~~~----~~--~~i~r~is~~~~~~I~~--~~lpGi~~~~~~~R~YP~~  211 (598)
                            .++++++|+..| ++|.+++.++++++.    .+  ..+.|+|+.+-++++++  +++.||.+.++++||||.+
T Consensus        81 ~~k~~~~~eiA~~LA~vL-~md~~~v~~~i~k~~~~G~~~~~~~l~Rki~~dKa~~v~~st~~l~Gv~v~edskRYYp~G  159 (660)
T TIGR02214        81 EKKDTDQREIAEKLAEVL-EMDKEKVFKRITKKEKDGSPVRSAKLIRKIEKDKAEKVRESTLKLKGVIVSEDSKRYYPNG  159 (660)
T ss_pred             CCCCHHHHHHHHHHHHHH-CCCHHHHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHCEEEEEEEEECCCCCCCCCCH
T ss_conf             210000799999999973-8877787767530177987145552101238889998831743410189746742227860


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEECCCC-----CCCEEEECCCC------------CCCCCCCEEEEHHHHHHHHHHHHHH
Q ss_conf             000011111124687512310001466-----85168953666------------7688674255525767777764421
Q gi|254781103|r  212 SHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVE  274 (598)
Q Consensus       212 ~lashiiGyv~~d~~G~~GlE~~~d~~-----g~~~~~~~~~~------------~~~g~dI~lTID~~lQ~~~e~~l~~  274 (598)
                      +++|||||+++.|++|++|||++||+.     |..+.+.+.+.            |.+|.|+.||||..+|+.+|+++.+
T Consensus       160 ~flshvLG~t~sD~~GL~GlEl~YdkeL~G~pG~~~~e~d~~~~~~P~~~~~y~~P~dG~~l~LTID~~iqy~~Er~~~~  239 (660)
T TIGR02214       160 DFLSHVLGFTNSDGEGLEGLELYYDKELKGLPGVRVAEVDANSLELPYAEDEYKKPVDGKDLVLTIDENIQYIVEREADE  239 (660)
T ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHCHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCEEEHHHHHHHHHHHHHHH
T ss_conf             02666525557760345231233141006899607988743677788541236688688733100002346798899999


Q ss_pred             HCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCC------------CCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             0011323431112230232032111210014731113444------------3232222233245664320123565443
Q gi|254781103|r  275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGK------------KEGWFNRISYGIFEMGSIFKVFTIAMGI  342 (598)
Q Consensus       275 ~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~------------~~~~~Nra~~~~yePGStfKp~t~aaaL  342 (598)
                      +..+++|++.+++||||+|||||+|+|+|+||||++++..            +..|+||+++++||||||||++|++|||
T Consensus       240 a~~~~~a~g~~i~vMnpknGeILGM~nrP~ydpn~p~~~s~~~~~kdesa~LQ~~WRN~~v~d~yEPGS~FKiiT~~AA~  319 (660)
T TIGR02214       240 ALSERKADGVSIIVMNPKNGEILGMSNRPSYDPNDPRDKSPEVKRKDESAKLQKSWRNRVVSDAYEPGSIFKIITSSAAM  319 (660)
T ss_pred             HHHHCCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCHHHCCCCHHHHHHHHCCCCEEECCCCCCCHHHHHHHHHHH
T ss_conf             97526987589999769997176520678878777430374360542036886501885011221698477999999997


Q ss_pred             HCCCEE-CCCCCCCCCCCCCCCCCCCCCCC-CCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCC
Q ss_conf             024032-04421336763222101123454-3230039998550367123543202333320011012225763446865
Q gi|254781103|r  343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP  420 (598)
Q Consensus       343 e~g~i~-~~~~~~~~~~~~~~~~~i~~~~~-~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp  420 (598)
                      ++|+++ .++.|+|+|.+++++.+++||++ +||..|+.|.+.+|||++|+.|+++||.++|.+|++.||||++||||||
T Consensus       320 ~eg~v~le~d~FYd~G~~~vg~~~~kCWK~~GHG~qtF~~vv~NSCN~GF~elG~~LG~~~L~~Yi~~FGFG~~tGIdL~  399 (660)
T TIGR02214       320 EEGIVKLEKDKFYDDGSATVGGKKIKCWKPGGHGSQTFLEVVQNSCNVGFIELGERLGAEKLNEYIKKFGFGSKTGIDLP  399 (660)
T ss_pred             HCCCEECCCCEEECCCEEEECCCEEEEECCCCCCCCCHHHHHHCCCCHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             32740003650107841443482667676886955464787532777789988554076689999984289876886667


Q ss_pred             CCCCCCCC--CCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCC------------CCCCCCC
Q ss_conf             42111122--335544100114687521300100221100110782301089998630788------------5032018
Q gi|254781103|r  421 EIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE------------KVSRIVL  486 (598)
Q Consensus       421 ~e~~g~~p--~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~------------~~~~~vi  486 (598)
                      ||++|.+-  ++-+++++||+||||+.++||+|..+|.+++||||.+++||+++++.+..+            ...++|+
T Consensus       400 GEA~GIl~n~~~v~pvdlAT~SfGQ~n~v~~iQ~~~A~~AvaNGG~L~~P~i~~e~~d~~~NG~~~v~~~f~P~~~~~vv  479 (660)
T TIGR02214       400 GEAAGILKNLEKVGPVDLATISFGQANTVTPIQLMTAVNAVANGGKLIQPHIMKEISDKENNGRKVVDKKFEPEVKRKVV  479 (660)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHCCCCHHCCHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCCCCCEEEEEEECCCEEEEEC
T ss_conf             74103341376556122543310520004778999999987516656613312202175789515887530770123532


Q ss_pred             CHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEEECCEEEECC--CCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCC
Q ss_conf             999999999999987338846410479735766724035126--887668862179999974288809999998078888
Q gi|254781103|r  487 KKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI--KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK  564 (598)
Q Consensus       487 s~~~a~~l~~~l~~vv~~GTg~~a~~~g~~vaGKTGTAq~~~--~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~  564 (598)
                      |++++..|+.+|+.||.+|||+.|+++||+|||||||||++.  +|+|.++.|++|||||||++||+++|.|.||+|+..
T Consensus       480 ~~~~~~~l~~~LE~vVs~GsGk~AfIdGyrvGGKTGTAqKv~P~~G~Y~~g~YivSFvG~APa~dP~v~~~V~vD~P~~~  559 (660)
T TIGR02214       480 DKETTEKLRLALEKVVSKGSGKDAFIDGYRVGGKTGTAQKVKPEDGGYLEGEYIVSFVGFAPADDPEVAVLVVVDNPKGV  559 (660)
T ss_pred             CHHHHHHHHHHHHCEEECCCCCCCCCCCEEECCEECCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCEEEEEEEECCCCC
T ss_conf             67789999886411451477756110346957730453444788893414866899864278898847999998679897


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             888743214678999999999999818998556
Q gi|254781103|r  565 ERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL  597 (598)
Q Consensus       565 ~~~~~~Gg~~AaPi~~~I~~~~~~~~~i~P~~~  597 (598)
                         .+|||.+||||+++||+-+++||||+|+..
T Consensus       560 ---~~FGG~vAAPv~~~v~~d~l~~lGi~P~~~  589 (660)
T TIGR02214       560 ---EQFGGLVAAPVVGEVFNDILNYLGIKPRKE  589 (660)
T ss_pred             ---CCCCCEEECHHHHHHHHHHHHHCCCCCCCC
T ss_conf             ---201344874146889998887557689886


No 2  
>TIGR03423 pbp2_mrdA penicillin-binding protein 2. Members of this protein family are penicillin-binding protein 2 (PBP-2), a protein whose gene (designated pbpA or mrdA) generally is found next to the gene for RodA, a protein required for rod (bacillus) shape in many bacteria. PBP-2 acts as a transpeptidase for cell elongation (hence, rod-shape).
Probab=100.00  E-value=0  Score=920.17  Aligned_cols=501  Identities=28%  Similarity=0.415  Sum_probs=442.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHEEEEEECCHHH-----HCEEEEEEECCCCCEEECCCCEEEEEEEEEEEEEEEHHHHCCH
Q ss_conf             47999999999999999864313434415323-----2100046651799745764870816869779999973380998
Q gi|254781103|r   72 NRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI-----APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISP  146 (598)
Q Consensus        72 ~Ri~il~~v~~ii~~il~~rl~~lq~~~~~~~-----~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i~i~P~~i~~~  146 (598)
                      +|+.+++++|+++|++|++||+++|+++++.+     .++.+...+++.||.||||||++||.|.+.|+|+++|+.+.+.
T Consensus         1 rR~~il~~~i~~~~~~li~RL~~lQv~~~~~y~~~a~~~~~~~~~i~a~RG~I~DrnG~~LA~s~~~~~l~~~p~~~~d~   80 (592)
T TIGR03423         1 RRALVAGGLVLALFGVLAARLYYLQVIRGEEYATLSEDNRIRLVPIPPPRGLILDRNGVLLADNRPSFSLEIVPEKVDDL   80 (592)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHEEEECHHHHHHHHHHCEEEEEEECCCCCCEECCCCCEEEECCEEEEEEEEHHHCCCH
T ss_conf             90699999999999999999863321006999999973737988965899858948999826433344999973452799


Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHH---HCCCCE--EEEECCCCHHHHHHHH--HHHCCCCEECCHHHHHHHHCCCCCCCCC
Q ss_conf             99999998880799989999985---136762--8961379999999976--3101375012023333210000001111
Q gi|254781103|r  147 DEIIEKLQIVLPNLDSEMIRRKL---SSETKF--QWLRRKLSPQQQKRIL--SFGLPGVGFRLEKSRFYPAASHASHVVG  219 (598)
Q Consensus       147 ~~~~~~L~~il~~~~~~~i~~~l---~~~~~~--~~i~r~is~~~~~~I~--~~~lpGi~~~~~~~R~YP~~~lashiiG  219 (598)
                      ++.++.|+++| +++.+++.+++   ++.++|  ++|++++++++..+|.  .+++|||.++++++|+||++++++||||
T Consensus        81 ~~~~~~L~~~l-~~~~~~~~~~~~~~~~~~~~~~~~l~~~ls~~~~~~i~~~~~~lpGi~~~~~~~R~YP~g~~~s~vlG  159 (592)
T TIGR03423        81 DATLDRLAKLL-DLDPEDIARFLKELKRSRRFEPIPLKSDLTEEEVARFAVNQYRLPGVEIEARLKRYYPYGELAAHVLG  159 (592)
T ss_pred             HHHHHHHHHHH-CCCHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHCCCCCCEEEEEEEEEECCCCCCHHHEEE
T ss_conf             99999999871-95999999999875424885279987579999999999741559966887613774787522221322


Q ss_pred             CCCC-----------------CCCCCCCCEEECCCCC-----CCEEEECC----------CCCCCCCCCEEEEHHHHHHH
Q ss_conf             1124-----------------6875123100014668-----51689536----------66768867425552576777
Q gi|254781103|r  220 YVDI-----------------DNRGITGIEKFLDMQG-----LTRVFTTN----------KGEKNLQPIRLALDLRIQNI  267 (598)
Q Consensus       220 yv~~-----------------d~~G~~GlE~~~d~~g-----~~~~~~~~----------~~~~~g~dI~lTID~~lQ~~  267 (598)
                      |++.                 |.+|++|||++||+.+     ....+.+.          ..+++|.||+||||.++|++
T Consensus       160 yv~~~~~~dl~~~~~~~y~~~d~vG~~GlE~~yd~~L~G~~G~~~~~~d~~g~~i~~~~~~~~~~G~~v~LTID~~lQ~~  239 (592)
T TIGR03423       160 YVGRINEEDLERLEPANYAGGDYIGKLGIEKYYEDDLRGKPGYREVEVNARGRVIRTLSRVPPVPGKDLVLTIDARLQQA  239 (592)
T ss_pred             ECCCCCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCCCEECCCCCCCCCCCCCEEEEECHHHHHH
T ss_conf             02557878874200013677663222316999887717998850799768997502332368999985799988999999


Q ss_pred             HHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCC------------CCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             7764421001132343111223023203211121001473111344------------4323222223324566432012
Q gi|254781103|r  268 VHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKG------------KKEGWFNRISYGIFEMGSIFKV  335 (598)
Q Consensus       268 ~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~------------~~~~~~Nra~~~~yePGStfKp  335 (598)
                      +|++|.+       ++|++|||||+|||||||||+|+||||.+...            ...++.|||+++.|||||||||
T Consensus       240 ae~~l~~-------~~g~~Vvmd~~TGeILAmas~P~fdpN~~~~~~~~~~~~~~~~~~~~~~~Nrav~~~yePGStfK~  312 (592)
T TIGR03423       240 AEKALGG-------RRGAVVVMDPRTGEILAMVSTPSFDPNLFVDGISSADYKALLNDPDRPLLNRAIQGVYPPGSTFKP  312 (592)
T ss_pred             HHHHHHC-------CCEEEEEEECCCCCEEEEECCCCCCCHHHCCCCCHHHHHHHHCCCCCCCCCCEEECCCCCCCHHHH
T ss_conf             9998615-------735699996688848999617887702303787988999874396654212011224468726899


Q ss_pred             HHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCC
Q ss_conf             3565443024032044213367632221011234543-230039998550367123543202333320011012225763
Q gi|254781103|r  336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK  414 (598)
Q Consensus       336 ~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~  414 (598)
                      ||+++|||+|+++|++.|+|+|.+.+++++++||+++ +|.+|+++||++|||++|+++++++|.+.+++|+++||||++
T Consensus       313 ~t~aaaLe~g~i~~~~~~~~~g~~~~~~~~i~d~~~~~~g~lt~~~~l~~SsNvg~~~ia~~lg~~~~~~~~~~fGfg~~  392 (592)
T TIGR03423       313 FVALAALEEGVITPDTRINCPGYFQLGGRRFRCWKRGGHGRVDLRKAIEESCDVYFYQLALRLGIDKIAEYAKKFGFGQK  392 (592)
T ss_pred             HHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCEECHHHHHHEEECHHHHHHHHHCCHHHHHHHHHHCCCCCC
T ss_conf             99999997599999858960783025985230478888630145544103833999789886187889999984678877


Q ss_pred             CCCCCCCCCCCCCCC----------CCCCCCCEECCCCCC-CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCC--
Q ss_conf             446865421111223----------355441001146875-2130010022110011078230108999863078850--
Q gi|254781103|r  415 LETELPEIQAPSYPS----------QWKRIHSLTISFGHG-LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV--  481 (598)
Q Consensus       415 t~idlp~e~~g~~p~----------~~~~~~~~~~~~Gqg-~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~--  481 (598)
                      ||+|||+|+.|.+|.          .|...+.+++||||| +++||||||++|++|||+|++++||+|+++.+.++.+  
T Consensus       393 tgidlp~E~~G~lp~~~w~~~~~~~~~~~~~~~~~siGQG~i~~TplQla~a~~~iaN~G~~~~P~lv~~i~d~~g~~~~  472 (592)
T TIGR03423       393 TGIDLPGEKSGLVPSREWKRKRFGQPWYPGDTLNVSIGQGYVLVTPLQLAVATAALANGGKLYKPHLVKSIEDPDGGVVQ  472 (592)
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCCEEE
T ss_conf             68998777488689968976420577774423354103674315889999999988619838521899975168885664


Q ss_pred             ------CCC-CCCHHHHHHHHHHHHHHHCC--CCEEECCCC-CEEEEEECCEEEECC---CCCCCC------CCCEEEEE
Q ss_conf             ------320-18999999999999987338--846410479-735766724035126---887668------86217999
Q gi|254781103|r  482 ------SRI-VLKKNTVKTMRSLLREGVTG--GSGRRAFVP-GFEVGGKTGTAQKVI---KKRYSD------TLNFNSFL  542 (598)
Q Consensus       482 ------~~~-vis~~~a~~l~~~l~~vv~~--GTg~~a~~~-g~~vaGKTGTAq~~~---~g~y~~------~~~~~~Fv  542 (598)
                            .++ ++|+++++.++++|+.||++  |||+.++++ ||+|||||||||+..   .++|..      .++|+||+
T Consensus       473 ~~~~~~~~~~~is~~ta~~v~~~m~~VV~~~~GTg~~a~~~~gy~vaGKTGTAq~~~~~~~~~~~~~~~~~~~~~~asFv  552 (592)
T TIGR03423       473 ETEPEVLPPLPISPENLDVVREGMRDVVNEPRGTARRARLGLDYKMAGKTGTAQVVSLKQGEKYDAEQIPERLRDHALFV  552 (592)
T ss_pred             ECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEHHHCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             04875456657899999999999999832899475752489998799996367624578875325554554567777999


Q ss_pred             EEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             997428880999999807888888874321467899999999999
Q gi|254781103|r  543 AVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA  587 (598)
Q Consensus       543 G~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~  587 (598)
                      ||||++||+|+|+|+|++|       .+||.+|||||++||+.++
T Consensus       553 G~~P~~~P~~~v~V~v~~~-------~~Gg~~AaPvf~~I~e~y~  590 (592)
T TIGR03423       553 AFAPYDNPEIAVAVIVEHG-------GGGSSAAAPIARKIMDAYF  590 (592)
T ss_pred             EEEECCCCEEEEEEEEECC-------CCCHHHHHHHHHHHHHHHH
T ss_conf             9978789879999999689-------9511489999999999985


No 3  
>PRK10795 penicillin-binding protein 2; Provisional
Probab=100.00  E-value=0  Score=872.55  Aligned_cols=511  Identities=22%  Similarity=0.339  Sum_probs=435.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEECCHH-----HHCEEEEEEECCCCCEEECCCCEEEEEEEEEEEEE
Q ss_conf             5778888664799999999999999986431343441532-----32100046651799745764870816869779999
Q gi|254781103|r   63 RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP-----IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLY  137 (598)
Q Consensus        63 ~kk~~~~~k~Ri~il~~v~~ii~~il~~rl~~lq~~~~~~-----~~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i~  137 (598)
                      .++-....+.|+.+++++++++|.+|++||++||+++++.     ..++++...++|.||.||||||++||.|.+.|+|+
T Consensus        10 ~~~e~~~f~rR~~i~~~~i~ll~~vLi~RL~~LQii~~~~y~~~A~~~~~r~~~i~a~RG~I~DrnG~~LA~n~~~y~l~   89 (619)
T PRK10795         10 YTAESALFVRRALVAFLGILLLTGVLIANLYNLQIVRFTDYQTRSNENRIKLVPIAPSRGIIYDRNGIPLALNRTIYQIE   89 (619)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCEECCCCCEEEECCEEEEEE
T ss_conf             58899999999999999999999999999884133508999999972715888706999878989998966211774899


Q ss_pred             EEHHHHCCHHHHHHHHHHHHCCCCHHHHH---HHHHCCCCEEE--EECCCCHHHHHH--HHHHHCCCCEECCHHHHHHHH
Q ss_conf             97338099899999998880799989999---98513676289--613799999999--763101375012023333210
Q gi|254781103|r  138 VEPHKVISPDEIIEKLQIVLPNLDSEMIR---RKLSSETKFQW--LRRKLSPQQQKR--ILSFGLPGVGFRLEKSRFYPA  210 (598)
Q Consensus       138 i~P~~i~~~~~~~~~L~~il~~~~~~~i~---~~l~~~~~~~~--i~r~is~~~~~~--I~~~~lpGi~~~~~~~R~YP~  210 (598)
                      ++|..+.+.++.++.|+.++ +++.+++.   ++.+..++|.+  ++.++++++..+  ++++++|||.++.+++|+||+
T Consensus        90 i~P~~i~~~~~~~~~L~~il-~~~~~~i~~~~~~~~~~~~~~~i~~~~~l~~~~~a~~~~~~~~lpGv~i~~~~~R~YP~  168 (619)
T PRK10795         90 MMPEKVDNVQQTLDALRSVV-DLTDDDIAAFEKERARSHRFTSIPVKTNLTEVQVARFAVNQYRFPGVEVKGYKRRYYPY  168 (619)
T ss_pred             EEHHHCCCHHHHHHHHHHHH-CCCHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEEEEECCC
T ss_conf             98787469999999999871-98999999999998636686378853586888999998754248955777657886666


Q ss_pred             CCCCCCCCCCCCC---------------------CCCCCCCCEEECCCC-----CCCEEEECCC----------CCCCCC
Q ss_conf             0000011111124---------------------687512310001466-----8516895366----------676886
Q gi|254781103|r  211 ASHASHVVGYVDI---------------------DNRGITGIEKFLDMQ-----GLTRVFTTNK----------GEKNLQ  254 (598)
Q Consensus       211 ~~lashiiGyv~~---------------------d~~G~~GlE~~~d~~-----g~~~~~~~~~----------~~~~g~  254 (598)
                      +++++|||||++.                     |..|++|||++||+.     |....+.+.+          .+.+|+
T Consensus       169 g~~ashviGyvg~i~~~~~~~~~~~g~~~~y~~~~~vG~~GlE~~yd~~L~G~~G~~~~~vd~~G~~i~~~~~~~p~~G~  248 (619)
T PRK10795        169 GSALTHVIGYVSKINDKDVERLDKEGKLANYAATHDIGKLGIERYYEDVLHGQTGYEEVEVNNRGRVIRQLKEVPPQAGH  248 (619)
T ss_pred             CHHHHHHEEECCCCCHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             12455530210466777775420024443445201001475899999862899883599975888523543436899999


Q ss_pred             CCEEEEHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCC------------CCCCCCCCC
Q ss_conf             74255525767777764421001132343111223023203211121001473111344------------432322222
Q gi|254781103|r  255 PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKG------------KKEGWFNRI  322 (598)
Q Consensus       255 dI~lTID~~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~------------~~~~~~Nra  322 (598)
                      ||+||||.+||+++|++|..       .+|++|||||+|||||||||+|+||||.+.+.            ...++.|||
T Consensus       249 dv~LTID~~lQ~~~e~~L~~-------~~gavVvmd~~TGeILAmaS~P~fdpN~~~~~~~~~~~~~~~~~~~~p~~Nra  321 (619)
T PRK10795        249 DIYLTLDLKLQQYIETLLAG-------SRAAVVVTDPRTGGILALVSNPSYDPNLFVDGISSKDYSGLLNDPNTPLVNRA  321 (619)
T ss_pred             CEEEEECHHHHHHHHHHHHC-------CCCEEEEEECCCCCEEEEEECCCCCHHHHCCCCCHHHHHHHHCCCCCCCCCHH
T ss_conf             58999878999999999740-------77259999679884899981687784664157787889986338676520211


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCC--CCCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEECCCC
Q ss_conf             3324566432012356544302403204421336763222--1011234543-230039998550367123543202333
Q gi|254781103|r  323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG--KHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGI  399 (598)
Q Consensus       323 ~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~--~~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~lg~  399 (598)
                      +++.|||||||||+|++||||+|+++|++.+.|+|.+.+.  +.+++||+.+ +|.+|+.+||++|||++|++++.++|.
T Consensus       322 ~~~~yePGStfK~~t~~aaLe~g~i~~~~~~~~~g~~~~~~~~~~~~~~~~~g~G~~~~~~al~~SsNv~~~~i~~~lg~  401 (619)
T PRK10795        322 TQGVYPPASTVKPYVAVSALSAGVITRNTSLFDPGWWQLPGSEKRYRDWKKWGHGRLNVTKSLEESADTFFYQVAYDMGI  401 (619)
T ss_pred             EECCCCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCEEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHCC
T ss_conf             01166898606999999999749999997796099337678862256688899974008889886355999999887052


Q ss_pred             CCCHHHCCCCCCCCCCCCCCCCCCCCCCCC----------CCCCCCCEECCCCCCC-EEEHHHCCCCCCHHHHCCEECCE
Q ss_conf             320011012225763446865421111223----------3554410011468752-13001002211001107823010
Q gi|254781103|r  400 QGHKEFLYRLGLLSKLETELPEIQAPSYPS----------QWKRIHSLTISFGHGL-STTPLQTAVAAAALINEGRLIPP  468 (598)
Q Consensus       400 ~~~~~~~~~fG~g~~t~idlp~e~~g~~p~----------~~~~~~~~~~~~Gqg~-~~TPlqla~~~atiAN~G~~~~P  468 (598)
                      +.+.+++++||||++||+|||+|+.|.+|.          .|...++++++||||+ ++||||||++|++|||+|++++|
T Consensus       402 ~~~~~~~~~fG~g~~tgi~lp~E~~G~~p~~~w~~~~~~~~w~~~~~~~~siGQG~~~~TPlQla~~~~aiaN~G~~~~P  481 (619)
T PRK10795        402 DRLSEWMGKFGYGHYTGIDLAEERSGNMPTREWKQKRFKKPWYQGDTIPVGIGQGYWTATPIQMSKALMILINDGIVKVP  481 (619)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             25544555327887668887665578678756654202466664545554120425563599999999999639808634


Q ss_pred             EEEEEEECCCCCCC--------CCCCCHHHHHHHHHHHHHHHC--CCCEEECCCC-CEEEEEECCEEEECCC---CCCCC
Q ss_conf             89998630788503--------201899999999999998733--8846410479-7357667240351268---87668
Q gi|254781103|r  469 TFMIRSREESEKVS--------RIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP-GFEVGGKTGTAQKVIK---KRYSD  534 (598)
Q Consensus       469 ~lv~~~~~~~~~~~--------~~vis~~~a~~l~~~l~~vv~--~GTg~~a~~~-g~~vaGKTGTAq~~~~---g~y~~  534 (598)
                      |+|+++.+....+.        ...+++++++.++++|+.||.  +|||+.+... +|+|||||||||+...   +.|..
T Consensus       482 ~lv~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~m~~Vv~~~~GT~~~~~~~~~~~vaGKTGTAqv~~~~~~~~~~~  561 (619)
T PRK10795        482 HLLMSTAEDGKQVPWVQPHEPPVGDIHSGYWEIAKDGMYGVANRPNGTAHKYFASAPYKIAAKSGTAQVFGLKANETYNA  561 (619)
T ss_pred             EEEEEECCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHEECCCCEEEHHCCCCCCEEEEEEECCEECCCCCCCCCCC
T ss_conf             79987514896642036665544555778999999999986727995256000589967999825324636678753234


Q ss_pred             ------CCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             ------8621799999742888099999980788888887432146789999999999998
Q gi|254781103|r  535 ------TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM  589 (598)
Q Consensus       535 ------~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~~~  589 (598)
                            -+.|+||+||||+|||+|+|+|+|++|.        +|..||||||+|+++++.-
T Consensus       562 ~~~~~~~~~hawf~gfaP~d~P~~av~V~ve~gg--------~G~~aapi~r~i~~~~l~~  614 (619)
T PRK10795        562 HKIAERLRDHKLMTAFAPYNNPQVAVAIILENGG--------AGPAVGTIMRQILDHIMLG  614 (619)
T ss_pred             CCCCCCCCCCEEEEEEEECCCCEEEEEEEEECCC--------CCCHHHHHHHHHHHHHHCC
T ss_conf             3345456777599999776898899999997998--------4026899999999999648


No 4  
>COG0768 FtsI Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=855.51  Aligned_cols=525  Identities=33%  Similarity=0.530  Sum_probs=461.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEECCHHH-----HCEEEEEEECCCCCEEECCCCEEEEEEEEEEEEEE
Q ss_conf             7788886647999999999999999864313434415323-----21000466517997457648708168697799999
Q gi|254781103|r   64 RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI-----APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYV  138 (598)
Q Consensus        64 kk~~~~~k~Ri~il~~v~~ii~~il~~rl~~lq~~~~~~~-----~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i~i  138 (598)
                      +........|+.+++++++++|.++++|++++|+++++.+     .+..+...++++||.|+||||++||+|.+.|+|++
T Consensus         7 ~~~~~~~~~r~~~~~~~i~~~~~~l~~~l~~~qi~~~~~~~~~~~~~~~~~~~~~~~RG~I~DRnG~~LA~n~~~~~l~~   86 (599)
T COG0768           7 KKKGRLFRRRLNLLFLIIFLLFALLILRLFYLQIVQGDDYAKEAANRNQRTVPIPAPRGDIYDRNGKVLATNVPVYSLTA   86 (599)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCEECCCCCEEEEECCEEEEEE
T ss_conf             45566789999999999999999999999999985057799997525564543478988767489988787346059999


Q ss_pred             EHHHHCCH------HHHHHHHHHHHCCCCHHHHHHHHHCCCC-EEEEECC--CCHHHHHHHHH--HHCCCCEECCHHHHH
Q ss_conf             73380998------9999999888079998999998513676-2896137--99999999763--101375012023333
Q gi|254781103|r  139 EPHKVISP------DEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK--LSPQQQKRILS--FGLPGVGFRLEKSRF  207 (598)
Q Consensus       139 ~P~~i~~~------~~~~~~L~~il~~~~~~~i~~~l~~~~~-~~~i~r~--is~~~~~~I~~--~~lpGi~~~~~~~R~  207 (598)
                      +|+.+.+.      ++....+.....+.+.+.+.++++.+.+ |.++.++  |++++..+|.+  +++|||.++++++|+
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~l~~~~~~~i~~~~~~lpGv~~~~~~~R~  166 (599)
T COG0768          87 DPRKITDEPLEATKDELAAKLLALLEDLDKRALLKELKSKSRLFTPLARKTNLTPEQAARIAELLLKLPGVDVETDSRRY  166 (599)
T ss_pred             EHHHHCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCCEEEHHHCCCCHHHHHHHHHHHCCCCCEEEEEEEEEE
T ss_conf             50140253034567788888753267746899998742255550671331578999999999853669956888604564


Q ss_pred             HHHCCCCCCCCCCCC---CCCCC--------CCCCEEECCCCC-----CCEEEECCCC----------CCCCCCCEEEEH
Q ss_conf             210000001111112---46875--------123100014668-----5168953666----------768867425552
Q gi|254781103|r  208 YPAASHASHVVGYVD---IDNRG--------ITGIEKFLDMQG-----LTRVFTTNKG----------EKNLQPIRLALD  261 (598)
Q Consensus       208 YP~~~lashiiGyv~---~d~~G--------~~GlE~~~d~~g-----~~~~~~~~~~----------~~~g~dI~lTID  261 (598)
                      ||++++++|++|||+   .|+.|        ++|||++||+.+     ...++.+.++          +.+|+||+||||
T Consensus       167 YP~g~~~~~v~g~vg~~~~~~~~~~~~~~iG~~GlE~~yd~~L~G~~g~~~~~~d~~G~~i~~~~~~~~~~G~dv~LTID  246 (599)
T COG0768         167 YPYGELASHVAGYVGKINEDELGRLKNEDIGKSGLEKSYDDVLRGKDGYREVEVDRRGNVIPTLKEVKPKDGKDVQLTID  246 (599)
T ss_pred             CCCCCCHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             78864012224741212565566433344104779999998727987736999879887644544368999985599888


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCHHH
Q ss_conf             576777776442100113234311122302320321112100147311134443-----232222233245664320123
Q gi|254781103|r  262 LRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKK-----EGWFNRISYGIFEMGSIFKVF  336 (598)
Q Consensus       262 ~~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~-----~~~~Nra~~~~yePGStfKp~  336 (598)
                      .++|+.+|++|.++++ +++++|++|||||+|||||||||.|+||||++.....     .++.||++++.|||||||||+
T Consensus       247 ~~lQ~~~e~~l~~~~~-~~~~~g~~vv~dp~tGeILAmas~P~ydpn~~~~~~~~~~~~~~~~n~a~~~~yePGStfK~~  325 (599)
T COG0768         247 LRLQKAAEEALDKAVA-NKAKGGAAVVLDPKTGEILAMASSPSYDPNLFVSSKDYDKPRKPLLNRAVTGTYEPGSTFKPI  325 (599)
T ss_pred             HHHHHHHHHHHHHHHH-CCCCCEEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCHHHHHH
T ss_conf             9999999999998765-266604899981788848999568999986223321002334202447551704782108999


Q ss_pred             HHHHHHHC---CCEECCCCCCCCCC-CCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCC
Q ss_conf             56544302---40320442133676-322210112345432300399985503671235432023333200110122257
Q gi|254781103|r  337 TIAMGIDS---GLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL  412 (598)
Q Consensus       337 t~aaaLe~---g~i~~~~~~~~~~~-~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g  412 (598)
                      |++|||++   +.++|++.++|+++ +.+++..+++++..  .+|+.+||.+|||++|+++++.+|++.+.+++++||||
T Consensus       326 t~aaaL~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~al~~SsNv~f~~la~~~g~~~~~~~~~~fGfg  403 (599)
T COG0768         326 TAAAALETGNTGLFDPGSVLDGNGPKIRIWGRTGHDYGGR--PLTLTEALQKSSNVGFAKLALRLGPDGLYDYLKKFGFG  403 (599)
T ss_pred             HHHHHHHCCCCCCCCCCCEEECCCCEEEECCCCCCCCCCC--CCCHHHHHHHHCHHHHHHHHHHHCHHHHHHHHHHCCCC
T ss_conf             9999997699853489854736986164188156787763--12899998870809999999985858899999876998


Q ss_pred             CCCCCCCCCCCCCCCCC----CCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCC-------CCC
Q ss_conf             63446865421111223----3554410011468752130010022110011078230108999863078-------850
Q gi|254781103|r  413 SKLETELPEIQAPSYPS----QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES-------EKV  481 (598)
Q Consensus       413 ~~t~idlp~e~~g~~p~----~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~-------~~~  481 (598)
                      ++|++|||+|..|.+|+    .|++++++++|||||+++||||||++|++|||+|++++||+++++.+..       ++.
T Consensus       404 ~~t~idl~~e~~g~~p~~~~~~~~~~~~~~~siGQ~~~vTPlQla~~~a~iaN~G~~~~P~lv~~~~~~~~~~~~~~~~~  483 (599)
T COG0768         404 QKTGIDLPGETSGLLPSREPWRWGPIDLATLSIGQGLLVTPLQLAQAYATIANGGKLVKPHLVKGIEDPVGENKKEPPVL  483 (599)
T ss_pred             CCCCCCCCCCCCCCCCCCHHCCCCCCCEEEECCCCCCCCCHHHHHHHHHHHHCCCEEECCEEEECCCCCCCCCCCCCCCC
T ss_conf             75567986642565798200136721124404787402089999999999962997942589712446555421246643


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCC---CEEECCCCCEEEEEECCEEEECCC--CCCCCCCCEEEEEEEEECCCCEEEEEE
Q ss_conf             320189999999999999873388---464104797357667240351268--876688621799999742888099999
Q gi|254781103|r  482 SRIVLKKNTVKTMRSLLREGVTGG---SGRRAFVPGFEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLS  556 (598)
Q Consensus       482 ~~~vis~~~a~~l~~~l~~vv~~G---Tg~~a~~~g~~vaGKTGTAq~~~~--g~y~~~~~~~~FvG~~P~~dP~~~v~V  556 (598)
                      .++++|+++++.++++|+.|++.|   +|+.+.++||+|||||||||+...  ++|..+.+|+||+||||++||+|+++|
T Consensus       484 ~~~~is~~~~~~v~~~m~~Vv~~~~gg~~~~a~v~g~~iaGKTGTAq~~~~~~~~y~~~~~~~~Fvg~aP~d~P~~~v~v  563 (599)
T COG0768         484 KKRVISPETAEKVREGMRAVVNDGGGGTGKAAAVPGYRIAGKTGTAQKAGPGGGGYSKGRYHAWFVGFAPADNPKYAVAV  563 (599)
T ss_pred             CCCCCCHHHHHHHHHHHHHHEECCCCCCCCCCCCCCCCEEEEECCCEECCCCCCCCCCCCCEEEEEEEEECCCCCEEEEE
T ss_conf             45558999999999999987717877641104568952376501150334788863456534899997416899799999


Q ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             9807888888874321467899999999999981899855
Q gi|254781103|r  557 FMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF  596 (598)
Q Consensus       557 ~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~~~~~i~P~~  596 (598)
                      +|++|+..     +|+.+|||+|++|+++++.+++++|+.
T Consensus       564 ~v~~~~~~-----~g~~~aapv~~~I~~~~~~~~~~~~~~  598 (599)
T COG0768         564 LVDNPGGG-----YGGAVAAPVFKKIMERLLDYLNVKPDA  598 (599)
T ss_pred             EEECCCCC-----CCHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99778877-----623567999999999999973456568


No 5  
>pfam00905 Transpeptidase Penicillin binding protein transpeptidase domain. The active site serine is conserved in all members of this family.
Probab=100.00  E-value=0  Score=555.93  Aligned_cols=292  Identities=33%  Similarity=0.529  Sum_probs=270.1

Q ss_pred             CEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCC
Q ss_conf             11122302320321112100147311134443232222233245664320123565443024032044213367632221
Q gi|254781103|r  284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK  363 (598)
Q Consensus       284 gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~  363 (598)
                      |++|+|||+||+||||||.|+||||+.    ...+.|||+++.||||||||||++++|||+|++++++.++|++.+..++
T Consensus         1 Ga~Vv~d~~TG~IlAm~~~p~~~~~~~----~~~~~n~a~~~~~~PGStfKp~~~aaaLe~g~~~~~~~~~~~~~~~~~~   76 (296)
T pfam00905         1 GSAVVLDPKTGEVLAMAGKPSYDPNRD----KEPLRNRAVQDVYEPGSTFKIFTALAALDNGILKPEETFDDWPGLPVGG   76 (296)
T ss_pred             CEEEEEECCCCCEEEEEECCCCCCCCC----CCCCCCHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             959999899992999986898897876----6422218766865884899999999999879988761114776434799


Q ss_pred             CCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCC
Q ss_conf             011234543-2300399985503671235432023333200110122257634468654211112233554410011468
Q gi|254781103|r  364 HVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFG  442 (598)
Q Consensus       364 ~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~G  442 (598)
                      +.++||+.. +|.+++++||++|||++|+++++++|.+++.+++++|||++++++|+|+|..+.+|. |...+.++++||
T Consensus        77 ~~~~n~~~~~~G~~tl~~al~~S~N~~~~~l~~~lg~~~~~~~~~~~G~g~~~~~~~~~e~~g~~~~-~~~~~~~~~~~G  155 (296)
T pfam00905        77 YTIKDWNQDGSGTITLREALEYSSNWYFQQLALKLGKDKLRDYLKKFGYGNKTGIGLPGESAGILPP-RYRGDGATTAWG  155 (296)
T ss_pred             CCEECCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHEEEE
T ss_conf             3224689998875549999985096778999997084789999997188877688886443566777-554310101010


Q ss_pred             CC-CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCC--CCCCCCCHHHHHHHHHHHHHHHCCCCEEECCCCCEEEEE
Q ss_conf             75-213001002211001107823010899986307885--032018999999999999987338846410479735766
Q gi|254781103|r  443 HG-LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG  519 (598)
Q Consensus       443 qg-~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~--~~~~vis~~~a~~l~~~l~~vv~~GTg~~a~~~g~~vaG  519 (598)
                      || +.+||||||++|++|||+|.+++||+|+++.+..+.  ..++++|+++++.++++|+.||++||++ +..++++|||
T Consensus       156 ~G~~~vTplq~a~aya~iAN~G~~~~p~~v~~i~~~~~~~~~~~~~is~~~a~~v~~~l~~vv~~gt~~-~~~~~~~vaG  234 (296)
T pfam00905       156 QGSLTITPLQQAQAYATIANNGKLVPPHIVKSIKKLVDPKVLGKLPISKSTAEKVKDMLKLVVNDGGGA-AAVPGYKVAG  234 (296)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCEEECCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCC-CCCCCCCEEE
T ss_conf             676622699999999998719968376999500147898222340389999999999998507788743-3468972689


Q ss_pred             ECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             72403512688766886217999997428880999999807888888874321467899999999
Q gi|254781103|r  520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR  584 (598)
Q Consensus       520 KTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~  584 (598)
                      ||||||+...++|.++.+++||+||+|++||+|+++|||++|+..   +.+||.+|||||++||+
T Consensus       235 KTGTaq~~~~~~~~~~~~~awFvG~~P~~~p~~~v~V~v~~~~~~---~~~Gg~~AaPi~~~i~~  296 (296)
T pfam00905       235 KTGTAQVAGKGGYKDGTYNGWFVGYAPADNPKYAFAVLIDDPKGD---GGAGGKVAAPIFKDILE  296 (296)
T ss_pred             EEECCEECCCCCCCCCCEEEEEEEEEECCCCEEEEEEEECCCCCC---CCCHHHHHHHHHHHHHC
T ss_conf             982536658888878865899999998799829999998668989---98606899999999869


No 6  
>TIGR02074 PBP_1a_fam penicillin-binding protein, 1A family; InterPro: IPR011816    Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (IPR011813 from INTERPRO). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages.; GO: 0008233 peptidase activity, 0016763 transferase activity transferring pentosyl groups, 0009252 peptidoglycan biosynthetic process, 0046677 response to antibiotic.
Probab=100.00  E-value=0  Score=467.89  Aligned_cols=313  Identities=25%  Similarity=0.368  Sum_probs=260.1

Q ss_pred             CCCCCCEEEEHHHHHHHHHHHHHHHCCCC----CC---------------------------------------------
Q ss_conf             68867425552576777776442100113----23---------------------------------------------
Q gi|254781103|r  251 KNLQPIRLALDLRIQNIVHQELVENKKKY----NA---------------------------------------------  281 (598)
Q Consensus       251 ~~g~dI~lTID~~lQ~~~e~~l~~~~~~~----~a---------------------------------------------  281 (598)
                      ..|..|+||||.++|+.+|+.|.+.+...    +.                                             
T Consensus       239 ~~Gl~iyTtlD~~~Q~~Ae~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  318 (700)
T TIGR02074       239 QGGLKIYTTLDLDMQKAAEKVLREGLREAGKQAGVRKSSESIILEELYEEKELLSLLSGLKTLLAKVRKVKKDAKKERVV  318 (700)
T ss_pred             HCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEECCCHHHCCCHHCCC
T ss_conf             38989999448689999999997210223542014776112221232238887555414510133110011001110001


Q ss_pred             ------------------------------------------------CCCEEEEEECCCHHHHHHHHHCCCCCCCCCCC
Q ss_conf             ------------------------------------------------43111223023203211121001473111344
Q gi|254781103|r  282 ------------------------------------------------ESVGTVILNVSTGEVISMVSIPDYDPHEAFKG  313 (598)
Q Consensus       282 ------------------------------------------------~~gavVvmd~~TGeILAmas~P~~dpn~~~~~  313 (598)
                                                                      ..||.|+|||+||+|+|||+.-+|..+-.   
T Consensus       319 i~Li~g~~~~~~~~~~~~~~~~NK~~~~~~gvi~v~~~~~~~~~~~~~~q~A~V~~D~~TG~v~A~VGG~dy~~~v~---  395 (700)
T TIGR02074       319 IDLIDGKAKIEIVDLLKAAKKDNKSVDLKKGVIVVKNKLGRALIAIPDLQAALVAIDPKTGAVRALVGGRDYGENVS---  395 (700)
T ss_pred             CCCCCCCEEHHHHHHHHHHHHHCCEEEECCCEEEEEECCCCHHHHCCCCCEEEEEEECCCCEEEEEECCEECCCCCC---
T ss_conf             24754110023355567787617804421447998306870232053325006898458976899874612377764---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHH-HHHHHHHCC-CEECCCCCCCCCCCCC-------CCCCCCCCCCC-CCCCCHHHHHH
Q ss_conf             43232222233245664320123-565443024-0320442133676322-------21011234543-23003999855
Q gi|254781103|r  314 KKEGWFNRISYGIFEMGSIFKVF-TIAMGIDSG-LFTVKDLFDTRNPIKV-------GKHVIHDYHPQ-NRILTIPEIFR  383 (598)
Q Consensus       314 ~~~~~~Nra~~~~yePGStfKp~-t~aaaLe~g-~i~~~~~~~~~~~~~~-------~~~~i~~~~~~-~g~it~~~al~  383 (598)
                         .-+|||++...+|||||||| +|++|||.| .++|++.++|. |..+       +.|.++||++. .|.||+++||+
T Consensus       396 ---~~fNRAT~a~RQPGStfKPf~VY~~Ale~G~~~~~~~~~~D~-P~~~~~~~~~G~~w~P~Ny~g~y~G~vtl~~ALa  471 (700)
T TIGR02074       396 ---SQFNRATQAKRQPGSTFKPFAVYAAALEKGLKYTPASILDDE-PITYSGDPGNGGGWEPKNYGGKYRGNVTLRQALA  471 (700)
T ss_pred             ---CCCCHHEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEC-CEEECCCCCCCCCCCEECCCCCEEECCCHHHHHH
T ss_conf             ---464201000268651265799999999850434701033303-3453588898895030006881461332999975


Q ss_pred             CCCCCEEEEEEECCC-CCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCE----EEHHHCCCCCCH
Q ss_conf             036712354320233-332001101222576344686542111122335544100114687521----300100221100
Q gi|254781103|r  384 YSSNIGAAQIADAMG-IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS----TTPLQTAVAAAA  458 (598)
Q Consensus       384 ~S~Nv~~~~i~~~lg-~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~----~TPlqla~~~at  458 (598)
                      +|.|+++++|++++| .+...+++++|||..+-..   +   -      ..-...++++| ++.    +||||||.||++
T Consensus       472 ~S~N~pAv~l~~~vG~~~~~~~~~~~~Gi~~~~~~---E---~------T~~~~~s~ALG-~~e~~~Gv~pl~~A~AYa~  538 (700)
T TIGR02074       472 QSINIPAVKLLDEVGFLDKVVALAKRFGITSPELP---E---K------TLDPVLSLALG-TVESRKGVSPLEMASAYAV  538 (700)
T ss_pred             HCCCHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCC---C---C------CCCCCCCEEEC-CCCCCCCCCHHHHHHHHHH
T ss_conf             12238999999870782799999997088787666---6---5------88875650106-6543447568999987677


Q ss_pred             HHHCCEECCEEEEEEEECC-CCC------------------CCCCCCCHHHHHHHHHHHHHHHCCCCEEECC----CCCE
Q ss_conf             1107823010899986307-885------------------0320189999999999999873388464104----7973
Q gi|254781103|r  459 LINEGRLIPPTFMIRSREE-SEK------------------VSRIVLKKNTVKTMRSLLREGVTGGSGRRAF----VPGF  515 (598)
Q Consensus       459 iAN~G~~~~P~lv~~~~~~-~~~------------------~~~~vis~~~a~~l~~~l~~vv~~GTg~~a~----~~g~  515 (598)
                      |||+|.+++||+|++|.+. .++                  ..+||+|+.++..|.+||+.||+ |||++|+    +.+.
T Consensus       539 FaN~G~~~eP~~I~~I~~~r~G~~~~~~~~~~~~a~~~~~~~~~~v~~~~~a~~m~~ml~~vv~-GTG~~A~~Y~~~~~~  617 (700)
T TIGR02074       539 FANGGKYVEPHFIRKIVDRRDGKVLYENERDDVLAKLKAKPETTQVISPATAYIMTDMLKSVVE-GTGRSAREYDKLPGR  617 (700)
T ss_pred             HHCCCEEECCEEEEEEEECCCCCEEEECCCCCEEEEEECCCCCCEECCHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCC
T ss_conf             6417800246379999864788363404777416653068876211288889999998878756-677877753430686


Q ss_pred             EEEEECCEEEECCC--CCC--CCCCCEEEEEEEEECCCCEEEEEEEEECCCC------CCCC---CCCCHHHHHHHHHHH
Q ss_conf             57667240351268--876--6886217999997428880999999807888------8888---743214678999999
Q gi|254781103|r  516 EVGGKTGTAQKVIK--KRY--SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI------KERN---QLTAGINVAPMVGNI  582 (598)
Q Consensus       516 ~vaGKTGTAq~~~~--g~y--~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~------~~~~---~~~Gg~~AaPi~~~I  582 (598)
                      +|||||||+|....  .+|  ..-..++|||||+|    +|+.+||+++-+.      +.+.   ..+|+.+|+|||+++
T Consensus       618 ~~AGKTGTT~~p~e~~~~y~~pSa~~D~WFvGyTP----~~v~aVW~G~D~~~~E~~~~~~~~a~~~~G~~~aa~~w~~f  693 (700)
T TIGR02074       618 PVAGKTGTTNNPEEETSKYIKPSAARDAWFVGYTP----YYVTAVWVGYDDKKKEYKLTLGKGALEVTGGGLAAPIWRDF  693 (700)
T ss_pred             CCCCCCCCCCCCCHHHCCCCCCCCCCCCCEEECCC----CEEEEEEEEECCCCCCEEECCCCCEEEECCCCCCHHHHHHH
T ss_conf             32245488988713310343676554751350167----75899997404897431104665036515653107899999


Q ss_pred             HHHHHH
Q ss_conf             999999
Q gi|254781103|r  583 IRRSAS  588 (598)
Q Consensus       583 ~~~~~~  588 (598)
                      |+.+++
T Consensus       694 M~~a~~  699 (700)
T TIGR02074       694 MAEALK  699 (700)
T ss_pred             HHHHCC
T ss_conf             999605


No 7  
>PRK11636 mrcA peptidoglycan synthetase; Provisional
Probab=100.00  E-value=0  Score=429.35  Aligned_cols=269  Identities=22%  Similarity=0.312  Sum_probs=216.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCC-
Q ss_conf             3111223023203211121001473111344432322222332456643201235654430240320442133676322-
Q gi|254781103|r  283 SVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV-  361 (598)
Q Consensus       283 ~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~-  361 (598)
                      .|++|+|||+||+|+||++..+|..         .-+|||+++..||||+||||+|++|||+| ++|.+.++|. ++.. 
T Consensus       426 q~AlV~iDp~tG~V~A~vGG~d~~~---------s~fNrA~qa~RQpGStfKPfvYaaAle~G-~t~~t~v~D~-Pi~~~  494 (850)
T PRK11636        426 NSALVSINPQNGAVMALVGGFDFNQ---------SKFNRATQALRQVGSNIKPFLYTAAMDKG-LTLASMLNDV-PISRW  494 (850)
T ss_pred             CCEEEEEECCCCCEEEEECCCCCCC---------CCCCHHHHCCCCCCCCHHHHHHHHHHHCC-CCCCCEECCC-CCEEE
T ss_conf             1217986067783467516756421---------13225443444788651789999999749-9964450587-71230


Q ss_pred             -----CCCCCCCCCC-CCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             -----2101123454-3230039998550367123543202333320011012225763446865421111223355441
Q gi|254781103|r  362 -----GKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIH  435 (598)
Q Consensus       362 -----~~~~i~~~~~-~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~  435 (598)
                           ..|.++|+++ +.|.+++++||++|.|++++++.+.+|++.+.+++++|||..+   +++              .
T Consensus       495 ~~~~g~~w~P~N~~~~~~G~vtlr~AL~~S~N~~aVrl~~~vG~~~~~~~~~~~Gi~~~---~~~--------------~  557 (850)
T PRK11636        495 DAGAGSDWRPKNSPPQYAGPIRLRQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQ---NIV--------------H  557 (850)
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHCHHHHHHHHHHCCCCCC---CCC--------------C
T ss_conf             27888866700799883886999999984847999999998696999999998499855---667--------------6


Q ss_pred             CEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCC---------------------------------
Q ss_conf             00114687521300100221100110782301089998630788503---------------------------------
Q gi|254781103|r  436 SLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS---------------------------------  482 (598)
Q Consensus       436 ~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~---------------------------------  482 (598)
                      ..++++| +..+|||+||.|||+|||+|++++|++|.++.|.++++.                                 
T Consensus       558 ~~slaLG-s~~vtplema~AYatfAN~G~~~~P~~I~kI~D~~G~vi~~~~p~~~~~~~~~pv~~~~~~~~~~~~~~~~~  636 (850)
T PRK11636        558 TESLALG-SASFTPMQVARGYAVMANGGFLVDPYFISKIENDQGGVIFEAKPKVACPECDIPVIYGDTQKSNVLENNNVE  636 (850)
T ss_pred             CCCCCCC-CCCCCHHHHHHHHHHHHCCCEECCCEEEEEEECCCCCEEEECCCCCCCCCCCCCCCCCCCCCHHHHCCCHHH
T ss_conf             6320257-677679999999999973986616689999987999788743664345433433213444100110110123


Q ss_pred             -----------------------------------CCCCCHHHHHHHHHHHHHHHC-----CCCEEECC--CCCEEEEEE
Q ss_conf             -----------------------------------201899999999999998733-----88464104--797357667
Q gi|254781103|r  483 -----------------------------------RIVLKKNTVKTMRSLLREGVT-----GGSGRRAF--VPGFEVGGK  520 (598)
Q Consensus       483 -----------------------------------~~vis~~~a~~l~~~l~~vv~-----~GTg~~a~--~~g~~vaGK  520 (598)
                                                         .+++++.++..|.+||+.||.     .|||+++.  +.+.++|||
T Consensus       637 ~v~~~~~~~~~~~~~p~l~~~~~~~~~~~~~~~~~~~vi~~~~a~lm~~~l~~~v~~~~g~~GTg~~a~~~l~~~~~AGK  716 (850)
T PRK11636        637 DVAISQEQQNSSVPMPQLEQANQALVAQNGAQEYAPHVINTPLAFLIKSALNTNIFGEPGWMGTGWRAGRDLKRRDIGGK  716 (850)
T ss_pred             HHHHCCCCCCCCCCCHHHHHCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCCEEE
T ss_conf             32201223334566302321120122102221134201236889999999862013565567608887750479965257


Q ss_pred             CCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCC---------------CCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             2403512688766886217999997428880999999807888---------------8888743214678999999999
Q gi|254781103|r  521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI---------------KERNQLTAGINVAPMVGNIIRR  585 (598)
Q Consensus       521 TGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~---------------~~~~~~~Gg~~AaPi~~~I~~~  585 (598)
                      |||++         +..++||+||.|    +|++.|||+.-+.               ..+...+|+..|+|||.++|+.
T Consensus       717 TGTTn---------~~~DaWFvGytp----~~~~~VWvG~Dd~~~~lg~~~~~g~~~~~~~~~~~g~~~a~piW~~~M~~  783 (850)
T PRK11636        717 TGTTN---------SSKDAWFSGYGP----GVVTSVWIGFDDHRRNLGRTTASGAIKDQISGYEGGAKSAQPAWDAYMKA  783 (850)
T ss_pred             CCCCC---------CCCCEEEECCCC----CEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             77679---------971279962579----95899997015886645654445555555556554336679999999999


Q ss_pred             HHHHCCCC
Q ss_conf             99981899
Q gi|254781103|r  586 SASMLGVK  593 (598)
Q Consensus       586 ~~~~~~i~  593 (598)
                      ++.-+..+
T Consensus       784 a~~~~~~~  791 (850)
T PRK11636        784 VLEGVPEQ  791 (850)
T ss_pred             HHCCCCCC
T ss_conf             97269978


No 8  
>PRK09506 mrcB penicillin-binding protein 1b; Reviewed
Probab=100.00  E-value=0  Score=421.18  Aligned_cols=302  Identities=17%  Similarity=0.213  Sum_probs=250.0

Q ss_pred             CCCCCEEEEHHHHHHHHHHHHHHHCCCCC------CCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             88674255525767777764421001132------343111223023203211121001473111344432322222332
Q gi|254781103|r  252 NLQPIRLALDLRIQNIVHQELVENKKKYN------AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYG  325 (598)
Q Consensus       252 ~g~dI~lTID~~lQ~~~e~~l~~~~~~~~------a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~  325 (598)
                      .|..|+||||+.+|..+|+++.+.+...+      ...+|+|+|||+||+|+||++..+|.         ..-+|||+++
T Consensus       432 ~GLkI~TTLDp~~Q~~AE~av~~~l~~l~~~~~~~~lq~A~VviD~~TG~V~AmVGG~d~~---------~sgfNRA~~A  502 (839)
T PRK09506        432 SGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVRAMVGGSEPQ---------FAGYNRAMQA  502 (839)
T ss_pred             CCCEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCEEEEEECCCCCC---------CCCCEEEEEC
T ss_conf             7706996389999999999999867887642277664057999978998599997488877---------6676134546


Q ss_pred             CCCCCCCCHHHHHHHHHHC-CCEECCCCCCCCCCCCC---CC--CCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEECCC
Q ss_conf             4566432012356544302-40320442133676322---21--011234543-23003999855036712354320233
Q gi|254781103|r  326 IFEMGSIFKVFTIAMGIDS-GLFTVKDLFDTRNPIKV---GK--HVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMG  398 (598)
Q Consensus       326 ~yePGStfKp~t~aaaLe~-g~i~~~~~~~~~~~~~~---~~--~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~lg  398 (598)
                      ..+|||+||||++++||++ +.+++++.++|. ++.+   +|  |.++|+++. +|.+++++||++|.|++++++++.+|
T Consensus       503 ~RQ~GSt~KPfvY~aAL~~~~~~~~~T~l~D~-Pi~~~~~~G~~W~P~Nyd~~~~G~VtLr~ALa~S~N~paVrL~~~vG  581 (839)
T PRK09506        503 RRSIGSLAKPATYLTALSQPDKYRLNTWIADA-PISLRQPNGQVWSPQNDDRRYSGRVMLVDALTRSMNVPTVNLGMALG  581 (839)
T ss_pred             CCCCCCCCCHHHHHHHHHCCCCCCCCCEECCC-CEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHC
T ss_conf             77997651189999998667997776452453-54864689874388648998657121999998583899999999879


Q ss_pred             CCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCC
Q ss_conf             33200110122257634468654211112233554410011468752130010022110011078230108999863078
Q gi|254781103|r  399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES  478 (598)
Q Consensus       399 ~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~  478 (598)
                      .+++.+++++||+....   ++              ...++++| +..+||++||++|+||||+|.+++|+.|.++.+.+
T Consensus       582 l~~v~~~~~~lGi~~~~---~~--------------~~pSlaLG-a~evSplemA~AYatfAN~G~~~~p~~I~~V~d~~  643 (839)
T PRK09506        582 LPAVTDTWIKLGVPKDQ---LN--------------PVPAMLLG-ALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAED  643 (839)
T ss_pred             HHHHHHHHHHCCCCCCC---CC--------------CCCCEEEC-CCCCCHHHHHHHHHHHHCCCEECCCEEEEEEECCC
T ss_conf             89999999986998666---88--------------88673107-78888999999999997598773888999999899


Q ss_pred             CCC-------CCCCCCHHHHHHHHHHHHHHHCCCCEEEC--CCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCC
Q ss_conf             850-------32018999999999999987338846410--479735766724035126887668862179999974288
Q gi|254781103|r  479 EKV-------SRIVLKKNTVKTMRSLLREGVTGGSGRRA--FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD  549 (598)
Q Consensus       479 ~~~-------~~~vis~~~a~~l~~~l~~vv~~GTg~~a--~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~d  549 (598)
                      +.+       .+++++++++..+.++|++||+.|||+.+  ..+++.+||||||+         ++..++||+||.|   
T Consensus       644 G~vl~~~~p~~~rvis~~~A~l~~~~L~~Vv~~GTgr~l~~~~p~~~vAGKTGTT---------nd~rDaWFvG~T~---  711 (839)
T PRK09506        644 GKVLYQSFPQAERAVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTT---------NNNVDTWFAGIDG---  711 (839)
T ss_pred             CCEEEECCCCCCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHCCCCCCCEEECCCC---------CCCEEEEEEEECC---
T ss_conf             9988306998650379999999999999986525524466248998514788887---------9982169985369---


Q ss_pred             CEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH--HHCCCCCC
Q ss_conf             80999999807888888874321467899999999999--98189985
Q gi|254781103|r  550 PQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA--SMLGVKPV  595 (598)
Q Consensus       550 P~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~--~~~~i~P~  595 (598)
                       +|+++|||++.+... ...+|++.|.|||+++|++.-  |+.-.+|+
T Consensus       712 -~~v~~VWvG~DdN~p-~~ltG~sgAl~iw~~~m~~~~~~~l~~~~p~  757 (839)
T PRK09506        712 -SEVTITWVGRDNNQP-TKLYGASGAMTIYQRYLANQTPTPLNLTPPE  757 (839)
T ss_pred             -CEEEEEEEECCCCCC-CCCCCCHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             -959999982568998-7886413279999999973699776678999


No 9  
>COG5009 MrcA Membrane carboxypeptidase/penicillin-binding protein [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=411.66  Aligned_cols=266  Identities=27%  Similarity=0.375  Sum_probs=222.3

Q ss_pred             CCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCC
Q ss_conf             31112230232032111210014731113444323222223324566432012356544302403204421336763222
Q gi|254781103|r  283 SVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG  362 (598)
Q Consensus       283 ~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~  362 (598)
                      .|+.|+|||+||.|+|||+.=+|.-         .-+|||+|+..||||.||||+|+||||+| ++|.+.++|. ++.+.
T Consensus       420 ~gAlVsmdp~tG~I~AlVGGfsf~~---------SkFNRATQA~rQPGSsfKPfvYsAALd~G-~T~asvi~Da-Pi~~~  488 (797)
T COG5009         420 NGALVSLDPKTGAILALVGGFSFAQ---------SKFNRATQALRQPGSSFKPFVYSAALDKG-LTPASVINDA-PISFW  488 (797)
T ss_pred             CCCEEEEECCCCEEEEEECCCCCCH---------HHHHHHHHHHHCCCCCHHHHHHHHHHHCC-CCHHHEECCC-CEEEE
T ss_conf             5626997079870899863634322---------24447777641798521278999998649-9876701378-84664


Q ss_pred             ------CCCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             ------1011234543-230039998550367123543202333320011012225763446865421111223355441
Q gi|254781103|r  363 ------KHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIH  435 (598)
Q Consensus       363 ------~~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~  435 (598)
                            -|.+.|+++. .|+++++++|.+|.|+.++++++.+|.+...+|+++|||-..   ++|              .
T Consensus       489 ~~~~~~~W~PkNy~gk~~Gp~~lR~gL~qSrNl~aVR~l~~vG~d~~~ey~~rfG~~~d---~~~--------------~  551 (797)
T COG5009         489 DGGGGGVWRPKNYGGKFAGPITLRQGLEQSRNLVAVRLLDAVGVDYAAEYIKRFGFYTD---ELP--------------P  551 (797)
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHCCCCC---CCC--------------C
T ss_conf             69988752778889875673389999997012899999998575999999998497745---668--------------5


Q ss_pred             CEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCC---------C-------------------CCCCC
Q ss_conf             0011468752130010022110011078230108999863078850---------3-------------------20189
Q gi|254781103|r  436 SLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV---------S-------------------RIVLK  487 (598)
Q Consensus       436 ~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~---------~-------------------~~vis  487 (598)
                      ..+|+.| ..++||||||++||+|||||+.++|++|+++.|..+++         .                   .||++
T Consensus       552 ~~smALG-s~e~Tplqma~AYaVfaNGG~~VeP~~I~~I~Dr~Gkvif~~~p~~~~~~~~~~~~~~~~~~~~~~~~qVid  630 (797)
T COG5009         552 VLSMALG-SGETTPLQMARAYAVFANGGKRVEPYFIDRIEDRNGKVIFRAEPRVCCRCNADEANNQEEQTLADYAPQVID  630 (797)
T ss_pred             CCCEECC-CCCCCHHHHHHHHHHHHCCCEEECCEEEEEEECCCCCEEEECCCHHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             4121114-335428998766763106980756444453654888667535815654422332235555432235240268


Q ss_pred             HHHHHHHHHHHHHHHCCCCEEECCCCCEE-EEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEE--ECCCCC
Q ss_conf             99999999999987338846410479735-766724035126887668862179999974288809999998--078888
Q gi|254781103|r  488 KNTVKTMRSLLREGVTGGSGRRAFVPGFE-VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFM--DSPKIK  564 (598)
Q Consensus       488 ~~~a~~l~~~l~~vv~~GTg~~a~~~g~~-vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v--~~p~~~  564 (598)
                      +.+++.+.+||+.||..|||+++..-+.+ |||||||.+         +..++||+||.|    .+|..|||  |+|+.-
T Consensus       631 ~~~ay~itsml~~vv~~GT~~~a~~L~r~DiAGKTGTTN---------d~kDAWfvGy~P----~~Vt~vwvGfD~~rsL  697 (797)
T COG5009         631 PMTAYQITSMLRGVVQRGTAARAGRLGRPDIAGKTGTTN---------DSKDAWFVGYTP----DLVTGVWVGFDHPRSL  697 (797)
T ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHHCCCCCCCCCCCCCC---------CCCCEEEECCCC----CEEEEEEEECCCCCCC
T ss_conf             337899999998888603377787439854366777778---------765526733689----8268999866898667


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             888743214678999999999999818
Q gi|254781103|r  565 ERNQLTAGINVAPMVGNIIRRSASMLG  591 (598)
Q Consensus       565 ~~~~~~Gg~~AaPi~~~I~~~~~~~~~  591 (598)
                       +.+.+|+.+|+|+|.+.|+.++.-..
T Consensus       698 -G~~~tG~~~A~Piw~~fM~~alk~~P  723 (797)
T COG5009         698 -GRGETGGKLALPIWIDFMKVALKGKP  723 (797)
T ss_pred             -CCCCCCCCCCCCHHHHHHHHHHCCCC
T ss_conf             -67777877566469999999973898


No 10 
>PRK11240 penicillin-binding protein 1C; Provisional
Probab=100.00  E-value=0  Score=384.19  Aligned_cols=296  Identities=18%  Similarity=0.214  Sum_probs=241.4

Q ss_pred             CCCCEEEEHHHHHHHHHHHHHHHCCCCCC-CCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             86742555257677777644210011323-43111223023203211121001473111344432322222332456643
Q gi|254781103|r  253 LQPIRLALDLRIQNIVHQELVENKKKYNA-ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS  331 (598)
Q Consensus       253 g~dI~lTID~~lQ~~~e~~l~~~~~~~~a-~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGS  331 (598)
                      +.-|+||||..+|+.+|+.+.+....... .++++|+||++||+|+||++..+|..+..     ... ..+++...+|||
T Consensus       269 ~~~I~TTlD~~lQ~~~e~~~~~~~~~l~~~~~~A~vviD~~tg~V~A~VG~~d~~~~~~-----~g~-vd~~~A~RqPGS  342 (770)
T PRK11240        269 SDKIVTTLDAGLQRRLEDLAQNWKGRLPERSSLAMIVVDHTDMAVRGWVGSVDLNDDSR-----FGH-VDMVNAIRSPGS  342 (770)
T ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCEEEEEECCCCCCCCCC-----CCC-CCCCCCCCCCCC
T ss_conf             97499575999999999999877751687556359999789980899983766675444-----676-330203568962


Q ss_pred             CCHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCC
Q ss_conf             20123565443024032044213367632221011234543-23003999855036712354320233332001101222
Q gi|254781103|r  332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG  410 (598)
Q Consensus       332 tfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG  410 (598)
                      |||||+|++|||+|.++|++.+.| .+..+++|.++|++.. .|.+++++||++|.|++++++.+++|++++.+.++++|
T Consensus       343 tlKPfvYa~Ale~G~i~p~s~l~D-~P~~~g~y~P~Nfd~~~~G~vt~r~AL~~SlNipAV~ll~~~G~~~~~~~l~~~G  421 (770)
T PRK11240        343 VLKPFVYGLALDDGLIHPASLLQD-VPRRTGDYRPGNFDSGFHGPVSMSEALVRSLNLPAVQVLEAYGPKRFAAKLRNVG  421 (770)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEECC-CCCCCCCCCCCCCCCCCCCEEEHHHHHHHCCCHHHHHHHHHHCHHHHHHHHHHCC
T ss_conf             388999999997699998878416-8701488687027887206110999998654799999999879699999999739


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHH
Q ss_conf             57634468654211112233554410011468752130010022110011078230108999863078850320189999
Q gi|254781103|r  411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNT  490 (598)
Q Consensus       411 ~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~  490 (598)
                      +...    +|....   |       -.++++| |..+||++|+.+|++|||+|...+|++..    ..+...++++|+++
T Consensus       422 i~~~----l~~~~~---~-------~LslaLG-g~evtl~eLa~aYa~~An~G~~~~~~~~~----~~~~~~~~v~s~~a  482 (770)
T PRK11240        422 LPLY----LPAGAA---P-------NLSLILG-GAGARLEDMAAAYSAFARHGKAAKLRLQP----DDPLLERPLMSPGA  482 (770)
T ss_pred             CCCC----CCCCCC---C-------CCCEECC-CCCCCHHHHHHHHHHHHCCCEECCCEECC----CCCCCCCCCCCHHH
T ss_conf             9756----787778---9-------8533315-76888999999999997798433517715----88633213688888


Q ss_pred             HHHHHHHHHHHHCCCCEEECCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCC
Q ss_conf             99999999987338846410479735766724035126887668862179999974288809999998078888888743
Q gi|254781103|r  491 VKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT  570 (598)
Q Consensus       491 a~~l~~~l~~vv~~GTg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~  570 (598)
                      +..+.++|.+++..++... ...+.++||||||++         +..++|||||.|    +|+++|||++|++....+.+
T Consensus       483 a~~~~~iL~~~~r~~~~~~-l~~~~pvAgKTGTS~---------g~RDaWfvG~tp----~ytvgVWvGn~Dg~p~~~~~  548 (770)
T PRK11240        483 AWIIRRIMADEAQPLPDAA-LPRVVPLAWKTGTSY---------GYRDAWAIGVNA----RYVIGIWTGRPDGTPVVGQF  548 (770)
T ss_pred             HHHHHHHHHHCCCCCHHHH-CCCCCCCEECCCCCC---------CCCCEEEEEECC----CEEEEEEEECCCCCCCCCCC
T ss_conf             9999999875044430110-023776244346788---------873338986359----85999998689999387740


Q ss_pred             CHHHHHHHHHHHHHHHHH
Q ss_conf             214678999999999999
Q gi|254781103|r  571 AGINVAPMVGNIIRRSAS  588 (598)
Q Consensus       571 Gg~~AaPi~~~I~~~~~~  588 (598)
                      |...||||+.+|++.+..
T Consensus       549 G~~~AaPllf~i~~~L~~  566 (770)
T PRK11240        549 GFASAVPLLNQVNNLLLS  566 (770)
T ss_pred             CHHHHHHHHHHHHHHHHH
T ss_conf             602358799999998532


No 11 
>COG0744 MrcB Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=377.95  Aligned_cols=302  Identities=24%  Similarity=0.317  Sum_probs=255.9

Q ss_pred             CCCCCCCEEEEHHHHHHHHHHHHH-HHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             768867425552576777776442-1001132343111223023203211121001473111344432322222332456
Q gi|254781103|r  250 EKNLQPIRLALDLRIQNIVHQELV-ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFE  328 (598)
Q Consensus       250 ~~~g~dI~lTID~~lQ~~~e~~l~-~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~ye  328 (598)
                      ...|..|+||||+.+|..+|+++. ......+...++.|++|++||+|+||++..+|.+.+         +|||++...+
T Consensus       293 ~~~gl~I~TTlD~~~Q~~ae~~v~~~~~~~~~~~q~a~v~~d~~tG~V~A~VGg~d~~~~~---------fNrAt~a~Rq  363 (661)
T COG0744         293 LTGGLKVYTTLDPELQEAAEKAVQADPLYKLRDVQAALVLIDPKTGAVRALVGGRDYQPSG---------FNRATQAKRQ  363 (661)
T ss_pred             HCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEEECCCCCEEEEECCCCCCCCC---------CCCCCCCCCC
T ss_conf             0498589957799999999999863046777650367999966898589997688898665---------3300003678


Q ss_pred             CCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCC--CCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHC
Q ss_conf             643201235654430240320442133676322210112345432--300399985503671235432023333200110
Q gi|254781103|r  329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQN--RILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL  406 (598)
Q Consensus       329 PGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~~--g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~  406 (598)
                      |||+||||++++|+++|..+|++.+.+ .++.++++.++|+++..  |.+++.+||++|.|++++++.+++|.+.+.+++
T Consensus       364 ~GSt~KP~~~~~a~~~~~~~~~~~~~d-~p~~~~~~~p~N~~~~y~~g~vtl~~ALa~S~Nipav~l~~~vG~~~~~~~~  442 (661)
T COG0744         364 PGSTFKPFLYYAALEEGKATPSTIVVD-APVTYGNWSPKNYDGRYEGGSVTLREALATSLNIPAVRLLQKVGLDKVVDTA  442 (661)
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCCEECC-CCEECCCCCCEECCCCCCCCEECHHHHHHCCCCHHHHHHHHHHCHHHHHHHH
T ss_conf             852588999999997389997744526-8722378887466786568526199998719999999999986748999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCC------
Q ss_conf             12225763446865421111223355441001146875213001002211001107823010899986307885------
Q gi|254781103|r  407 YRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK------  480 (598)
Q Consensus       407 ~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~------  480 (598)
                      ++||+..+..                  ...+++.| ...+||+|||++|++|||+|.+.+||+|.++.+.++.      
T Consensus       443 ~~lGi~~~~~------------------~~~s~~lg-~~~~sp~~ma~aY~~fangG~~~~p~~I~ki~~~~Gvl~~~~~  503 (661)
T COG0744         443 KKLGINSPLV------------------PGPSLALG-ASEVSPLEMASAYATFANGGTYYPPHFIRKVTDADGVLYDNPP  503 (661)
T ss_pred             HHHCCCCCCC------------------CCCCCCCC-CCCCCHHHHHHHHHHHHHCCEECCCEEEEEEECCCCCEEECCC
T ss_conf             9829988888------------------86522268-8889899999989999609833587468999889970763699


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCC-CCEEECCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEE
Q ss_conf             032018999999999999987338-8464104797357667240351268876688621799999742888099999980
Q gi|254781103|r  481 VSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD  559 (598)
Q Consensus       481 ~~~~vis~~~a~~l~~~l~~vv~~-GTg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~  559 (598)
                      ..+|+++++++..+.+||+.||+. |++..+...+...||||||++.         ..++|||||.|    +|+++||+.
T Consensus       504 ~~~rv~~~~~a~~m~~ml~~vv~~tg~~~~a~~~~~~~~GKTGTt~~---------~~D~WfvG~tp----~~~~avW~G  570 (661)
T COG0744         504 KVKRVLSPQAAYLMTDMLQGVVTPTGTGAAAKLPGPYAAGKTGTTND---------NRDAWFVGYTP----QLTTAVWLG  570 (661)
T ss_pred             CCEEEECHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC---------CCCEEEEEECC----CEEEEEEEE
T ss_conf             86363089899999999999876507610025676555665678898---------76417983158----758999984


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             78888888743214678999999999999818998
Q gi|254781103|r  560 SPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP  594 (598)
Q Consensus       560 ~p~~~~~~~~~Gg~~AaPi~~~I~~~~~~~~~i~P  594 (598)
                      +.+. .....+|++.++++|+++|+.+++.....|
T Consensus       571 ~d~~-~~~~~~g~s~~a~iw~~~m~~a~~~~~~~~  604 (661)
T COG0744         571 NDDN-PLTPLTGGSDAAAIWKEFMGQALPGGLRVP  604 (661)
T ss_pred             CCCC-CCCCCCCCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             5899-875676776189999999998722687778


No 12 
>TIGR02073 PBP_1c penicillin-binding protein 1C; InterPro: IPR011815    This entry contains penicillin binding proteins includes the member from Escherichia coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this entry are presumed to have the same basic function..
Probab=100.00  E-value=0  Score=357.09  Aligned_cols=304  Identities=19%  Similarity=0.234  Sum_probs=250.0

Q ss_pred             CCCEEEEHHHHHHHHHHHHHHHCCCCCCC---CCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             67425552576777776442100113234---311122302320321112100147311134443232222233245664
Q gi|254781103|r  254 QPIRLALDLRIQNIVHQELVENKKKYNAE---SVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG  330 (598)
Q Consensus       254 ~dI~lTID~~lQ~~~e~~l~~~~~~~~a~---~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePG  330 (598)
                      .-|++|||.+||..+|+.+++...+.+.+   +.|++|||..+|+|+|.|++-+|+-  .   ....+.| ++++.+.||
T Consensus       254 s~i~sTlD~~LQ~~~E~~~~~~~~~l~~~gi~~~A~lVvD~~s~~V~A~vGS~df~d--~---~~~gqVD-~v~A~RSpG  327 (786)
T TIGR02073       254 SKIVSTLDADLQRRLEELARRYLSALRPRGISNLAILVVDNRSGAVLAYVGSADFFD--D---SNAGQVD-GVRAIRSPG  327 (786)
T ss_pred             CEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCEEEEEECCCCCC--C---CCCEEEE-EEECCCCCC
T ss_conf             736762474479999999999998618688302578899717982699982456766--1---3050461-476676678


Q ss_pred             CCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCC----CCCCCCCC-CCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHH
Q ss_conf             320123565443024032044213367632221----01123454-3230039998550367123543202333320011
Q gi|254781103|r  331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK----HVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF  405 (598)
Q Consensus       331 StfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~----~~i~~~~~-~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~  405 (598)
                      ||.|||.|+.|||+|.++|++...|. |..+++    |.+.||+. .+|.+++++||.+|.||++|.+++++|+++|+++
T Consensus       328 StLKPFlYaLald~G~~~p~slL~D~-P~~fg~~SG~Y~P~Nf~~~F~G~V~v~~AL~~SLNiPAV~ll~~~g~~~f~~~  406 (786)
T TIGR02073       328 STLKPFLYALALDDGLIHPDSLLKDV-PLRFGDVSGLYAPENFDKTFHGPVPVREALARSLNIPAVRLLERLGPPRFASF  406 (786)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHC-CHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCHHHHHHHHCCHHHHHHH
T ss_conf             64318999856565211201010101-21014723332678877764677639998643067148999974292689999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCC------
Q ss_conf             01222576344686542111122335544100114687521300100221100110782301089998630788------
Q gi|254781103|r  406 LYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE------  479 (598)
Q Consensus       406 ~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~------  479 (598)
                      +++.|+....            ++.. ...-.++..| |-.+|-.|||++|+++||.|...+|+..........      
T Consensus       407 L~~~G~~~~~------------~~~~-~~yGLSL~LG-G~e~tL~dLa~lY~~LA~~G~~~plr~~~~~~~~~~~~~~ke  472 (786)
T TIGR02073       407 LRQAGLKLLK------------PKSR-DYYGLSLILG-GAEITLQDLANLYAMLANQGLSGPLRFLQADAKRPEREESKE  472 (786)
T ss_pred             HHHHCCCCCC------------HHHH-CCCCCEEEEC-CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             9970565578------------0000-2576013123-017448999999999974266657421335456764124666


Q ss_pred             -CCCCCCCCHHHHHHHHHHHHHHHCC-CCEE-E-CCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEE
Q ss_conf             -5032018999999999999987338-8464-1-0479735766724035126887668862179999974288809999
Q gi|254781103|r  480 -KVSRIVLKKNTVKTMRSLLREGVTG-GSGR-R-AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVL  555 (598)
Q Consensus       480 -~~~~~vis~~~a~~l~~~l~~vv~~-GTg~-~-a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~  555 (598)
                       ....+++|+++|..+.++|++.-.. .+.. . +....+++|.|||||.         +..+||=|||++    +|+|+
T Consensus       473 Gnf~~rll~~~aa~~~~diL~~~~~p~~~~~~~~~~~~~~~~AwKTGTSy---------G~RDAWa~G~~~----~Yti~  539 (786)
T TIGR02073       473 GNFGTRLLSPGAAWIVLDILKDRPRPEDTLPKSSALSTRLPLAWKTGTSY---------GFRDAWAAGVSG----RYTIG  539 (786)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEECCCC---------CCCCCEEEECCC----CEEEE
T ss_conf             76688757888899999996037884211310023556653577626647---------872216861058----76899


Q ss_pred             EEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             998078888888743214678999999999999818
Q gi|254781103|r  556 SFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG  591 (598)
Q Consensus       556 V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~~~~~  591 (598)
                      ||++||+++.+.+.+|..+|||||.+|++.+..-..
T Consensus       540 VWvGn~~G~p~~~~~G~~~AaPllf~i~d~l~~~~~  575 (786)
T TIGR02073       540 VWVGNFDGKPNPGFIGAAAAAPLLFDILDALQASEA  575 (786)
T ss_pred             EEEECCCCCCCCCEEEHHHHHHHHHHHHHHHHHCCC
T ss_conf             974568999996402002344379999999763355


No 13 
>TIGR02071 PBP_1b penicillin-binding protein 1B; InterPro: IPR011813    Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in Escherichia coli and other Proteobacteria, designated penicillin-binding protein 1B.; GO: 0008233 peptidase activity, 0008955 peptidoglycan glycosyltransferase activity, 0009252 peptidoglycan biosynthetic process, 0046677 response to antibiotic, 0009274 peptidoglycan-based cell wall.
Probab=100.00  E-value=0  Score=347.82  Aligned_cols=297  Identities=17%  Similarity=0.228  Sum_probs=250.2

Q ss_pred             CCCCCCCCEEEEHHHHHHHHHHHHHHHCCCC--------CCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             6768867425552576777776442100113--------23431112230232032111210014731113444323222
Q gi|254781103|r  249 GEKNLQPIRLALDLRIQNIVHQELVENKKKY--------NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFN  320 (598)
Q Consensus       249 ~~~~g~dI~lTID~~lQ~~~e~~l~~~~~~~--------~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~N  320 (598)
                      ....|--|-||+|+..|..+|+++.+.+...        +.-.+|+||+|+.||||+|||+.         ..+..+-+|
T Consensus       371 ~~~~G~~iFTtlD~~~Q~~aE~av~~~~~~L~~~kG~~~~~LEaAmvv~D~~~GEvrA~vGg---------~~p~f~GFN  441 (742)
T TIGR02071       371 KDLSGLRIFTTLDPVSQSAAEQAVKETIPALKKKKGKKLKDLEAAMVVVDRFTGEVRALVGG---------RDPQFAGFN  441 (742)
T ss_pred             CCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCEEEEEECC---------CCCCCCCCH
T ss_conf             54578778843797899999987876457888750678885317788983688707888758---------788756010


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHC-CCEECCCCCCCCCCCCCC-----CCCCCCCCC-CCCCCCHHHHHHCCCCCEEEEE
Q ss_conf             223324566432012356544302-403204421336763222-----101123454-3230039998550367123543
Q gi|254781103|r  321 RISYGIFEMGSIFKVFTIAMGIDS-GLFTVKDLFDTRNPIKVG-----KHVIHDYHP-QNRILTIPEIFRYSSNIGAAQI  393 (598)
Q Consensus       321 ra~~~~yePGStfKp~t~aaaLe~-g~i~~~~~~~~~~~~~~~-----~~~i~~~~~-~~g~it~~~al~~S~Nv~~~~i  393 (598)
                      ||+++.++.||..||+||++||.+ ..++++|.+.+. |+.+.     -|.++|++. ++|.+-+-+||++|.|+++++|
T Consensus       442 RAl~A~R~iGSL~KP~vYLtALs~P~~Y~LnTw~~d~-P~~ik~~~G~~W~P~N~D~~~~g~V~L~dALa~S~N~pTV~l  520 (742)
T TIGR02071       442 RALQARRQIGSLVKPAVYLTALSQPDKYRLNTWIEDQ-PLSIKLSNGQVWSPRNYDRRYSGTVMLYDALARSLNIPTVNL  520 (742)
T ss_pred             HHHHCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCC-CEEEECCCCCCCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHH
T ss_conf             3641637764324368999972789731146642366-447756888724651477422562646789876531767886


Q ss_pred             EECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEE
Q ss_conf             20233332001101222576344686542111122335544100114687521300100221100110782301089998
Q gi|254781103|r  394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR  473 (598)
Q Consensus       394 ~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~  473 (598)
                      ++++|++++.+.+.++|..+..               |.+.  .+|..| .++.||+++|++|.||||||...+.+-|++
T Consensus       521 Gm~vGl~~V~~t~~~LG~~k~~---------------i~~~--PsmlLG-A~~ltP~evaq~YQtlAsgG~~~pL~avRS  582 (742)
T TIGR02071       521 GMKVGLDKVSQTLKKLGINKDE---------------IPPV--PSMLLG-AISLTPYEVAQLYQTLASGGERAPLSAVRS  582 (742)
T ss_pred             HHHCCHHHHHHHHHHHCCCCCC---------------CCCC--CHHHHC-CCCCCHHHHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             4631767899999982877120---------------4766--335521-136687899989977625775543102201


Q ss_pred             EECCCCCCC-------CCCCCHH--HHHHHHHHHHHHHCCCCEEECCC--C-CEEEEEECCEEEECCCCCCCCCCCEEEE
Q ss_conf             630788503-------2018999--99999999998733884641047--9-7357667240351268876688621799
Q gi|254781103|r  474 SREESEKVS-------RIVLKKN--TVKTMRSLLREGVTGGSGRRAFV--P-GFEVGGKTGTAQKVIKKRYSDTLNFNSF  541 (598)
Q Consensus       474 ~~~~~~~~~-------~~vis~~--~a~~l~~~l~~vv~~GTg~~a~~--~-g~~vaGKTGTAq~~~~g~y~~~~~~~~F  541 (598)
                      |.+.++++.       +++.+.+  +|+.+..+|++||++|||+....  + .+..||||||+         ++..++||
T Consensus       583 Vl~~dG~vLy~~~~~~~~~~p~~svAaylt~~AMQqvV~~GTaRsL~~~~~~~l~LAGKTGTt---------Nd~RDsWF  653 (742)
T TIGR02071       583 VLDEDGKVLYQSLPQAEQAVPSQSVAAYLTLYAMQQVVQRGTARSLGADFPSSLSLAGKTGTT---------NDSRDSWF  653 (742)
T ss_pred             EECCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCCCCCCCCCCC---------CCCCCEEE
T ss_conf             011477633017887454577420357767778775420120110010046665654563656---------88851047


Q ss_pred             EEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             9997428880999999807888888874321467899999999999
Q gi|254781103|r  542 LAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA  587 (598)
Q Consensus       542 vG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~  587 (598)
                      +||    |.+-+.+|||++ +.+.....||++.|--|+++++++.-
T Consensus       654 ~G~----dG~~~~~~W~GR-D~N~~TkLtGAsGAl~vy~~yL~~~~  694 (742)
T TIGR02071       654 VGI----DGKEVTIVWLGR-DDNGPTKLTGASGALQVYKRYLKYQT  694 (742)
T ss_pred             EEE----CCCEEEEEEEEC-CCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             764----387899999852-78988476453158999999985258


No 14 
>COG4953 PbpC Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=320.35  Aligned_cols=300  Identities=21%  Similarity=0.246  Sum_probs=245.2

Q ss_pred             CCCCCEEEEHHHHHHHHHHHHHHHCCCCCCC-CCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8867425552576777776442100113234-311122302320321112100147311134443232222233245664
Q gi|254781103|r  252 NLQPIRLALDLRIQNIVHQELVENKKKYNAE-SVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG  330 (598)
Q Consensus       252 ~g~dI~lTID~~lQ~~~e~~l~~~~~~~~a~-~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePG  330 (598)
                      .+.-|++|||..+|+.+|+...+......++ ++|++|+|.+||||||.|++++|+-+......      -.++....||
T Consensus       263 ~~~~I~tTLd~~lQr~lE~~ar~~~~~l~~~~saAvlvvD~~t~eVla~VGS~d~fd~~r~G~i------dm~~a~RSPG  336 (733)
T COG4953         263 KGDIIVTTLDANLQRRLEEQARDYASRLGPRNSAAVLVVDNRTMEVLAYVGSADFFDASRSGHI------DMVRALRSPG  336 (733)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCCCCCC------CCEEEECCCC
T ss_conf             9881565017558999999999998514876642699996577405788425455673213634------3113303885


Q ss_pred             CCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCC-CCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCC
Q ss_conf             32012356544302403204421336763222101123454-32300399985503671235432023333200110122
Q gi|254781103|r  331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL  409 (598)
Q Consensus       331 StfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~-~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~f  409 (598)
                      ||.|||+|+.|+|+|+|+|+|.+.|. +.++++|..+||+. .+|.+++++||.+|.|++++++.+++|+++|+.++++.
T Consensus       337 StLKPFiY~LA~D~GLI~p~Tll~D~-P~~fg~YrP~Nfd~~F~G~VsvreAL~~SLNiPAV~lLe~~gp~rf~~rl~~a  415 (733)
T COG4953         337 STLKPFVYGLAFDQGLIHPETLLKDV-PTRFGDYRPENFDSNFHGPVSVREALIKSLNIPAVRLLEAVGPPRFAARLRQA  415 (733)
T ss_pred             CCCCHHHHHHHHCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHCHHHHHHHHHHC
T ss_conf             30003665543014654653114678-70106758866665566740099999874386299999873939899999967


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHH
Q ss_conf             25763446865421111223355441001146875213001002211001107823010899986307885032018999
Q gi|254781103|r  410 GLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKN  489 (598)
Q Consensus       410 G~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~  489 (598)
                      |+.    +-+|...+.          -.++..| |-.+|+-+||++|+++||.|...+.+..   .++++...++.+|++
T Consensus       416 g~~----L~~P~~~~~----------GLsLiLG-g~gi~L~dLa~lYa~lAn~G~~~~L~~~---~~~~~~~~~~l~s~~  477 (733)
T COG4953         416 GVH----LYLPEGAAP----------GLSLILG-GAGITLEDLAQLYAALANQGKAGPLRDT---LDDDPLTERTLLSPG  477 (733)
T ss_pred             CCC----CCCCCCCCC----------CEEEEEC-CCCCCHHHHHHHHHHHHCCCCEECCCCC---CCCCCCCCCCCCCCC
T ss_conf             998----778976688----------7258855-7766499999999998618943104346---787888786356860


Q ss_pred             HHHHHHHHHHHHHCCCCEEECCCCC-EEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCC
Q ss_conf             9999999999873388464104797-357667240351268876688621799999742888099999980788888887
Q gi|254781103|r  490 TVKTMRSLLREGVTGGSGRRAFVPG-FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ  568 (598)
Q Consensus       490 ~a~~l~~~l~~vv~~GTg~~a~~~g-~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~  568 (598)
                      ++..+.+.|.++...|+...+. +. .+||.||||+-         +..++|-+||++    +|+++||+++|+++...+
T Consensus       478 Aaw~i~dIl~~~~~P~~~~~~~-~~~~piawKTGTSy---------GyRDAWsvG~~g----~Y~l~VWvGr~dg~~~~g  543 (733)
T COG4953         478 AAWQILDILSDVARPGLPNGAL-PSVRPIAWKTGTSY---------GYRDAWSVGVFG----RYVLGVWVGRFDGTPVPG  543 (733)
T ss_pred             HHHHHHHHHHCCCCCCCCCCCC-CCCCCEEEECCCCC---------CCCCCEEECCCC----CEEEEEEEECCCCCCCCC
T ss_conf             2799999985047988656676-65665057427766---------653314632358----658999974799984776


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             43214678999999999999818
Q gi|254781103|r  569 LTAGINVAPMVGNIIRRSASMLG  591 (598)
Q Consensus       569 ~~Gg~~AaPi~~~I~~~~~~~~~  591 (598)
                      .+|-..|||++-+|++. ...-+
T Consensus       544 ~~G~~~AaPLlf~v~~~-~~~~~  565 (733)
T COG4953         544 LSGVATAAPLLFQVNNI-IARSG  565 (733)
T ss_pred             CCCHHHHHHHHHHHHHH-HHCCC
T ss_conf             01423456789988888-64266


No 15 
>pfam03717 PBP_dimer Penicillin-binding Protein dimerization domain. This domain is found at the N terminus of Class B High Molecular Weight Penicillin-Binding Proteins. Its function has not been precisely defined, but is strongly implicated in PBP polymerisation. The domain forms a largely disordered 'sugar tongs' structure.
Probab=99.96  E-value=1.4e-28  Score=200.39  Aligned_cols=137  Identities=39%  Similarity=0.593  Sum_probs=120.1

Q ss_pred             ECCCCCEEECCCCEEEEEEEEEEEEEEEHHHHCCH-HHHHHHHHHHHCCCCHHHHHHHHHCC----CCEEEEECCCCHHH
Q ss_conf             51799745764870816869779999973380998-99999998880799989999985136----76289613799999
Q gi|254781103|r  112 YGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISP-DEIIEKLQIVLPNLDSEMIRRKLSSE----TKFQWLRRKLSPQQ  186 (598)
Q Consensus       112 i~a~RG~I~DRNG~~LA~n~~~y~i~i~P~~i~~~-~~~~~~L~~il~~~~~~~i~~~l~~~----~~~~~i~r~is~~~  186 (598)
                      ++|+||.||||||++||.|.+.|+|+++|..+.+. ++.++.|+.++ +++.+++.++++..    .+|++|+++|++++
T Consensus         1 i~a~RG~I~DrnG~~LA~n~~~~~l~i~p~~~~~~~~~~~~~L~~~l-~~~~~~~~~~l~~~~~~~~~~~~l~~~l~~~~   79 (165)
T pfam03717         1 IPAPRGEILDRNGRVLATNVPVYSVYVDPKEVEDELKETAEKLAKIL-GLDPEEILKKLKEKDAKSYEPVVLARNLSPEE   79 (165)
T ss_pred             CCCCCCCEECCCCCEEEECCEEEEEEEEHHHCCCHHHHHHHHHHHHH-CCCHHHHHHHHHHHHCCCCCEEEEECCCCHHH
T ss_conf             98999868958999968544155999983570782999999999881-97999999999873146862799877899999


Q ss_pred             HHHHHHHHCCCCEECCHHHHHHHHCCCCCCCCCCCCCCCC-----------CCCCCEEECCCCC-----CCEEEECCCC
Q ss_conf             9997631013750120233332100000011111124687-----------5123100014668-----5168953666
Q gi|254781103|r  187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR-----------GITGIEKFLDMQG-----LTRVFTTNKG  249 (598)
Q Consensus       187 ~~~I~~~~lpGi~~~~~~~R~YP~~~lashiiGyv~~d~~-----------G~~GlE~~~d~~g-----~~~~~~~~~~  249 (598)
                      +++|.++++|||.++++++|+||+++++||+||||+.++.           |++|||++||..+     ....+++..|
T Consensus        80 ~~~i~~~~~pGi~~~~~~~R~YP~~~~ashviGyv~~~~~~~~~~~~~~~vG~~GlE~~yd~~L~G~~G~~~~~~d~~G  158 (165)
T pfam03717        80 AAKIKELKLPGVSIEEEPKRYYPYGELAAHVLGYVGEINEEELERLPGDRVGKSGLEKQYEKLLRGTDGKRVVEVDALG  158 (165)
T ss_pred             HHHHHHCCCCCEEEEEEEEEECCCCCCCCEEEEEECCCCHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCEEEEEECCCC
T ss_conf             9999973899669987455517787530007787256760334406787527262799866240898756999999999


No 16 
>COG2602 Beta-lactamase class D [Defense mechanisms]
Probab=99.64  E-value=3.4e-15  Score=115.36  Aligned_cols=251  Identities=21%  Similarity=0.281  Sum_probs=168.4

Q ss_pred             EEEHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHH
Q ss_conf             55525767777764421001132343111223023203211121001473111344432322222332456643201235
Q gi|254781103|r  258 LALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT  337 (598)
Q Consensus       258 lTID~~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t  337 (598)
                      ++++...|......+..--..++.-.|+.|+.|-+     ++- +.-|        .    .-|+ ...|-|.||||++-
T Consensus         4 ~~~~~~~~~~~~~~~~~~a~~f~~~~gtfvlyd~~-----~~~-~~i~--------n----~~~~-~qr~sPaSTfKI~~   64 (254)
T COG2602           4 LTLSLLAQNPLYGQLKNLAKSFKGADGTFVLYDDK-----AMG-YSIY--------N----EERA-KQRFSPASTFKIAL   64 (254)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHCCCCCEEEEEEECC-----CCC-EEEE--------C----HHHH-CCCCCCHHHHHHHH
T ss_conf             01446654311156678887477666049999754-----563-2463--------3----3553-68668468999999


Q ss_pred             HHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCC
Q ss_conf             65443024032044213367632221011234543230039998550367123543202333320011012225763446
Q gi|254781103|r  338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLET  417 (598)
Q Consensus       338 ~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~i  417 (598)
                      .+.|++.|++..+..     +...-+..++.+......++++.++.+|++-++=.++.++|.+++..|++++|+|..   
T Consensus        65 sLigld~Gvl~d~~~-----~v~~wd~~~~~f~~W~qd~dl~~amk~Svvwy~q~iar~ig~ek~~aylk~l~YGN~---  136 (254)
T COG2602          65 SLIGLDAGVLSDEDT-----PVLLWDGKIRWFESWNQDQDLTSAMKNSVVWYYQEIARAIGREKMAAYLKQLGYGNQ---  136 (254)
T ss_pred             HHHHCCCCCCCCCCC-----EEEEECCCCCCCHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH---
T ss_conf             974114573135876-----555107775634112155888999999878899999998768999999887522631---


Q ss_pred             CCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             86542111122335544100114687521300100221100110782301089998630788503201899999999999
Q gi|254781103|r  418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL  497 (598)
Q Consensus       418 dlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~  497 (598)
                      |+.+.     |.-|-..         ++.+||++-+...--++.+                    +-.+|.++-+.++.+
T Consensus       137 dis~~-----~~~Wl~~---------sLkIS~~EQv~fL~rL~~~--------------------~LPFs~~a~~~v~~~  182 (254)
T COG2602         137 DISGN-----PGFWLES---------SLKISPKEQVIFLRRLAQN--------------------ELPFSAKAQDLVKAI  182 (254)
T ss_pred             HHCCC-----CCCEECC---------CCCCCHHHHHHHHHHHHHC--------------------CCCCCHHHHHHHHHH
T ss_conf             10589-----9811136---------6522779999999999746--------------------699887899999877


Q ss_pred             HHHHHCCCCEEECCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHH
Q ss_conf             99873388464104797357667240351268876688621799999742888099999980788888887432146789
Q gi|254781103|r  498 LREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP  577 (598)
Q Consensus       498 l~~vv~~GTg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaP  577 (598)
                      |..-         +.++|.+-|||||.-       ..+..++|||||...++-.|+++.-++..+.          .-+|
T Consensus       183 m~~~---------~~~~~~l~GKTG~~~-------~~~~~~GWfVG~v~~~~~~y~FA~nld~~~~----------~d~~  236 (254)
T COG2602         183 MILE---------RGPNWELHGKTGTGI-------VNTKNLGWFVGWVETNENKYVFATNLDIDGN----------EDGP  236 (254)
T ss_pred             HHHH---------CCCCEEEEECCCCCC-------CCCCCCEEEEEEEEECCCEEEEEEEECCCCC----------CCHH
T ss_conf             7013---------089769984044465-------3788750599999968937999996125777----------7546


Q ss_pred             HHHHHHHHHHHHCCCCCC
Q ss_conf             999999999998189985
Q gi|254781103|r  578 MVGNIIRRSASMLGVKPV  595 (598)
Q Consensus       578 i~~~I~~~~~~~~~i~P~  595 (598)
                      -..+|-+++|.-|++.|+
T Consensus       237 k~~~i~~~~Lk~l~~l~~  254 (254)
T COG2602         237 KREEITEAILKELGLLVK  254 (254)
T ss_pred             HHHHHHHHHHHHHCCCCC
T ss_conf             778899999987233469


No 17 
>pfam00768 Peptidase_S11 D-alanyl-D-alanine carboxypeptidase.
Probab=98.56  E-value=4.2e-08  Score=70.30  Aligned_cols=213  Identities=16%  Similarity=0.183  Sum_probs=113.9

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CCCEECCCCCCCCC
Q ss_conf             343111223023203211121001473111344432322222332456643201235654430---24032044213367
Q gi|254781103|r  281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SGLFTVKDLFDTRN  357 (598)
Q Consensus       281 a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g~i~~~~~~~~~~  357 (598)
                      -.+-+++|||..||+||.--                   |  ....++|+|+-|++|+..+||   ++.+++++.+..+.
T Consensus        10 i~A~saiv~D~~tg~iL~~k-------------------n--~~~~~~pAS~TKlMTa~v~le~~~~~~~~~~~~v~is~   68 (241)
T pfam00768        10 IAAKSAILVDYNTGKVLYEK-------------------N--ADQVRPIASITKLMTAYVVLEALKAGKLKEDDPVTISE   68 (241)
T ss_pred             CCCEEEEEEECCCCCEEEEE-------------------C--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEECCH
T ss_conf             65129999999999790006-------------------9--09981778999999999999975628988544421018


Q ss_pred             CC-CCCC-CCCCC-CCCCCCCCCHHH----HHHCCCCCEEEEEEECCC------CCCCHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             63-2221-01123-454323003999----855036712354320233------33200110122257634468654211
Q gi|254781103|r  358 PI-KVGK-HVIHD-YHPQNRILTIPE----IFRYSSNIGAAQIADAMG------IQGHKEFLYRLGLLSKLETELPEIQA  424 (598)
Q Consensus       358 ~~-~~~~-~~i~~-~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg------~~~~~~~~~~fG~g~~t~idlp~e~~  424 (598)
                      .. .... ..... +-..+..+++++    .|..|.|-...-|++.++      .+.+.+.++++|+.. |.+.=|   .
T Consensus        69 ~~~~~~~~~~~s~~~l~~G~~~tv~dLl~~lll~S~NdAA~aLA~~v~Gs~~~Fv~~MN~~A~~LGm~~-T~F~np---~  144 (241)
T pfam00768        69 YAYALGNFRGSSNMFLKPGDKVTVRDLLRGLLVSSGNDAAVALAEKIAGSEKAFVKMMNAKAKQLGLKN-TRFVNP---T  144 (241)
T ss_pred             HHHHHCCCCCCCEEEECCCCEEEHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCC-CEEECC---C
T ss_conf             899863788873465348999889999999987564599999999845829999999999999819999-866668---7


Q ss_pred             CCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCC
Q ss_conf             11223355441001146875213001002211001107823010899986307885032018999999999999987338
Q gi|254781103|r  425 PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG  504 (598)
Q Consensus       425 g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~~  504 (598)
                      |....              +-..|+-+||.....+..+    .|..+.......-....    ..         ......
T Consensus       145 GL~~~--------------~~~sTA~Dla~l~~~~~~~----~~~~~~~~~~~~~~~~~----~~---------~~~~~~  193 (241)
T pfam00768       145 GLDNH--------------GQYSSARDLAILARALIKD----LPEVLSITKEKSATFNT----PI---------YKINWM  193 (241)
T ss_pred             CCCCC--------------CCEECHHHHHHHHHHHHHH----CHHHEEEEEEEEEEECC----CC---------CEEEEE
T ss_conf             77788--------------8666799999999999874----95840888778999747----87---------358997


Q ss_pred             CCEEECCCCCEE-EEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEEC
Q ss_conf             846410479735-76672403512688766886217999997428880999999807
Q gi|254781103|r  505 GSGRRAFVPGFE-VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDS  560 (598)
Q Consensus       505 GTg~~a~~~g~~-vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~  560 (598)
                      -|.+.....+.. .++|||+.....          ..|++.+..++-+| ++|+++-
T Consensus       194 NtN~ll~~~~~~v~G~KTG~T~~AG----------~clv~~a~~~g~~~-I~VvLgs  239 (241)
T pfam00768       194 NTNGLLYRKGGNVDGLKTGYTKEAG----------YCLVATATEGGMRV-ISVVLNA  239 (241)
T ss_pred             CCCCHHHCCCCCEEEEEEEEECCCC----------CEEEEEEEECCEEE-EEEEECC
T ss_conf             3795100579857999952531666----------45999999999899-9999499


No 18 
>PRK10001 D-alanyl-D-alanine carboxypeptidase fraction C; Provisional
Probab=98.42  E-value=2.7e-07  Score=65.23  Aligned_cols=113  Identities=13%  Similarity=0.241  Sum_probs=78.4

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH---HHHCCCEECCCCCCCC
Q ss_conf             2343111223023203211121001473111344432322222332456643201235654---4302403204421336
Q gi|254781103|r  280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM---GIDSGLFTVKDLFDTR  356 (598)
Q Consensus       280 ~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aa---aLe~g~i~~~~~~~~~  356 (598)
                      +...-++|+||..||+||.-                     +-....++|+|+-|+.|+..   +|++|.+++++.+..+
T Consensus        36 ~i~A~sail~D~~TG~VLy~---------------------Kn~d~~~~pAS~TKlMTa~lv~eai~~g~i~ld~~v~vs   94 (400)
T PRK10001         36 SVDARAWILMDYASGKVLAE---------------------GNADEKLDPASLTKIMTSYVVGQALKAGKIKLTDMVTVG   94 (400)
T ss_pred             CCCCEEEEEEECCCCCCHHH---------------------CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             74531899999999959453---------------------093998487799999999999999865999878647724


Q ss_pred             CCC-CCCCCCCCCC----CCCCCCCCHHH----HHHCCCCCEEEEEEECCCC------CCCHHHCCCCCCCC
Q ss_conf             763-2221011234----54323003999----8550367123543202333------32001101222576
Q gi|254781103|r  357 NPI-KVGKHVIHDY----HPQNRILTIPE----IFRYSSNIGAAQIADAMGI------QGHKEFLYRLGLLS  413 (598)
Q Consensus       357 ~~~-~~~~~~i~~~----~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~------~~~~~~~~~fG~g~  413 (598)
                      ... ..+.......    -..+..+++++    .+..|.|-..+-||+.++.      +.+.+.++++|+..
T Consensus        95 ~~a~~~~~~~~~g~S~~~l~~g~~~tv~dLL~~lli~SaNDAA~aLAe~i~Gs~~~Fv~~MN~kA~~LG~~n  166 (400)
T PRK10001         95 KDAWATGNPALRGSSVMFLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTN  166 (400)
T ss_pred             HHHHHHCCCCCCCCCEEEECCCCEEEHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             899852476556874244237989899999999877442599999997235568999999999999828987


No 19 
>PRK11669 pbpG D-alanyl-D-alanine endopeptidase; Provisional
Probab=98.40  E-value=6.2e-07  Score=62.89  Aligned_cols=109  Identities=17%  Similarity=0.167  Sum_probs=70.7

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCCC--C
Q ss_conf             34311122302320321112100147311134443232222233245664320123565443024032044213367--6
Q gi|254781103|r  281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN--P  358 (598)
Q Consensus       281 a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~~--~  358 (598)
                      -.+.++|+||..||+||.--                   |  ....++|.|+-|+.|+..+||.+ ++.++.+...-  .
T Consensus        38 i~A~sail~D~~TG~VLy~k-------------------n--~d~~~~pAS~TKlMTalv~le~~-~~ld~~v~v~~~~~   95 (308)
T PRK11669         38 LASGSAMVVDLNTNKVIYSS-------------------N--PDLVVPIASITKLMTAMVVLDAK-LPLDEKLKVDISQT   95 (308)
T ss_pred             CCCEEEEEEECCCCCEEEEE-------------------C--CCCCCCCHHHHHHHHHHHHHHCC-CCCCCEEEEEHHHH
T ss_conf             45408999999999690015-------------------8--29984878999999999998178-99887699767762


Q ss_pred             CCCCCCCCCCCCCCCCCCCHH----HHHHCCCCCEEEEEEECCC------CCCCHHHCCCCCCCC
Q ss_conf             322210112345432300399----9855036712354320233------332001101222576
Q gi|254781103|r  359 IKVGKHVIHDYHPQNRILTIP----EIFRYSSNIGAAQIADAMG------IQGHKEFLYRLGLLS  413 (598)
Q Consensus       359 ~~~~~~~i~~~~~~~g~it~~----~al~~S~Nv~~~~i~~~lg------~~~~~~~~~~fG~g~  413 (598)
                      -...+.. .... -+..++++    -+|..|.|-..+-|++.++      .+.+.+.++++|+..
T Consensus        96 ~~~~~~~-s~l~-~G~~~tv~dLl~~~li~S~NdAA~aLAe~i~Gs~~~Fv~~MN~kA~eLGm~~  158 (308)
T PRK11669         96 PEMKGVY-SRVR-LNSEISRKDMLLLALMSSENRAAASLAHHYPGGYKAFIKAMNAKAKALGMKN  158 (308)
T ss_pred             HHCCCCC-CCCC-CCCEEEHHHHHHHHHHHCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             0006874-4334-7988889999999987465299999999707679999999999999829998


No 20 
>COG2367 PenP Beta-lactamase class A [Defense mechanisms]
Probab=97.81  E-value=5.8e-05  Score=50.34  Aligned_cols=253  Identities=20%  Similarity=0.224  Sum_probs=133.2

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CCCEECCCCCCC
Q ss_conf             32343111223023203211121001473111344432322222332456643201235654430---240320442133
Q gi|254781103|r  279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SGLFTVKDLFDT  355 (598)
Q Consensus       279 ~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g~i~~~~~~~~  355 (598)
                      ....+-.+.+.|.+||+..+      ++                -...|+-+||||...++++++   +|.+.+++.+..
T Consensus        60 ~~~~~~~~~v~d~~t~~~~~------~n----------------~~~~fp~aSt~K~~v~~a~l~~v~~G~~~l~e~~ti  117 (329)
T COG2367          60 ATDGRVGVYVLDVDTGELIA------IN----------------GDERFPAASTIKLPVLAALLEQVDAGRIGLDERLTI  117 (329)
T ss_pred             CCCCEEEEEEEECCCCCEEE------EC----------------CCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             57852679999668873131------15----------------775212578999999999999714575575542010


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHH----HHHCCCCCEEEEEEECCCCC-CCHHHCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6763222101123454323003999----85503671235432023333-200110122257634468654211112233
Q gi|254781103|r  356 RNPIKVGKHVIHDYHPQNRILTIPE----IFRYSSNIGAAQIADAMGIQ-GHKEFLYRLGLLSKLETELPEIQAPSYPSQ  430 (598)
Q Consensus       356 ~~~~~~~~~~i~~~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~~-~~~~~~~~fG~g~~t~idlp~e~~g~~p~~  430 (598)
                      +......+..+-+....++.+++++    .+..|-|+..=.+..+||.. .+..++++.|+.. |.+..+-+..- ....
T Consensus       118 ~~d~~~~~s~~~~~~~~g~~~t~~el~~~mi~~SDNtAtnmLi~rlg~~~~v~~~l~~~Gl~~-t~~~~~~~~~l-n~~~  195 (329)
T COG2367         118 TKDDRVGGSGVLQYLVGGGGSTLRELLTKMITASDNTATNMLIERLGGPKALNEWLRSIGLPN-TRLRRPYMPDL-NRFN  195 (329)
T ss_pred             CHHHHCCCCCHHEEECCCCCEEHHHHHHHHHHHCCHHHHHHHHHHHCCHHHHHHHHHHHCCCC-CCCHHHCCCCC-CCCC
T ss_conf             433322576111131578835799999652221402888999999358199999999818832-23100026620-0266


Q ss_pred             CCCCCCEECCCCCCCEEEHHHCC-CCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             55441001146875213001002-21100110782301089998630788503201899999999999998733884641
Q gi|254781103|r  431 WKRIHSLTISFGHGLSTTPLQTA-VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR  509 (598)
Q Consensus       431 ~~~~~~~~~~~Gqg~~~TPlqla-~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~~GTg~~  509 (598)
                      | +.+    .-|++.+.|+-..+ ...+.+.+. +...+          ...  --++...+..  .+|.......+.-+
T Consensus       196 ~-~~d----~~~~~~~~t~a~~~~~L~q~i~~~-~~~~~----------~~~--~~~~~~~~~~--~~~~~~~g~~~~~r  255 (329)
T COG2367         196 G-PYD----PRDSGKTTTPADDAATLLQLILGA-VLSPS----------DRA--TGLSGYLAEW--ALLANTIGRDWLLR  255 (329)
T ss_pred             C-CCC----CCCCCCCCCHHHHHHHHHHHHHCC-CCCCC----------CCC--CCCHHHHHHH--HHHHHCCCCCCCHH
T ss_conf             7-766----333556568789999999987335-57854----------223--4405888878--99862668643201


Q ss_pred             CC-CCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCE-EEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             04-7973576672403512688766886217999997428880-999999807888888874321467899999999999
Q gi|254781103|r  510 AF-VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ-YIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA  587 (598)
Q Consensus       510 a~-~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~-~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~  587 (598)
                      +. ..++.|+=|||+.-.       ...+.   +++....+|. +++.++-+.|.....    ++.+..++...+...+.
T Consensus       256 ~~~~~~~~ia~K~G~~l~-------~~~~D---~~~~~~~~~~~~v~~~~~~~~~~~~d----~~~~~~~~~~~~~~~~~  321 (329)
T COG2367         256 AGLPFDWAIAHKTGTGLG-------GTAND---VGIIWAPVPKPIVAAVIGERPGKKAD----ATAVYTALPAELAREVA  321 (329)
T ss_pred             CCCCCCHHHHCCCCCCCC-------CCCCC---EEEEECCCCCEEEEEEEECCCCCCCC----CCCCCCHHHHHHHHHHH
T ss_conf             038744223046563467-------88776---37885698844899997347676777----54100104899999985


Q ss_pred             HH
Q ss_conf             98
Q gi|254781103|r  588 SM  589 (598)
Q Consensus       588 ~~  589 (598)
                      ..
T Consensus       322 ~~  323 (329)
T COG2367         322 GL  323 (329)
T ss_pred             HC
T ss_conf             02


No 21 
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional
Probab=97.80  E-value=5.8e-06  Score=56.72  Aligned_cols=112  Identities=17%  Similarity=0.216  Sum_probs=76.5

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH---HHHCCCEECCCCCCCCC
Q ss_conf             343111223023203211121001473111344432322222332456643201235654---43024032044213367
Q gi|254781103|r  281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM---GIDSGLFTVKDLFDTRN  357 (598)
Q Consensus       281 a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aa---aLe~g~i~~~~~~~~~~  357 (598)
                      ..+-++|+||..||+||.-=                   |  ....++|+|+-|+.|+..   ++++|.+++++.+..+.
T Consensus        36 i~A~sailiD~~TG~vLy~k-------------------N--~d~~~~pAS~TKlMT~~v~~e~i~~g~l~~d~~v~vs~   94 (390)
T PRK11397         36 IDAGSWVLMDYTTGQILTAG-------------------N--EHQQRNPASLTKLMTGYVVDRAIDSHRITPDDIVTVGR   94 (390)
T ss_pred             CCCEEEEEEECCCCCEEEEE-------------------C--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECH
T ss_conf             55339999999999692012-------------------9--29984877999999999999999739999786599638


Q ss_pred             CC-CCCCCC-CCC---CCCCCCCCCHHH----HHHCCCCCEEEEEEECCCC------CCCHHHCCCCCCCC
Q ss_conf             63-222101-123---454323003999----8550367123543202333------32001101222576
Q gi|254781103|r  358 PI-KVGKHV-IHD---YHPQNRILTIPE----IFRYSSNIGAAQIADAMGI------QGHKEFLYRLGLLS  413 (598)
Q Consensus       358 ~~-~~~~~~-i~~---~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~------~~~~~~~~~fG~g~  413 (598)
                      .. ...+.. ...   +-..+..+|+++    .+..|.|-..+-||+.++.      +.+.+.++++|+..
T Consensus        95 ~a~~~~~~~~~g~s~~~l~~Ge~~tv~dLl~~lli~SaNDAa~aLAe~i~Gs~~~Fv~~MN~kAk~lG~~n  165 (390)
T PRK11397         95 DAWAKDNPVFVGSSLMFLKEGDRVSVRDLSRGLIVDSGNDACVALADYIAGGQRQFVEMMNNYVEKLHLKD  165 (390)
T ss_pred             HHHHCCCCCCCCCCEEECCCCCEEEHHHHHHHHHHHCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             78741487657872242158989999999999887442399999997527999999999999999858987


No 22 
>PRK10793 D-alanyl-D-alanine carboxypeptidase fraction A; Provisional
Probab=97.79  E-value=4.7e-06  Score=57.33  Aligned_cols=111  Identities=19%  Similarity=0.280  Sum_probs=77.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH---HHHCCCEECCCCCCCCCC
Q ss_conf             43111223023203211121001473111344432322222332456643201235654---430240320442133676
Q gi|254781103|r  282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM---GIDSGLFTVKDLFDTRNP  358 (598)
Q Consensus       282 ~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aa---aLe~g~i~~~~~~~~~~~  358 (598)
                      .+-++|+||+.||+||.--                   |  ....++|+|+-|+.|+..   +|++|.+++++.+..+..
T Consensus        45 ~A~sailiD~~TG~VLy~k-------------------N--ad~~~~pAS~TKlMT~~lv~eai~~g~l~~~d~v~vs~~  103 (403)
T PRK10793         45 DAESYILIDYNSGKVLAEQ-------------------N--ADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTVGND  103 (403)
T ss_pred             CCEEEEEEECCCCCCHHHC-------------------C--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHH
T ss_conf             5419999999999491310-------------------9--499958779999999999999997599998885996589


Q ss_pred             C-CCCCCCCCC----CCCCCCCCCHHH----HHHCCCCCEEEEEEECCC------CCCCHHHCCCCCCCC
Q ss_conf             3-222101123----454323003999----855036712354320233------332001101222576
Q gi|254781103|r  359 I-KVGKHVIHD----YHPQNRILTIPE----IFRYSSNIGAAQIADAMG------IQGHKEFLYRLGLLS  413 (598)
Q Consensus       359 ~-~~~~~~i~~----~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg------~~~~~~~~~~fG~g~  413 (598)
                      . ..++.....    +-..+..+|+++    .+..|.|-..+-||+.++      .+.+.+.++++|+..
T Consensus       104 a~~~~~~~~~g~s~~~l~~G~~~tv~dLl~gl~i~SaNDAa~aLAe~i~Gs~~~Fv~~MN~kA~eLG~~n  173 (403)
T PRK10793        104 AWATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKN  173 (403)
T ss_pred             HHHHCCCCCCCCCEEEECCCCEEEHHHHHHHHHHHCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             9851487667874254158989999999997565243599999997506989999999999999858987


No 23 
>COG1686 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane]
Probab=97.64  E-value=2e-05  Score=53.36  Aligned_cols=119  Identities=13%  Similarity=0.171  Sum_probs=80.1

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CCCEECCCCCCCC
Q ss_conf             2343111223023203211121001473111344432322222332456643201235654430---2403204421336
Q gi|254781103|r  280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SGLFTVKDLFDTR  356 (598)
Q Consensus       280 ~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g~i~~~~~~~~~  356 (598)
                      .....+++|||.+||+||.--                     -....++|.|+-|..|+...+|   .|.+++++.+..+
T Consensus        35 ~~~a~~aiviD~~sGkVLy~k---------------------n~d~~~~pASlTKlMTayv~~ea~~~gki~~~~~v~is   93 (389)
T COG1686          35 EIAAKAAIVIDADSGKVLYSK---------------------NADARRPPASLTKLMTAYVVLEALKAGKIKLDDKVTIS   93 (389)
T ss_pred             CCCCCEEEEEECCCCCEEECC---------------------CCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEECCC
T ss_conf             766643899988998472132---------------------88988785099999999999987642688845533356


Q ss_pred             CC-CCCCCCCCCCCCCCCCCCCHHH----HHHCCCCCEEEEEEECCCC------CCCHHHCCCCCCCC-----CCCCCCC
Q ss_conf             76-3222101123454323003999----8550367123543202333------32001101222576-----3446865
Q gi|254781103|r  357 NP-IKVGKHVIHDYHPQNRILTIPE----IFRYSSNIGAAQIADAMGI------QGHKEFLYRLGLLS-----KLETELP  420 (598)
Q Consensus       357 ~~-~~~~~~~i~~~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~------~~~~~~~~~fG~g~-----~t~idlp  420 (598)
                      .. +..++ .-.-+-..+..+++++    .+.+|-|-..+-|++.++.      +.+...++++|+..     ++|++-|
T Consensus        94 ~~a~~~~~-~S~~~l~~G~~~tv~dLl~gllv~SaNDAA~aLAe~~~Gs~~~Fv~~MN~kA~~LGm~nT~F~npsGL~~~  172 (389)
T COG1686          94 ENAWAKGG-GSKMFLKPGETVTVRDLLKGLLVQSANDAAVALAEHLAGSEDAFVAKMNAKAKELGMKNTHFVNPSGLDNP  172 (389)
T ss_pred             HHHHHCCC-CCCCEECCCCEEEHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCEECCCCCCCCC
T ss_conf             75663178-76511346988789999999887445499999998717989999999999999858988876188788988


No 24 
>PRK10662 beta-lactamase/D-alanine carboxypeptidase; Provisional
Probab=97.56  E-value=0.0037  Score=38.92  Aligned_cols=79  Identities=16%  Similarity=0.178  Sum_probs=48.6

Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH--
Q ss_conf             777776442100113234311122302320321112100147311134443232222233245664320123565443--
Q gi|254781103|r  265 QNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGI--  342 (598)
Q Consensus       265 Q~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaL--  342 (598)
                      -.++++.+.+.+++++..+.++.|+  +.|+++. .++-.-|+.+   ...   .  --...|+.||+=|+||+++.+  
T Consensus        32 ~d~iD~~~~~~m~~~~iPG~avavv--~~~~~~~-~~yG~ad~~~---~~~---~--t~dT~F~IaSiSK~fTa~ai~~L  100 (377)
T PRK10662         32 SDIVDRYAQHIFYGSGATGMALVVI--DGNQRVF-RSYGETRPGN---NVR---P--QLDSVIRIASITKLMTSEVLVKL  100 (377)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEEEE--ECCEEEE-EEEEEEECCC---CCC---C--CCCCEEEEEECHHHHHHHHHHHH
T ss_conf             7889999999998579984899999--8999999-7136643577---989---9--99987870043199999999999


Q ss_pred             -HCCCEECCCCCC
Q ss_conf             -024032044213
Q gi|254781103|r  343 -DSGLFTVKDLFD  354 (598)
Q Consensus       343 -e~g~i~~~~~~~  354 (598)
                       |+|.++.++.+.
T Consensus       101 ve~Gkl~lddpv~  113 (377)
T PRK10662        101 ADDGTVKLTDPLS  113 (377)
T ss_pred             HHCCCEECCCCHH
T ss_conf             9779220678199


No 25 
>pfam00144 Beta-lactamase Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
Probab=96.19  E-value=0.0044  Score=38.39  Aligned_cols=100  Identities=15%  Similarity=0.147  Sum_probs=51.1

Q ss_pred             HHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH---HCCCEE
Q ss_conf             42100113234311122302320321112100147311134443232222233245664320123565443---024032
Q gi|254781103|r  272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGI---DSGLFT  348 (598)
Q Consensus       272 l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaL---e~g~i~  348 (598)
                      +.+.+++....++++.|  .+.|+++--..+..-|....     .+.   -....|+.||+-|+||+++++   |+|.++
T Consensus         5 i~~~~~~~~ipG~~v~V--~~~g~~~~~~~~G~~d~~~~-----~p~---~~dT~f~iaSvsK~~ta~~i~~Lve~G~l~   74 (327)
T pfam00144         5 IRELMAQGGIPGVAVAV--TRDGKVVVDRGGGVADLEGG-----RPV---TADTLFRIASVTKTFTAAAVLALVERGKLD   74 (327)
T ss_pred             HHHHHHHCCCCEEEEEE--EECCEEEEEEEEEEECCCCC-----CCC---CCCCEEEEEEHHHHHHHHHHHHHHHCCCCC
T ss_conf             99999808998699999--99999999986888447779-----889---999858730127999999999999759988


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCE
Q ss_conf             04421336763222101123454323003999855036712
Q gi|254781103|r  349 VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG  389 (598)
Q Consensus       349 ~~~~~~~~~~~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~  389 (598)
                      +++.+..  .+.  .    ...+....+|+++.|.++|=..
T Consensus        75 Ld~~v~~--ylP--~----~~~~~~~~iTi~~LLsHtSGl~  107 (327)
T pfam00144        75 LDDPVSK--YLP--E----FAGSGKGGVTLRDLLTHTSGLP  107 (327)
T ss_pred             CCCCHHH--HCC--C----CCCCCCCCCCHHHHHHCCCCCC
T ss_conf             6643254--286--6----6778767865999944657999


No 26 
>PRK12357 glutaminase; Reviewed
Probab=96.19  E-value=0.022  Score=34.02  Aligned_cols=107  Identities=18%  Similarity=0.150  Sum_probs=69.2

Q ss_pred             CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECC
Q ss_conf             52130010022110011078230108999863078850320189999999999999873-38846410479735766724
Q gi|254781103|r  444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTG  522 (598)
Q Consensus       444 g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTG  522 (598)
                      .+.+|.-+||.+.+++||+|..             +...++++++++++.+..+|...- -+.+|.-++--|.+  +|+|
T Consensus       205 Si~~t~~dLA~~~a~LAN~G~~-------------P~t~~~v~~~~~~r~v~s~M~tcGmYD~SGefa~~VGlP--aKSG  269 (326)
T PRK12357        205 SIEINTEDIALIGLILAHDGYH-------------PIRKEQVIPKEVARLTKALMLTCGMYNASGKFAAFIGLP--AKSG  269 (326)
T ss_pred             CHHCCHHHHHHHHHHHHCCCCC-------------CCCCCEECCHHHHHHHHHHHHHCCCCCCCHHHHHHCCCC--CCCC
T ss_conf             7052099999999999768979-------------998897559999999999986458865400268863883--0357


Q ss_pred             EEEECCCCCCCCCCCEEEEEEEEECC-----CCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             03512688766886217999997428-----88099999980788888887432146789999999
Q gi|254781103|r  523 TAQKVIKKRYSDTLNFNSFLAVFPTT-----DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII  583 (598)
Q Consensus       523 TAq~~~~g~y~~~~~~~~FvG~~P~~-----dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~  583 (598)
                      -+              .-.++..|..     ....++.+.+.-|.-.    ..|.++++--+-+-+
T Consensus       270 Vg--------------GgIlavvPg~~~~~~~~~~~mgIav~SP~LD----~~GNSv~G~~~le~l  317 (326)
T PRK12357        270 VS--------------GGIMALVPSKSRKDLPFQDGCGIGIYGPAID----EYGNSLPGIMLLKHI  317 (326)
T ss_pred             CC--------------CEEEEEECCCCCCCCCCCCCEEEEEECCCCC----CCCCCHHHHHHHHHH
T ss_conf             66--------------6269995775555655667506999888768----888869999999999


No 27 
>PRK00971 glutaminase; Provisional
Probab=96.13  E-value=0.043  Score=32.14  Aligned_cols=215  Identities=17%  Similarity=0.173  Sum_probs=107.2

Q ss_pred             CCCCCCCCCCHHHHHHHHHHC-CCEECCCCCCC-CCCCCCCCCC---CCCCCCCCCCCCHHHHHHCCCCCEEEEEEECCC
Q ss_conf             324566432012356544302-40320442133-6763222101---123454323003999855036712354320233
Q gi|254781103|r  324 YGIFEMGSIFKVFTIAMGIDS-GLFTVKDLFDT-RNPIKVGKHV---IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG  398 (598)
Q Consensus       324 ~~~yePGStfKp~t~aaaLe~-g~i~~~~~~~~-~~~~~~~~~~---i~~~~~~~g~it~~~al~~S~Nv~~~~i~~~lg  398 (598)
                      ...|..-|+-|||+++.||+. |.-...+.+-. |....++.-.   .....+++ ++-=..||.-++=+.-....++  
T Consensus        58 ~~~FsiQSisK~f~~~lal~~~G~~~v~~~VG~ePSg~~FNSi~~Le~~~g~P~N-PmINAGAI~~~sll~~~~~~~~--  134 (308)
T PRK00971         58 DERFSIQSISKVFSLTLALQHYGEEEVWSRVGKEPSGDPFNSLVQLELERGKPRN-PMINAGAIVVTDLLQGRDSAPK--  134 (308)
T ss_pred             CCCEEHHHHHHHHHHHHHHHHHCHHHHHHHHCCCCCCCCHHHHHHHHCCCCCCCC-CCHHHHHHHHHHHHCCCCHHHH--
T ss_conf             8853289889999999999887979999984878776764678865404898788-5202679999998606982999--


Q ss_pred             CCCCHHHCCCCCCCCCCCCCCC---CCCC---------------CCCCCCCCCCCCEECCCCC-CCEEEHHHCCCCCCHH
Q ss_conf             3320011012225763446865---4211---------------1122335544100114687-5213001002211001
Q gi|254781103|r  399 IQGHKEFLYRLGLLSKLETELP---EIQA---------------PSYPSQWKRIHSLTISFGH-GLSTTPLQTAVAAAAL  459 (598)
Q Consensus       399 ~~~~~~~~~~fG~g~~t~idlp---~e~~---------------g~~p~~~~~~~~~~~~~Gq-g~~~TPlqla~~~ati  459 (598)
                      .+.+.++++++.=.+...+|-.   .|..               |.+..+  .-+....=|-| .+.+|..+||.+.+++
T Consensus       135 ~~~il~~~~~~ag~~~i~~d~~v~~SE~~t~~rN~Alay~lk~~g~~~~d--~~~~Ld~Yf~~CSi~vt~~dLA~~~a~L  212 (308)
T PRK00971        135 QERLLEFVRELAGNQDILYDEVVASSELEHSDRNAAIAYLMKSFGNIEND--VETVLDTYFHQCALEMSCIDLARAGLFL  212 (308)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCC--HHHHHHHHHHHCCCCCCHHHHHHHHHHH
T ss_conf             99999999998399965506899999860768999999999977998999--9999999999717321299999999999


Q ss_pred             HHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECCEEEECCCCCCCCCCCE
Q ss_conf             1078230108999863078850320189999999999999873-388464104797357667240351268876688621
Q gi|254781103|r  460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNF  538 (598)
Q Consensus       460 AN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~~  538 (598)
                      ||+|..             +...++++++++++.+...|...- -+.+|.-+.--|.+  +|+|-+              
T Consensus       213 An~G~~-------------P~tg~~vls~~~~r~v~s~M~tcGmYd~SGefa~~VGlP--aKSGVg--------------  263 (308)
T PRK00971        213 ANDGVS-------------PHTGERVVSPSQARQVNALMATCGMYDASGEFAYRVGLP--AKSGVG--------------  263 (308)
T ss_pred             HCCCCC-------------CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHEECCC--CCCCCC--------------
T ss_conf             768968-------------998895389999999999998768865533125406871--036766--------------


Q ss_pred             EEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             7999997428880999999807888888874321467899999
Q gi|254781103|r  539 NSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN  581 (598)
Q Consensus       539 ~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~  581 (598)
                      .-.++..|-   ++.++||=  |.-.    ..|.++++=-+-+
T Consensus       264 GgIlavvPg---~~gIav~S--P~LD----~~GNSv~G~~~le  297 (308)
T PRK00971        264 GGILAVVPG---EMAIAVWS--PGLD----AKGNSLAGTAALE  297 (308)
T ss_pred             CEEEEEECC---CCEEEEEC--CCCC----CCCCCHHHHHHHH
T ss_conf             538999379---71899988--8868----8888699999999


No 28 
>PRK12356 glutaminase; Reviewed
Probab=95.71  E-value=0.085  Score=30.24  Aligned_cols=216  Identities=19%  Similarity=0.165  Sum_probs=109.7

Q ss_pred             CCCCCCCCCCHHHHHHHHHHC-CCEECCCCCCC-CCCCCCCCC---CCCCCCCCCCCCCHHHHHHCCCCCEEEEEEECCC
Q ss_conf             324566432012356544302-40320442133-676322210---1123454323003999855036712354320233
Q gi|254781103|r  324 YGIFEMGSIFKVFTIAMGIDS-GLFTVKDLFDT-RNPIKVGKH---VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG  398 (598)
Q Consensus       324 ~~~yePGStfKp~t~aaaLe~-g~i~~~~~~~~-~~~~~~~~~---~i~~~~~~~g~it~~~al~~S~Nv~~~~i~~~lg  398 (598)
                      ...|..-|+-|||+++.||+. |.-...+.+-. |....++.-   ...+.++++ +|-=..||..++=+.--...++  
T Consensus        62 ~~~FsiQSisK~f~~~lal~~~G~~~v~~~VG~EPSG~~FNSl~~Le~~~g~P~N-PmINAGAI~~~sli~~~~~~~~--  138 (319)
T PRK12356         62 DYRFAIESISKVFTLALVLEDIGPQAVREKIGADPTGLPFNSVIALELHNGKPLN-PLVNAGAIATTSLVPGANSDER--  138 (319)
T ss_pred             CCCEEHHHHHHHHHHHHHHHHHCHHHHHHHHCCCCCCCCCHHHHHHHHCCCCCCC-CCHHHHHHHHHHHHCCCCHHHH--
T ss_conf             9877227789999999999866989999984878776760678887614998588-3034548899885037885899--


Q ss_pred             CCCCHHHCCCCCCCCCCCCCCC---CCCC---------------CCCCCCCCCC-CCEECCCCC-CCEEEHHHCCCCCCH
Q ss_conf             3320011012225763446865---4211---------------1122335544-100114687-521300100221100
Q gi|254781103|r  399 IQGHKEFLYRLGLLSKLETELP---EIQA---------------PSYPSQWKRI-HSLTISFGH-GLSTTPLQTAVAAAA  458 (598)
Q Consensus       399 ~~~~~~~~~~fG~g~~t~idlp---~e~~---------------g~~p~~~~~~-~~~~~~~Gq-g~~~TPlqla~~~at  458 (598)
                      .+.+.++++++- |.+..+|-.   .|..               +.+.   .+. +....=|=| ++.+|--+||.+.++
T Consensus       139 ~~~i~~~~~~~a-g~~l~~d~~V~~SE~~t~~RN~AlAy~l~~~g~~~---~d~~~~Ld~Yf~qCSi~vt~~dLA~~~at  214 (319)
T PRK12356        139 WQRILHGQQRFA-GRQLALSDEVYQSEQTTNFHNRAIAWLLYSYGRLY---CDPMEACDVYTRQCSTLVTARDLATMGAT  214 (319)
T ss_pred             HHHHHHHHHHHC-CCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCC---CCHHHHHHHHHHHCCCCEEHHHHHHHHHH
T ss_conf             999999999974-99974689999998740559999999999779988---99999999999970742029999999999


Q ss_pred             HHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECCEEEECCCCCCCCCCC
Q ss_conf             11078230108999863078850320189999999999999873-38846410479735766724035126887668862
Q gi|254781103|r  459 LINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN  537 (598)
Q Consensus       459 iAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~  537 (598)
                      +||+|+.             +...+|++++++++.+..+|...- -+.+|.-++--|.  -+|+|-+             
T Consensus       215 LAn~G~~-------------P~tg~~v~~~~~~r~v~s~M~tcGmYD~SG~fa~~VGl--PaKSGVg-------------  266 (319)
T PRK12356        215 LAAGGVN-------------PLTGKRVVDADNVPYILAEMTMEGLYERSGDWAYTVGL--PGKSGVG-------------  266 (319)
T ss_pred             HHCCCCC-------------CCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCHHHEECC--CCCCCCC-------------
T ss_conf             9758968-------------99889538889999999999866885351210203777--0235766-------------


Q ss_pred             EEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             17999997428880999999807888888874321467899999999
Q gi|254781103|r  538 FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR  584 (598)
Q Consensus       538 ~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~  584 (598)
                       .-.++..|.   ++.++||=  |.-.    ..|.++++--+-+-+.
T Consensus       267 -GgIlavvPg---~~gIav~S--P~LD----~~GNSvrG~~~le~Ls  303 (319)
T PRK12356        267 -GGILAVVPG---KMGIAAFS--PPLD----EAGNSVKGQLAVASVA  303 (319)
T ss_pred             -CEEEEEECC---CCEEEEEC--CCCC----CCCCCHHHHHHHHHHH
T ss_conf             -537999379---61799988--8878----8888699999999999


No 29 
>pfam04960 Glutaminase Glutaminase. This family of enzymes deaminates glutamine to glutamate EC:3.5.1.2.
Probab=95.61  E-value=0.068  Score=30.84  Aligned_cols=98  Identities=20%  Similarity=0.234  Sum_probs=66.7

Q ss_pred             CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECC
Q ss_conf             52130010022110011078230108999863078850320189999999999999873-38846410479735766724
Q gi|254781103|r  444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTG  522 (598)
Q Consensus       444 g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTG  522 (598)
                      ++.+|.-+||.+.+++||+|+-             +...++++++++++.+...|...- -+.+|.-++--|.+  +|+|
T Consensus       175 Si~~t~~dLA~~aatLAn~G~~-------------P~tg~~v~~~~~~~~v~s~M~tcGmYd~SG~fa~~VGlP--aKSG  239 (286)
T pfam04960       175 ALEMSCEDLAVMGATLANGGVN-------------PITGERVVSPDVARQILALMLTCGMYDASGDFAYRVGLP--AKSG  239 (286)
T ss_pred             CHHCCHHHHHHHHHHHHCCCCC-------------CCCCCEECCHHHHHHHHHHHHHCCCCCCCCHHHHHCCCC--CCCC
T ss_conf             7044299999999999768968-------------998896269999999999998768865500046516871--0467


Q ss_pred             EEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             035126887668862179999974288809999998078888888743214678999
Q gi|254781103|r  523 TAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMV  579 (598)
Q Consensus       523 TAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~  579 (598)
                      -+              .-.++..|-   +..++||=  |.-.    ..|.++++--+
T Consensus       240 Vg--------------GgIlavvPg---~~gIav~S--P~LD----~~GNSv~G~~~  273 (286)
T pfam04960       240 VG--------------GGILAVVPG---VMGIAVWS--PALD----EAGNSVAGVAA  273 (286)
T ss_pred             CC--------------CEEEEEECC---CCEEEEEC--CCCC----CCCCCHHHHHH
T ss_conf             67--------------538999379---61799988--8768----88886999999


No 30 
>PRK11289 ampC beta-lactamase; Provisional
Probab=95.40  E-value=0.028  Score=33.27  Aligned_cols=81  Identities=19%  Similarity=0.349  Sum_probs=48.6

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             76777776442100113234311122302320321112100147311134443232222233245664320123565443
Q gi|254781103|r  263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGI  342 (598)
Q Consensus       263 ~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaL  342 (598)
                      .+-..+++.+.+.+++++..+.++.|+  +.|++....    |--.+....  .+.   --...|+.||+-|+||+++++
T Consensus        32 ~~~~~id~~i~~~m~~~~iPG~avaVv--~~G~~~~~~----~G~~d~~~~--~pv---t~~T~F~iaSisK~fTa~~~~  100 (387)
T PRK11289         32 QLKDIVDRAIAPLMEEYDIPGMAVAVT--YNGKPYYFN----YGVASKATG--QPV---TQDTLFELGSVSKTFTATLAA  100 (387)
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEE--ECCEEEEEC----CCCEECCCC--CCC---CCCCEEECCCCHHHHHHHHHH
T ss_conf             999999999999998579980899999--999999975----132015769--889---999878521105999999999


Q ss_pred             ---HCCCEECCCCCC
Q ss_conf             ---024032044213
Q gi|254781103|r  343 ---DSGLFTVKDLFD  354 (598)
Q Consensus       343 ---e~g~i~~~~~~~  354 (598)
                         |+|.++.++.+.
T Consensus       101 ~Lv~~G~L~ldd~v~  115 (387)
T PRK11289        101 YAQARGELSLSDPAS  115 (387)
T ss_pred             HHHHCCCCCCCCCHH
T ss_conf             999769667667298


No 31 
>PRK11113 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Provisional
Probab=94.63  E-value=0.018  Score=34.48  Aligned_cols=34  Identities=24%  Similarity=0.391  Sum_probs=23.6

Q ss_pred             EEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCE-EEEEEEEEC
Q ss_conf             576672403512688766886217999997428880-999999807
Q gi|254781103|r  516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ-YIVLSFMDS  560 (598)
Q Consensus       516 ~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~-~~v~V~v~~  560 (598)
                      +|-+||||=.           ......||.-..+.+ |+++++|++
T Consensus       413 ~v~aKTGTL~-----------gV~sLAGYv~~~~G~~l~Fsi~vNn  447 (477)
T PRK11113        413 KVSAKTGSLQ-----------GVYNLAGFITTASGQRMAFVQFLSG  447 (477)
T ss_pred             EEEEEEECCC-----------CCEEEEEEEECCCCCEEEEEEEECC
T ss_conf             6999874356-----------8357179999899599999999789


No 32 
>COG2066 GlsA Glutaminase [Amino acid transport and metabolism]
Probab=90.85  E-value=1.1  Score=23.11  Aligned_cols=105  Identities=15%  Similarity=0.192  Sum_probs=70.3

Q ss_pred             CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECCE
Q ss_conf             2130010022110011078230108999863078850320189999999999999873-388464104797357667240
Q gi|254781103|r  445 LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGT  523 (598)
Q Consensus       445 ~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTGT  523 (598)
                      +.+|-.+||.+.+++||+|+.             +-..++++++..++.+...|-..- -++.|.-|+--|.+  ||+|-
T Consensus       199 i~~~~~dLA~~g~~LA~~G~~-------------p~tge~v~~~~~ar~i~alM~TcGmYd~sG~fa~rVGlP--~KSGV  263 (309)
T COG2066         199 IEMNCVDLARLGLFLANGGVN-------------PLTGERVVPADQARQINALMLTCGMYDASGEFAYRVGLP--AKSGV  263 (309)
T ss_pred             HHHHHHHHHHHHHHHHCCCCC-------------CCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHCCCC--CCCCC
T ss_conf             883399999988998669908-------------887885777788899999998703623300147630885--33676


Q ss_pred             EEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             3512688766886217999997428880999999807888888874321467899999999999
Q gi|254781103|r  524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA  587 (598)
Q Consensus       524 Aq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~  587 (598)
                      +              .--++..|.   +..++||=  |--    ...|.++|+-.+-+.+.+.+
T Consensus       264 g--------------GGI~AvvPg---~~gIav~s--P~L----d~~GNSv~G~~~le~Ls~~~  304 (309)
T COG2066         264 G--------------GGIMAVVPG---EMGIAVWS--PAL----DEAGNSVAGIAALEQLSQQL  304 (309)
T ss_pred             C--------------CEEEEEECC---CCEEEEEC--CCC----CCCCCCHHHHHHHHHHHHHH
T ss_conf             6--------------605898068---73789877--766----87788359999999999984


No 33 
>pfam02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family.
Probab=90.56  E-value=0.32  Score=26.58  Aligned_cols=123  Identities=17%  Similarity=0.193  Sum_probs=61.4

Q ss_pred             HHHHHHCCCCCEEEEEEECCCC------------CCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCC
Q ss_conf             9998550367123543202333------------3200110122257634468654211112233554410011468752
Q gi|254781103|r  378 IPEIFRYSSNIGAAQIADAMGI------------QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGL  445 (598)
Q Consensus       378 ~~~al~~S~Nv~~~~i~~~lg~------------~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~  445 (598)
                      +++.+.+|-|..+=.+...+|.            ..+.++++++|+... ++-                    +.=|-|+
T Consensus       235 v~~m~k~S~N~~AE~L~~~lg~~~~~~~s~~~g~~~v~~~L~~~gi~~~-~~~--------------------l~DGSGL  293 (383)
T pfam02113       235 LKKMMKKSDNLIAESLFREIGVAIKRPGSFEAGADAVRSILSTAGIDTA-NLV--------------------LRDGSGL  293 (383)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCC-CCE--------------------EECCCCC
T ss_conf             9999741856999999999998627998889999999999997499955-647--------------------8448988


Q ss_pred             ----EEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEECC----CCC---
Q ss_conf             ----130010022110011078230108999863078850320189999999999999873388464104----797---
Q gi|254781103|r  446 ----STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF----VPG---  514 (598)
Q Consensus       446 ----~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~~GTg~~a~----~~g---  514 (598)
                          .+||-+|++....+.+.-.                          .....+.|--.-.+||-+.-.    ..+   
T Consensus       294 Sr~n~is~~~l~~lL~~~~~~~~--------------------------~~~~~~sLPvaG~dGTL~~r~~~~~~~~~~~  347 (383)
T pfam02113       294 SRHNLVTAATLAQLLQAIADQPA--------------------------LQALLDSLPVAGESGTLVGGTLRNRFKGTPA  347 (383)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCC--------------------------HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73345499999999999986943--------------------------8899983982688885555555554457775


Q ss_pred             -EEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCE-EEEEEEE
Q ss_conf             -3576672403512688766886217999997428880-9999998
Q gi|254781103|r  515 -FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ-YIVLSFM  558 (598)
Q Consensus       515 -~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~-~~v~V~v  558 (598)
                       =.|-+||||=.           ...+++||....+.+ |++++++
T Consensus       348 ~G~v~aKTGTL~-----------~V~sLaGyv~~~~G~~l~Fsi~~  382 (383)
T pfam02113       348 VGKVRAKTGSLT-----------GVYSLAGYVTTDSGRKLAFSFIS  382 (383)
T ss_pred             CCEEEEEEEECC-----------CCEEEEEEEECCCCCEEEEEEEE
T ss_conf             675999985006-----------95794799997998999999995


No 34 
>PRK13128 D-aminopeptidase; Reviewed
Probab=88.79  E-value=0.3  Score=26.75  Aligned_cols=75  Identities=15%  Similarity=0.090  Sum_probs=43.9

Q ss_pred             HHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH---HC
Q ss_conf             776442100113234311122302320321112100147311134443232222233245664320123565443---02
Q gi|254781103|r  268 VHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGI---DS  344 (598)
Q Consensus       268 ~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaL---e~  344 (598)
                      ++..|....++++..++++.|  ++.|+|+..-.+---|      ....  ..--....|..||+-|.||+++.|   ++
T Consensus         9 ld~~~~~~~~~~~~PG~aVaV--vkdGkvv~~kgyG~ad------le~~--~Pvt~dT~F~IaSvTK~FTaaail~Lvee   78 (518)
T PRK13128          9 LEAFVHAIPQNYKGPGGAVAV--VKDGEVVLRHAWGFAD------LARR--KAMTPETRMPICSVSKQFTCAVLLDCIGE   78 (518)
T ss_pred             HHHHHHHHHHHCCCCCEEEEE--EECCEEEEEEEEEEEC------CCCC--CCCCCCCEEECHHHHHHHHHHHHHHHHHC
T ss_conf             999999989857899589999--9999999994054442------6779--88999987864313799999999999862


Q ss_pred             CCEECCCCC
Q ss_conf             403204421
Q gi|254781103|r  345 GLFTVKDLF  353 (598)
Q Consensus       345 g~i~~~~~~  353 (598)
                      |.+ .++.+
T Consensus        79 gkl-LDdpV   86 (518)
T PRK13128         79 PEM-LDAAL   86 (518)
T ss_pred             CCC-CCCCH
T ss_conf             986-56637


No 35 
>COG1680 AmpC Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms]
Probab=84.55  E-value=1.7  Score=21.94  Aligned_cols=60  Identities=17%  Similarity=0.208  Sum_probs=39.9

Q ss_pred             CCCCCCCCCHHHHHHHHH---HCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEE
Q ss_conf             245664320123565443---024032044213367632221011234543230039998550367123
Q gi|254781103|r  325 GIFEMGSIFKVFTIAMGI---DSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA  390 (598)
Q Consensus       325 ~~yePGStfKp~t~aaaL---e~g~i~~~~~~~~~~~~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~~  390 (598)
                      ..|+.+|+-|+||+.+.+   |+|++++++.+..--+-     ........ ..+|+++.|.++|=...
T Consensus        87 t~f~i~S~TK~~ta~~i~~LveeG~l~lddpV~~ylP~-----~~~~~~~~-~~iTi~~LL~htSGl~~  149 (390)
T COG1680          87 TVFRIASVTKSFTATLLGKLVEEGKLDLDDPVSKYLPE-----GKDPATGG-APITLRDLLTHTSGLPF  149 (390)
T ss_pred             CEEEEEECHHHHHHHHHHHHHHCCCCCCCCCHHHHCCC-----CCCCCCCC-CCCCHHHHHHCCCCCCC
T ss_conf             54675101799999999999986997610448875786-----44545576-77639999554479987


No 36 
>PRK03642 hypothetical protein; Provisional
Probab=83.14  E-value=1.3  Score=22.63  Aligned_cols=38  Identities=24%  Similarity=0.306  Sum_probs=27.7

Q ss_pred             CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHH
Q ss_conf             52130010022110011078230108999863078850320189999999999
Q gi|254781103|r  444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRS  496 (598)
Q Consensus       444 g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~  496 (598)
                      |+-.|.-+++..+..+.|+|.+               ..+|++++++.+.+..
T Consensus       299 GLfSTa~D~arF~qMlLn~G~~---------------~g~riLs~eTV~~mt~  336 (432)
T PRK03642        299 GLFSNTDDMAVLMQVMLNGGGY---------------GNVQLFDAETVKQFTT  336 (432)
T ss_pred             CCCCCHHHHHHHHHHHHHCCCC---------------CCEECCCHHHHHHHHC
T ss_conf             4437899999999999708972---------------8843249999999964


No 37 
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129   Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli K-12, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK  resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase..
Probab=77.35  E-value=2.2  Score=21.27  Aligned_cols=50  Identities=18%  Similarity=0.403  Sum_probs=34.6

Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCCCCCCEEECCCCCCCEEEECCCCCCCCCCCEEEEHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             33321000000111111246875123100014668516895366676886742555257677777644210011323431
Q gi|254781103|r  205 SRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESV  284 (598)
Q Consensus       205 ~R~YP~~~lashiiGyv~~d~~G~~GlE~~~d~~g~~~~~~~~~~~~~g~dI~lTID~~lQ~~~e~~l~~~~~~~~a~~g  284 (598)
                      .|.||+..= +|+||.||..+.|+|=+                                +.+..++..++.      ...
T Consensus        29 ~~i~p~~Gn-A~~vG~TG~PGaGKSTl--------------------------------~~~l~~~lrRrG------~~V   69 (333)
T TIGR00750        29 ERILPKTGN-AHVVGITGVPGAGKSTL--------------------------------VEKLIMELRRRG------LKV   69 (333)
T ss_pred             HHHHHHCCC-CEEEEEECCCCCCHHHH--------------------------------HHHHHHHHHHCC------CEE
T ss_conf             986243279-07876646888857779--------------------------------999989997659------768


Q ss_pred             EEEEEECCC
Q ss_conf             112230232
Q gi|254781103|r  285 GTVILNVST  293 (598)
Q Consensus       285 avVvmd~~T  293 (598)
                      +||++||.+
T Consensus        70 aViAvDP~S   78 (333)
T TIGR00750        70 AVIAVDPSS   78 (333)
T ss_pred             EEEEECCCC
T ss_conf             999887975


No 38 
>pfam06089 Asparaginase_II L-asparaginase II. This family consists of several bacterial L-asparaginase II proteins. L-asparaginase (EC:3.5.1.1) catalyses the hydrolysis of L-asparagine to L-aspartate and ammonium. Rhizobium etli possesses two asparaginases: asparaginase I, which is thermostable and constitutive, and asparaginase II, which is thermolabile, induced by asparagine and repressed by the carbon source.
Probab=69.29  E-value=2.5  Score=20.89  Aligned_cols=44  Identities=23%  Similarity=0.274  Sum_probs=34.1

Q ss_pred             CCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCE
Q ss_conf             31112230232032111210014731113444323222223324566432012356544302403
Q gi|254781103|r  283 SVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF  347 (598)
Q Consensus       283 ~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i  347 (598)
                      .|.+||+|++ |+|+..++-|+                +.   .| |-|+.|||-+.+.++.|..
T Consensus        15 ~g~~vv~d~~-G~~~~~~Gd~~----------------~~---~~-pRSa~Kp~QAl~~~~sGa~   58 (325)
T pfam06089        15 RGHAVVVDAD-GRVLASAGDPE----------------AP---TF-PRSAAKPFQALPLLESGAA   58 (325)
T ss_pred             EEEEEEECCC-CCEEEECCCCC----------------CC---EE-CHHHHHHHHHHHHHHCCCC
T ss_conf             8999999299-99898617999----------------83---41-3344369999999986840


No 39 
>KOG0506 consensus
Probab=67.20  E-value=4.2  Score=19.45  Aligned_cols=66  Identities=27%  Similarity=0.252  Sum_probs=43.6

Q ss_pred             CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECC
Q ss_conf             52130010022110011078230108999863078850320189999999999999873-38846410479735766724
Q gi|254781103|r  444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTG  522 (598)
Q Consensus       444 g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTG  522 (598)
                      ++.+|---+|.+.||+||||+-             +-..+++++++....+..+|...- -+-+|.-|+--|.+  +|+|
T Consensus       371 SiEvtCes~aVMAaTLANGGvc-------------Pit~E~~l~~~~cRdtLSLMySCGMYD~SGqFaFhVGLP--AKSg  435 (622)
T KOG0506         371 SIEVTCESAAVMAATLANGGVC-------------PITGERCLSPRACRDTLSLMYSCGMYDFSGQFAFHVGLP--AKSG  435 (622)
T ss_pred             EEEEECCHHHHHHHHHHCCCCC-------------CCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCEEEEECCC--CCCC
T ss_conf             2453011789999997538837-------------787770368377778999987526622456357885575--3246


Q ss_pred             EE
Q ss_conf             03
Q gi|254781103|r  523 TA  524 (598)
Q Consensus       523 TA  524 (598)
                      -+
T Consensus       436 Vs  437 (622)
T KOG0506         436 VS  437 (622)
T ss_pred             CC
T ss_conf             66


No 40 
>COG2027 DacB D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4) [Cell envelope biogenesis, outer membrane]
Probab=58.18  E-value=12  Score=16.54  Aligned_cols=134  Identities=19%  Similarity=0.203  Sum_probs=68.4

Q ss_pred             HHHHHHCCCCCEEEEEEECCCCCCCHHHCC-------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHH
Q ss_conf             999855036712354320233332001101-------2225763446865421111223355441001146875213001
Q gi|254781103|r  378 IPEIFRYSSNIGAAQIADAMGIQGHKEFLY-------RLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPL  450 (598)
Q Consensus       378 ~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~-------~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPl  450 (598)
                      +++.+++|-|..+=.+...+|......---       +-.|.++.|||+++..   + .+-+++       +-.-.+||=
T Consensus       299 Lk~m~k~SnN~~Ae~L~~~ig~~~~~~gs~~~~~~~v~~~l~~~~GId~~~~v---L-~DGSGL-------Sr~Nritpr  367 (470)
T COG2027         299 LKDMNKYSDNLMAEALFRAIGGAIKRPGSVSAAADAVRQILLQRAGIDLAGLV---L-ADGSGL-------SRDNRITPR  367 (470)
T ss_pred             HHHHHHHCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEE---E-ECCCCC-------CHHCCCCHH
T ss_conf             99998615089999999984534478742667789999999987398856648---7-418988-------711022989


Q ss_pred             HCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEE-EC---CCCCEEEEEECCEEEE
Q ss_conf             0022110011078230108999863078850320189999999999999873388464-10---4797357667240351
Q gi|254781103|r  451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RA---FVPGFEVGGKTGTAQK  526 (598)
Q Consensus       451 qla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~~GTg~-~a---~~~g~~vaGKTGTAq~  526 (598)
                      .|.++...++-.     |                     ....+.++|=-.-.+||=+ +.   ...| .+-+||||=.-
T Consensus       368 ~l~~~Lq~~~~~-----~---------------------~~~~~~dsLPIAG~~GTL~~R~~~~~~~G-~v~aKTGTL~g  420 (470)
T COG2027         368 TLVQLLQAAAQS-----P---------------------AAAALIDSLPIAGVDGTLRNRLRGTGAAG-KVRAKTGTLTG  420 (470)
T ss_pred             HHHHHHHHHHCC-----C---------------------HHHHHHHHCCCCCCCCCCCCCCCCCCCCC-CEEEEECCCCC
T ss_conf             999999998729-----7---------------------17789984773777875013144678787-17886312324


Q ss_pred             CCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEEC
Q ss_conf             2688766886217999997428880999999807
Q gi|254781103|r  527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDS  560 (598)
Q Consensus       527 ~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~  560 (598)
                                 ....+||.+..+.+-++++++-|
T Consensus       421 -----------V~aLaGyv~~~~g~~l~Fai~~N  443 (470)
T COG2027         421 -----------VSALAGYVTTASGRKLAFAIILN  443 (470)
T ss_pred             -----------CHHHEEEEECCCCCEEEEEEECC
T ss_conf             -----------04111068768898899999658


No 41 
>TIGR00666 PBP4 D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase; InterPro: IPR000667   Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes . They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence . Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases .   Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base . The geometric orientations of the catalytic residues are similar between families, despite different protein folds . The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) , .   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.    This family of serine peptidases belong to MEROPS peptidase family S13 (D-Ala-D-Ala carboxypeptidase C, clan SE). The predicted active site residues for members of this family and family S12 occur in the motif SXXK.    D-Ala-D-Ala carboxypeptidase C is involved in the metabolism of cell components ; it is synthesised with a leader peptide to target it to the cell membrane . After cleavage of the leader peptide, the enzyme is retained in the membrane by a C-terminal anchor . There are three families of serine-type D-Ala-D-Ala peptidase (designated S11, S12 and S13), which are also known as low molecular weight penicillin-binding proteins . Family S13 comprises D-Ala-D-Ala peptidases that have sufficient sequence similarity around their active sites to assume a distant evolutionary relationship to other clan members; members of the S13 family also bind penicillin and have D-amino-peptidase activity. Proteases of family S11 have exclusive D-Ala-D-Ala peptidase activity, while some members of S12 are C beta-lactamases . ; GO: 0004185 serine carboxypeptidase activity, 0006508 proteolysis.
Probab=56.83  E-value=4.6  Score=19.24  Aligned_cols=33  Identities=21%  Similarity=0.296  Sum_probs=23.2

Q ss_pred             EEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEE
Q ss_conf             57667240351268876688621799999742888099999980
Q gi|254781103|r  516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD  559 (598)
Q Consensus       516 ~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~  559 (598)
                      +|-|||||=+-           +.+.+||.-...-+-++++++-
T Consensus       393 kvrAKTGSL~g-----------V~sL~G~~t~~~G~~~aF~~~~  425 (427)
T TIGR00666       393 KVRAKTGSLTG-----------VYSLAGYVTNASGKKLAFSFLL  425 (427)
T ss_pred             EEEEECCCCCE-----------EEEEEEEEECCCCCEEEEEEEE
T ss_conf             37752233421-----------3234777883689889998884


No 42 
>KOG0809 consensus
Probab=55.97  E-value=9.1  Score=17.34  Aligned_cols=13  Identities=23%  Similarity=0.616  Sum_probs=5.4

Q ss_pred             CCCCCCCHHHHHH
Q ss_conf             5664320123565
Q gi|254781103|r  327 FEMGSIFKVFTIA  339 (598)
Q Consensus       327 yePGStfKp~t~a  339 (598)
                      |+--++||=..++
T Consensus       228 ~dL~~if~DL~~l  240 (305)
T KOG0809         228 YDLNQIFKDLSAL  240 (305)
T ss_pred             HHHHHHHHHHHHH
T ss_conf             9999999999999


No 43 
>COG1946 TesB Acyl-CoA thioesterase [Lipid metabolism]
Probab=52.43  E-value=10  Score=16.99  Aligned_cols=11  Identities=27%  Similarity=0.205  Sum_probs=5.3

Q ss_pred             EEEEEEEECCC
Q ss_conf             79999974288
Q gi|254781103|r  539 NSFLAVFPTTD  549 (598)
Q Consensus       539 ~~FvG~~P~~d  549 (598)
                      .||.==++.||
T Consensus       233 ~wFhrp~~~dd  243 (289)
T COG1946         233 MWFHRPFRLDD  243 (289)
T ss_pred             EEEECCCCCCC
T ss_conf             89824566897


No 44 
>pfam02438 Adeno_100 Late 100kD protein. The late 100kD protein is a non-structural viral protein involved in the transport of hexon from the cytoplasm to the nucleus.
Probab=50.48  E-value=9.5  Score=17.23  Aligned_cols=53  Identities=19%  Similarity=0.145  Sum_probs=22.1

Q ss_pred             CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCC----CCC-CHHHHHHHHHHH
Q ss_conf             213001002211001107823010899986307885032----018-999999999999
Q gi|254781103|r  445 LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR----IVL-KKNTVKTMRSLL  498 (598)
Q Consensus       445 ~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~----~vi-s~~~a~~l~~~l  498 (598)
                      +..||=--|+||----.- ..+-|+-|.--.+...+...    =|| +++....++++=
T Consensus       501 lkLTp~lWasAYLrKF~~-~Dyhp~~i~~Yed~~~~~~~~lTACVit~~~ILaqL~~Iq  558 (583)
T pfam02438       501 LKLTPGLWANAYLRKFVE-EDYHPFEIVFYEDQSKPFKAELTACVITQPEILAQLREIQ  558 (583)
T ss_pred             EEECHHHHHHHHHHHCCH-HHCCCCEEEECCCCCCCCCCCCCEEEECCHHHHHHHHHHH
T ss_conf             036788889999963574-2258725784467877789998437856689999999999


No 45 
>TIGR00170 leuC 3-isopropylmalate dehydratase, large subunit; InterPro: IPR004430   3-isopropylmalate dehydratase (or isopropylmalate isomerase; 4.2.1.33 from EC) catalyses the stereo-specific isomerisation of 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate. This enzyme performs the second step in the biosynthesis of leucine, and is present in most prokaryotes and many fungal species. The prokaryotic enzyme is a heterodimer composed of a large (LeuC) and small (LeuD) subunit, while the fungal form is a monomeric enzyme. Both forms of isopropylmalate are related and are part of the larger aconitase family . Aconitases are mostly monomeric proteins which share four domains in common and contain a single, labile [4Fe-4S] cluster. Three structural domains (1, 2 and 3) are tightly packed around the iron-sulphur cluster, while a fourth domain (4) forms a deep active-site cleft. The prokaryotic enzyme is encoded by two adjacent genes, leuC and leuD, corresponding to aconitase domains 1-3 and 4 respectively , . LeuC does not bind an iron-sulphur cluster. It is thought that some prokaryotic isopropylamalate dehydrogenases can also function as homoaconitase 4.2.1.36 from EC, converting cis-homoaconitate to homoisocitric acid in lysine biosynthesis . Homoaconitase has been identified in higher fungi (mitochondria) and several archaea and one thermophilic species of bacteria, Thermus thermophilus .    Members of this entry are 3-isopropylmalate dehydratase, large subunit, or the large subunit domain of single-chain forms. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (4.2.1 from EC) and bind a [4Fe-4S]-cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The archaeal leuC-like proteins are not included in group.; GO: 0003861 3-isopropylmalate dehydratase activity, 0051539 4 iron 4 sulfur cluster binding, 0009098 leucine biosynthetic process, 0009316 3-isopropylmalate dehydratase complex.
Probab=46.59  E-value=19  Score=15.37  Aligned_cols=44  Identities=11%  Similarity=0.191  Sum_probs=21.6

Q ss_pred             CCCEEEEHHHHHHH--HHHHHHHHCCCCCCCCCEEEEEECCCHHHHH
Q ss_conf             67425552576777--7764421001132343111223023203211
Q gi|254781103|r  254 QPIRLALDLRIQNI--VHQELVENKKKYNAESVGTVILNVSTGEVIS  298 (598)
Q Consensus       254 ~dI~lTID~~lQ~~--~e~~l~~~~~~~~a~~gavVvmd~~TGeILA  298 (598)
                      ++++.+++=.+|.=  +-|.+..-+-++....|+.-|++-- ||++-
T Consensus       170 K~m~i~V~Gk~~~GiTaKD~iLaiIGk~g~agGTG~ViEf~-GEai~  215 (472)
T TIGR00170       170 KTMKIEVDGKLAPGITAKDIILAIIGKTGVAGGTGHVIEFC-GEAIR  215 (472)
T ss_pred             CEEEEEEEEEECCCCCHHHHHHHHHHHHCCCCCCEEEEECC-CHHHH
T ss_conf             50589985576688845666665433312588750688401-06864


No 46 
>KOG3285 consensus
Probab=45.87  E-value=19  Score=15.30  Aligned_cols=47  Identities=17%  Similarity=0.246  Sum_probs=36.0

Q ss_pred             CCCCCEEEEHHHHHHHHHHHHHHHCCCC----CCCCCEEEEEECCCHHHHHH
Q ss_conf             8867425552576777776442100113----23431112230232032111
Q gi|254781103|r  252 NLQPIRLALDLRIQNIVHQELVENKKKY----NAESVGTVILNVSTGEVISM  299 (598)
Q Consensus       252 ~g~dI~lTID~~lQ~~~e~~l~~~~~~~----~a~~gavVvmd~~TGeILAm  299 (598)
                      =|.++-.+-|.+++..+...+.. +++|    .-+.-..|+++..|||||--
T Consensus        48 YgLtllvs~D~elk~f~~~ilsQ-~~~WL~~~kiqklvlvI~~~~tgEvlEr   98 (203)
T KOG3285          48 YGLTLLVSHDEELKTFIRNILSQ-VHEWLSKGKIQKLVLVITSKHTGEVLER   98 (203)
T ss_pred             CCCEEEEECCHHHHHHHHHHHHH-HHHHHHHCCCCEEEEEEEECCCCCCHHH
T ss_conf             08158885278899999999999-9999970873349999984454011422


No 47 
>COG5445 Predicted secreted protein [Function unknown]
Probab=45.40  E-value=9.1  Score=17.35  Aligned_cols=73  Identities=11%  Similarity=0.054  Sum_probs=43.5

Q ss_pred             CCCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHC
Q ss_conf             6643201235654430240320442133676322210112345432300399985503671235432023333200110
Q gi|254781103|r  328 EMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL  406 (598)
Q Consensus       328 ePGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~  406 (598)
                      +-||++|.++++...+...  ...-+-|-+...-   ...|.. .+..+.-..++.+||--+|.---..+|++....|+
T Consensus        57 PLgsvwkL~v~a~L~s~~~--ae~~y~c~g~s~e---evycca-~g~Tigr~~alV~scGlyf~pdrl~~~~a~w~gyw  129 (268)
T COG5445          57 PLGSVWKLFVYAWLQSTAQ--AEPDYLCIGNSPE---EVYCCA-AGQTIGRDTALVRSCGLYFAPDRLHLGPAAWRGYW  129 (268)
T ss_pred             HHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCHH---CEEEEC-CCCCCCCHHEEEEECCCEECCCCCCCCHHHHHHHH
T ss_conf             0789999999999985156--7898667799700---048834-88756631002433452116773414877777688


No 48 
>pfam00957 Synaptobrevin Synaptobrevin.
Probab=45.00  E-value=9.3  Score=17.27  Aligned_cols=53  Identities=19%  Similarity=0.139  Sum_probs=34.6

Q ss_pred             CCCCEEEECCCHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             355300100000022222035885535650011046778875778888664799
Q gi|254781103|r   22 NHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIG   75 (598)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~kk~~~~~k~Ri~   75 (598)
                      ..+..|..|..++=-|. +.=...+++.....+.+.-|++.-++..-+..+|-.
T Consensus        14 ev~~iM~~Ni~~il~Rg-e~L~~L~~ks~~L~~~s~~F~~~a~~l~r~~~w~~~   66 (89)
T pfam00957        14 EVKDIMTENIDKVLERG-EKLDELVDKTENLQSQAQQFRKQARKLKRKMWWKNM   66 (89)
T ss_pred             HHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999988-469999999999988899999999999999999989


No 49 
>TIGR01204 bioW 6-carboxyhexanoate--CoA ligase; InterPro: IPR005499 This family contains the enzyme 6-carboxyhexanoate--CoA ligase 6.2.1.14 from EC. This enzyme is involved in the first step of biotin synthesis, where it converts pimelate into pimeloyl-CoA . The enzyme requires magnesium as a cofactor and forms a homodimer .; GO: 0009102 biotin biosynthetic process.
Probab=43.20  E-value=19  Score=15.28  Aligned_cols=39  Identities=15%  Similarity=0.208  Sum_probs=28.1

Q ss_pred             EHHHHHHHHHHHHHHHCC-CCCCCCCEEEEEECCCHHHHHH
Q ss_conf             525767777764421001-1323431112230232032111
Q gi|254781103|r  260 LDLRIQNIVHQELVENKK-KYNAESVGTVILNVSTGEVISM  299 (598)
Q Consensus       260 ID~~lQ~~~e~~l~~~~~-~~~a~~gavVvmd~~TGeILAm  299 (598)
                      |..++|..|.+.|.+..+ +.+.-+| ||+||..||+=|--
T Consensus        85 v~~~v~~kA~e~l~~~~nPkGGn~RG-AvL~di~TG~Rld~  124 (238)
T TIGR01204        85 VSKEVAEKAYELLAKGANPKGGNLRG-AVLLDIETGKRLDE  124 (238)
T ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCE-EEEEECCCCCCHHC
T ss_conf             42899999988424778889874102-47852222760011


No 50 
>cd03444 Thioesterase_II_repeat1 Thioesterase II (TEII) is thought to regenerate misprimed nonribosomal peptide synthetases (NRPSs) as well as modular polyketide synthases (PKSs) by hydrolyzing acetyl groups bound to the peptidyl carrier protein (PCP) and acyl carrier protein (ACP) domains, respectively. TEII has two tandem asymmetric hot dog folds that are structurally similar to one found in PaaI thioesterase, 4-hydroxybenzoyl-CoA thioesterase (4HBT) and beta-hydroxydecanoyl-ACP dehydratase and thus, the TEII monomer is equivalent to the homodimeric form of the latter three enzymes. Human TEII is expressed in T cells and has been shown to bind the product of the HIV-1 Nef gene.
Probab=43.07  E-value=16  Score=15.82  Aligned_cols=18  Identities=28%  Similarity=0.449  Sum_probs=13.2

Q ss_pred             CCCEEECCCCEEEEEEEE
Q ss_conf             997457648708168697
Q gi|254781103|r  115 SRPDIIDRNGEILATDIP  132 (598)
Q Consensus       115 ~RG~I~DRNG~~LA~n~~  132 (598)
                      .||.|||++|+++|+...
T Consensus        83 ~~g~i~~~~G~LvAs~~Q  100 (104)
T cd03444          83 VEGRIFTRDGELVASVAQ  100 (104)
T ss_pred             EEEEEECCCCCEEEEEEE
T ss_conf             999999999999999970


No 51 
>PTZ00112 origin recognition complex 1 protein; Provisional
Probab=41.89  E-value=22  Score=14.91  Aligned_cols=10  Identities=30%  Similarity=0.531  Sum_probs=7.3

Q ss_pred             ECCCCEEEEE
Q ss_conf             7648708168
Q gi|254781103|r  120 IDRNGEILAT  129 (598)
Q Consensus       120 ~DRNG~~LA~  129 (598)
                      -|-|+++.|.
T Consensus       113 ~d~n~kl~aE  122 (650)
T PTZ00112        113 QDTNSKLMAE  122 (650)
T ss_pred             ECCCCCEEEE
T ss_conf             7688748999


No 52 
>KOG2302 consensus
Probab=41.87  E-value=22  Score=14.91  Aligned_cols=14  Identities=14%  Similarity=0.491  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999998643
Q gi|254781103|r   79 VVCLVIYIILAIRI   92 (598)
Q Consensus        79 ~v~~ii~~il~~rl   92 (598)
                      |.+|.||.|.++||
T Consensus       217 ffvffifgivgvql  230 (1956)
T KOG2302         217 FFVFFIFGIVGVQL  230 (1956)
T ss_pred             HHHHHHHHHHHHHH
T ss_conf             99999998879999


No 53 
>COG5325 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion]
Probab=39.15  E-value=24  Score=14.65  Aligned_cols=11  Identities=27%  Similarity=0.721  Sum_probs=3.9

Q ss_pred             CCCCCCCHHHH
Q ss_conf             56643201235
Q gi|254781103|r  327 FEMGSIFKVFT  337 (598)
Q Consensus       327 yePGStfKp~t  337 (598)
                      +|.-++|+=+-
T Consensus       205 ~Eln~IF~dL~  215 (283)
T COG5325         205 YELNEIFRDLG  215 (283)
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999


No 54 
>KOG0860 consensus
Probab=38.19  E-value=25  Score=14.55  Aligned_cols=47  Identities=21%  Similarity=0.405  Sum_probs=29.1

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             88553565001104677887577888-----866479999999999999998
Q gi|254781103|r   43 HNLCQKGCHMEDGQDLFQKRRRKVIA-----HSKNRIGMTIVVCLVIYIILA   89 (598)
Q Consensus        43 ~~~~~~~~~~~d~~~~~~~~~kk~~~-----~~k~Ri~il~~v~~ii~~il~   89 (598)
                      ..+.++.+.-++++.-|++.-.|.+-     ..|.|+.+.++++++++.++.
T Consensus        60 ~~L~drad~L~~~as~F~~~A~klkrk~wWkn~Km~~il~~v~~i~l~iiii  111 (116)
T KOG0860          60 DELDDRADQLQAGASQFEKTAVKLKRKMWWKNCKMRIILGLVIIILLVVIII  111 (116)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7899899999999999999999999999999878999999999999999999


No 55 
>pfam06977 SdiA-regulated SdiA-regulated. This family represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators. Some family members contain the pfam01436 repeat.
Probab=37.26  E-value=15  Score=16.00  Aligned_cols=72  Identities=13%  Similarity=0.254  Sum_probs=40.3

Q ss_pred             CCCCCCCCCCCCCCCEEECCCCCCCEEEECCCCCC---------CCCCCEEEEHHHHHHHHHHHHHHHCCCCCCCCCEEE
Q ss_conf             11111246875123100014668516895366676---------886742555257677777644210011323431112
Q gi|254781103|r  217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEK---------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV  287 (598)
Q Consensus       217 iiGyv~~d~~G~~GlE~~~d~~g~~~~~~~~~~~~---------~g~dI~lTID~~lQ~~~e~~l~~~~~~~~a~~gavV  287 (598)
                      .+|.-..+|+|.+||  .||..+..-+...++.|+         .+.++....+..+   .+       ...-...-+.+
T Consensus         3 ~Lg~~~~~NkGfEGl--a~d~~~~~l~v~kEr~P~~l~e~~~~~~~~~~~~~~~~~~---~~-------~~~~~~DlS~l   70 (101)
T pfam06977         3 TLGLDKSGNKGFEGL--AWDARGDRLFVAKERDPVALYEVNGFFDGNDLLVGDDSAL---LD-------DDLFLRDLSSL   70 (101)
T ss_pred             CCCCCCCCCCCCEEE--EECCCCCEEEEEEECCCCEEEEEECCCCCCCCEECCCCCC---CC-------CCEEECCCCCC
T ss_conf             124377888463877--8858999899998038868999703688630221344456---54-------56024025440


Q ss_pred             EEECCCHHHHHHH
Q ss_conf             2302320321112
Q gi|254781103|r  288 ILNVSTGEVISMV  300 (598)
Q Consensus       288 vmd~~TGeILAma  300 (598)
                      ..|+.||..|.+.
T Consensus        71 ~~d~~sghLlvLS   83 (101)
T pfam06977        71 HFDPRTGHLLVLS   83 (101)
T ss_pred             EECCCCCCEEEEE
T ss_conf             6538999099997


No 56 
>PRK10815 sensor protein PhoQ; Provisional
Probab=36.33  E-value=16  Score=15.81  Aligned_cols=21  Identities=29%  Similarity=0.194  Sum_probs=15.4

Q ss_pred             CCEEECCCCEEEEEEEEEEEE
Q ss_conf             974576487081686977999
Q gi|254781103|r  116 RPDIIDRNGEILATDIPTFSL  136 (598)
Q Consensus       116 RG~I~DRNG~~LA~n~~~y~i  136 (598)
                      ...|||.+|.++..+.....+
T Consensus        83 ~~~iyd~~g~l~~~~~~~~~l  103 (484)
T PRK10815         83 LTLIYDENGNLLWAQRDVPWL  103 (484)
T ss_pred             EEEEECCCCCEEEEECCCHHH
T ss_conf             588976988478751333011


No 57 
>TIGR00065 ftsZ cell division protein FtsZ; InterPro: IPR000158   In bacteria, FtsZ , ,  is an essential cell division protein which appears to be involved in the initiation of this event. It assembles into a cytokinetic ring on the inner surface of the cytoplasmic membrane at the place where division will occur. The ring serves as a scaffold that is disassembled when septation is completed. FtsZ ring formation is initiated at a single site on one side of the bacterium and appears to grow bidirectionally. In Escherichia coli, MinCD IPR005526 from INTERPRO, encoded by the MinB locus, form a complex which appears to block the formation of FtsZ rings at the cell poles, at the ancient mid cell division sites, whilst MinE, encoded at the same locus, specifically prevents the action of MinCD at mid cell.    FtsZ is a GTP binding protein PDOC00199 from PROSITEDOC with a GTPase activity. It undergoes GTP-dependent polymerization into filaments (or tubules) that seem to form a cytoskeleton involved in septum synthesis. The structure and the properties of FtsZ clearly provide it with the capacity for the cytoskeletal, perhaps motor role, necessary for "contraction" along the division plane. In addition, however, the FtsZ ring structure provides the framework for the recruitment or assembly of the ten or so membrane and cytoplasmic proteins, uniquely required for cell division in E. coli or Bacillus subtilis, some of which are required for biogenesis of the new hemispherical poles of the two daughter cells. FtsZ can polymerize into various structures, for example a single linear polymer of FtsZ monomers, called a protofilament. Protofilaments can associate laterally to form pairs (sometimes called thick filaments, bundles (ill-defined linear associations of multiple protofilaments or thick filaments, sheets (parallel or anti-parallel two-dimensional associations of thick filaments and tubes (anti-parallel associations of thick filaments in a circular fashion to form a tubular structure). In addition, small circles of FtsZ monomers (a short protofilament bent around to join itself, apparently head to tail) have been observed and termed mini-rings.    FtsZ is a protein of about 400 residues which is well conserved across bacterial species and which is also present in the chloroplast of plants  as well as in archaebacteria . FtsZ shows structural similarity with eukaryotic tubulins. This similarity is probably both evolutionary and functionally significant.; GO: 0005525 GTP binding, 0005737 cytoplasm.
Probab=35.88  E-value=21  Score=14.99  Aligned_cols=119  Identities=12%  Similarity=-0.038  Sum_probs=57.5

Q ss_pred             EEHHHHHHHHHHH-HHHHCCCC-CCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCC-CCCC--CCCCCCCCCCCCCCC
Q ss_conf             5525767777764-42100113-23431112230232032111210014731113444-3232--222233245664320
Q gi|254781103|r  259 ALDLRIQNIVHQE-LVENKKKY-NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGK-KEGW--FNRISYGIFEMGSIF  333 (598)
Q Consensus       259 TID~~lQ~~~e~~-l~~~~~~~-~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~-~~~~--~Nra~~~~yePGStf  333 (598)
                      -|..|+|+..... ..+-+--- +-.+|-..==+|.=|+-.|--|.-     ...... +.++  .-=-+-+.-=.||+ 
T Consensus        52 A~NTD~Q~L~~~~~A~~kilIG~~~TrGLGAGG~P~iG~~AAees~d-----~i~~~l~GaDmVFitAGmGGGTGTGAA-  125 (365)
T TIGR00065        52 AINTDAQHLKTTKYAPKKILIGKKLTRGLGAGGNPEIGRKAAEESRD-----EIRELLEGADMVFITAGMGGGTGTGAA-  125 (365)
T ss_pred             EECCCHHHHHCCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHH-----HHHHHCCCCCEEEEEECCCCCCCCCCH-
T ss_conf             97483785411556241356157335567679983888999898899-----999970388818997258668666635-


Q ss_pred             HHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEE
Q ss_conf             12356544302403204421336763222101123454323003999855036712354
Q gi|254781103|r  334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ  392 (598)
Q Consensus       334 Kp~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~~~~  392 (598)
                       |+++=.|=|.|.++-.   =++.|+.+.|.+-+.. -..|    -+.|.++|.+..+-
T Consensus       126 -PVvA~~AK~~GaLTva---vVT~PF~~EG~kr~~~-A~~G----l~~L~~~~Dt~ivI  175 (365)
T TIGR00065       126 -PVVAKIAKELGALTVA---VVTKPFKFEGKKRRKK-AEEG----LERLKQAVDTLIVI  175 (365)
T ss_pred             -HHHHHHHHHCCEEEEE---EECCCCCCHHHHHHHH-HHHH----HHHHHHHCCEEEEE
T ss_conf             -7899999757906999---8428741015899999-9987----89876556847882


No 58 
>pfam07423 DUF1510 Protein of unknown function (DUF1510). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=34.47  E-value=29  Score=14.18  Aligned_cols=29  Identities=17%  Similarity=0.301  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHEEEEEEC
Q ss_conf             64799999999999999986431343441
Q gi|254781103|r   71 KNRIGMTIVVCLVIYIILAIRIIQYGNIH   99 (598)
Q Consensus        71 k~Ri~il~~v~~ii~~il~~rl~~lq~~~   99 (598)
                      ..=+++++.+++|+.+++..+||.-..-.
T Consensus        13 n~vLNiaI~iV~llIiiva~~lf~~~~~~   41 (214)
T pfam07423        13 NRVLNIAIGIVVVLIIIVAYQLFFPSSPS   41 (214)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHEEECCCCC
T ss_conf             34557999999999999766402358875


No 59 
>pfam11189 DUF2973 Protein of unknown function (DUF2973). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently they have no known function.
Probab=33.45  E-value=27  Score=14.36  Aligned_cols=16  Identities=25%  Similarity=0.802  Sum_probs=10.7

Q ss_pred             CCCEEECCCCEEEEEE
Q ss_conf             9974576487081686
Q gi|254781103|r  115 SRPDIIDRNGEILATD  130 (598)
Q Consensus       115 ~RG~I~DRNG~~LA~n  130 (598)
                      .-.+.+|.||+++-+.
T Consensus        45 ~HPEllD~~G~~~~E~   60 (65)
T pfam11189        45 THPELLDEDGNLTKED   60 (65)
T ss_pred             CCHHHHCCCCCCCCCC
T ss_conf             8878876589841673


No 60 
>pfam10307 DUF2410 Hypothetical protein (DUF2410). This is a family of proteins conserved in fungi. The function is not known.There are two characteristic sequence motifs, GGWW and TGR.
Probab=31.82  E-value=17  Score=15.58  Aligned_cols=17  Identities=18%  Similarity=0.380  Sum_probs=6.2

Q ss_pred             CCCHHHHCCEECCEEEE
Q ss_conf             11001107823010899
Q gi|254781103|r  455 AAAALINEGRLIPPTFM  471 (598)
Q Consensus       455 ~~atiAN~G~~~~P~lv  471 (598)
                      .+..++|||.+..|+++
T Consensus        20 ~~~~~~nGGWW~d~~~L   36 (200)
T pfam10307        20 SPESFANGGWWHDPRIL   36 (200)
T ss_pred             CCCCCCCCCCCCCCHHH
T ss_conf             64547788876784488


No 61 
>TIGR01215 minE cell division topological specificity factor MinE; InterPro: IPR005527    Cytokinesis needs to be regulated spatially in order to ensure that it occurs between the daughter genomes. In prokaryotes such as Escherichia coli, cytokinesis is initiated by FtsZ, a tubulin-like protein that assembles into a ring structure at the cell centre called the Z ring. A fundamental problem in prokaryotic cell biology is to understand how the midcell division site is identified. Two major negative regulatory systems are known to be involved in preventing Z-ring assembly at all sites except the midcell. One of these systems, called nucleoid occlusion, blocks Z-ring assembly in the area occupied by an unsegregated nucleoid until a critical stage in chromosome replication or segregation is reached. The other system consists of three proteins, MinC, MinD and MinE, which prevent assembly of Z rings in regions of the cell not covered by the nucleoid, such as the cell poles. MinC is an inhibitor of FtsZ polymerization, resulting in the inhibition of Z ring assembly in the cell; MinD greatly enhances the inhibitory effects of MinC in vivo; and MinE antagonizes the effects of MinC and MinD .     MinE is a small bifunctional protein. The amino terminus of MinE is required to interact with MinD, while the carboxyl terminus is required for 'topological specificity' - that is, the ability of MinE to antagonize MinCD inhibition of Z rings at the midcell position but not at the poles..
Probab=30.52  E-value=24  Score=14.66  Aligned_cols=22  Identities=18%  Similarity=0.587  Sum_probs=14.7

Q ss_pred             HHHHHHH-HHHHHHHHHHHHHHH
Q ss_conf             6778875-778888664799999
Q gi|254781103|r   57 DLFQKRR-RKVIAHSKNRIGMTI   78 (598)
Q Consensus        57 ~~~~~~~-kk~~~~~k~Ri~il~   78 (598)
                      +||..++ |+.+..+|.|+-+++
T Consensus         5 ~ff~~r~~k~Sa~~Ak~RL~li~   27 (89)
T TIGR01215         5 EFFKSRKGKNSAEVAKDRLQLIV   27 (89)
T ss_pred             HHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             23428888641789999998876


No 62 
>COG0851 MinE Septum formation topological specificity factor [Cell division and chromosome partitioning]
Probab=29.39  E-value=30  Score=14.05  Aligned_cols=22  Identities=23%  Similarity=0.557  Sum_probs=15.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             6778875778888664799999
Q gi|254781103|r   57 DLFQKRRRKVIAHSKNRIGMTI   78 (598)
Q Consensus        57 ~~~~~~~kk~~~~~k~Ri~il~   78 (598)
                      +||..++++.+..+|.|+-+++
T Consensus         5 dff~~r~~~Sa~~AkeRLQiil   26 (88)
T COG0851           5 DFFFSRKKNSAETAKERLQLIL   26 (88)
T ss_pred             HHHHHCCCCCHHHHHHHHHHHH
T ss_conf             8887357783788998888754


No 63 
>TIGR02832 spo_yunB sporulation protein YunB; InterPro: IPR014197   This entry represents the sporulation protein YunB. In Bacillus subtilis its expression is controlled by sigmaE.The gene yunB seems to code for a protein involved, at least indirectly, in the pathway leading to the activation of sigmaK. Inactivation of yunB delays sigmaK activation and results in reduced sporulation efficiency ..
Probab=28.76  E-value=29  Score=14.15  Aligned_cols=29  Identities=10%  Similarity=0.150  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHEEEEEEC
Q ss_conf             64799999999999999986431343441
Q gi|254781103|r   71 KNRIGMTIVVCLVIYIILAIRIIQYGNIH   99 (598)
Q Consensus        71 k~Ri~il~~v~~ii~~il~~rl~~lq~~~   99 (598)
                      .+|+.+++++|++++.+.++.+++.++-.
T Consensus         3 ~r~ill~~~il~~~~~~~~~~i~d~~i~P   31 (220)
T TIGR02832         3 IRRILLISLILFILLLLTFLYIVDSLIKP   31 (220)
T ss_pred             EEEEHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             45313678999999999999998654368


No 64 
>pfam03356 Pox_LP_H2 Viral late protein H2. All Members of this family show similarity to the vaccinia virus late protein H2. This protein is often referred# to by its gene name H2R. Members from this family all belong to the viral taxon Poxviridae.
Probab=28.67  E-value=36  Score=13.57  Aligned_cols=50  Identities=4%  Similarity=0.197  Sum_probs=27.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHEEEEEECCHHHHC---------EE--------EEEEECCCCCEEECCC
Q ss_conf             99999999999999986431343441532321---------00--------0466517997457648
Q gi|254781103|r   74 IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP---------SM--------NIDEYGMSRPDIIDRN  123 (598)
Q Consensus        74 i~il~~v~~ii~~il~~rl~~lq~~~~~~~~~---------~~--------~~~~i~a~RG~I~DRN  123 (598)
                      -....++|+++++++++=|+++|+.+..-.++         .+        ....++..||...--+
T Consensus        27 a~~stl~ff~l~L~iS~llf~~Q~s~n~~~~eL~ky~RIKn~i~sWkpLV~~KT~iEsdrGr~~~~~   93 (189)
T pfam03356        27 AKTSTLIFFVLILLISVLLFWFQTSDNSVLSELAKYARIKNNIKSWKPLVESKTKIESDRGRALALG   93 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             4023289999999999998742122781899999999999856201678888888776452575358


No 65 
>PRK10458 DNA cytosine methylase; Provisional
Probab=28.45  E-value=35  Score=13.59  Aligned_cols=21  Identities=10%  Similarity=0.164  Sum_probs=19.2

Q ss_pred             CCHHHHHHHHHHHHHHHHHHC
Q ss_conf             321467899999999999981
Q gi|254781103|r  570 TAGINVAPMVGNIIRRSASML  590 (598)
Q Consensus       570 ~Gg~~AaPi~~~I~~~~~~~~  590 (598)
                      .|.+|+.||++.|++.+.|+.
T Consensus       439 ~GNSVtVPVI~AIAK~~~~~i  459 (470)
T PRK10458        439 FGNSVVVPVFAAVAKLLEPKI  459 (470)
T ss_pred             CCCEEEHHHHHHHHHHHHHHH
T ss_conf             598662799999999989999


No 66 
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases. Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder.
Probab=26.97  E-value=35  Score=13.61  Aligned_cols=38  Identities=13%  Similarity=-0.004  Sum_probs=18.1

Q ss_pred             CHHHHHH----CCCCCEEEEEEECCCCCCCHHHCCCCCCCCC
Q ss_conf             3999855----0367123543202333320011012225763
Q gi|254781103|r  377 TIPEIFR----YSSNIGAAQIADAMGIQGHKEFLYRLGLLSK  414 (598)
Q Consensus       377 t~~~al~----~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~  414 (598)
                      .+-+|+.    .-.|+-++-+++-=-.+.+.+.++++|+.+.
T Consensus       210 ~Li~A~~~l~~~~p~~~lvIvGdGp~~~~L~~l~~~~~l~~~  251 (398)
T cd03796         210 LLVGIIPEICKKHPNVRFIIGGDGPKRILLEEMREKYNLQDR  251 (398)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHCCCCE
T ss_conf             999999999965899599993787118999999987233672


No 67 
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]
Probab=26.61  E-value=31  Score=14.00  Aligned_cols=38  Identities=26%  Similarity=0.276  Sum_probs=23.2

Q ss_pred             EECCCCCCCHHHCCCCCCCC-------CCCCCCCCCC-CCCCCCCC
Q ss_conf             20233332001101222576-------3446865421-11122335
Q gi|254781103|r  394 ADAMGIQGHKEFLYRLGLLS-------KLETELPEIQ-APSYPSQW  431 (598)
Q Consensus       394 ~~~lg~~~~~~~~~~fG~g~-------~t~idlp~e~-~g~~p~~~  431 (598)
                      ++..-+..+..++.++||+.       .|.+|||... +|..+-.|
T Consensus       252 aQNtT~~QmKMfLTRiGf~skmvItGD~tQiDLp~~vkSGL~~a~~  297 (348)
T COG1702         252 AQNTTVGQMKMFLTRIGFESKMVITGDITQIDLPRGVKSGLHPALE  297 (348)
T ss_pred             CCCCCHHHHCEEEEEECCCCEEEEECCCCCCCCCCCCCCCCHHHHH
T ss_conf             1005064513400331377426997575211477653022557899


No 68 
>KOG3547 consensus
Probab=25.02  E-value=28  Score=14.23  Aligned_cols=92  Identities=9%  Similarity=-0.004  Sum_probs=42.0

Q ss_pred             HHHHHHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHEEEEEECCH-------HHHCEEEEEEECCCCC----EEECC
Q ss_conf             4677887577888--866479999999999999998643134344153-------2321000466517997----45764
Q gi|254781103|r   56 QDLFQKRRRKVIA--HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-------PIAPSMNIDEYGMSRP----DIIDR  122 (598)
Q Consensus        56 ~~~~~~~~kk~~~--~~k~Ri~il~~v~~ii~~il~~rl~~lq~~~~~-------~~~~~~~~~~i~a~RG----~I~DR  122 (598)
                      ..|++-.-|++.+  ++-.+-.++++++..+..++.-..  +...+.+       -...+....++.-..|    .|++|
T Consensus        15 ~~f~kll~rWkGSiwKai~~el~~~l~~Y~~i~~iYR~~--l~~~qq~~Fe~~~~~~d~~~~~iPLtFmLGFfVt~Vv~R   92 (450)
T KOG3547          15 FTFLKLLLRWKGSIWKAIWKELLIWLILYYIISVIYRFA--LTESQQETFEKFVMYCDSRLDFIPLTFMLGFFVTIVVDR   92 (450)
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             799999989465899999999999999999999999984--588787999999999842255566267666568799999


Q ss_pred             CCEEEEEEEEEEEEEEEHHHHCCHHHHHHHHHHHHCCCCH
Q ss_conf             8708168697799999733809989999999888079998
Q gi|254781103|r  123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS  162 (598)
Q Consensus       123 NG~~LA~n~~~y~i~i~P~~i~~~~~~~~~L~~il~~~~~  162 (598)
                      =.+.. .|            +.-++..+...+..+++.++
T Consensus        93 W~~~f-~n------------ig~id~~a~~vs~~i~g~d~  119 (450)
T KOG3547          93 WWKQF-RN------------IGWIDNLALLVSAYIPGTDE  119 (450)
T ss_pred             HHHHH-HC------------CCCHHHHHHHHHHHCCCCCH
T ss_conf             99997-64------------68616899999987469867


No 69 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=24.49  E-value=20  Score=15.13  Aligned_cols=12  Identities=25%  Similarity=0.634  Sum_probs=6.7

Q ss_pred             EEEECCCHHHHH
Q ss_conf             223023203211
Q gi|254781103|r  287 VILNVSTGEVIS  298 (598)
Q Consensus       287 Vvmd~~TGeILA  298 (598)
                      -++||.|||||.
T Consensus        80 s~~dPrTGEIl~   91 (197)
T cd04276          80 SVVDPRTGEILK   91 (197)
T ss_pred             CCCCCCCCCEEE
T ss_conf             757999866776


No 70 
>TIGR00381 cdhD CO dehydrogenase/acetyl-CoA synthase, delta subunit; InterPro: IPR004486 This is the small subunit of a heterodimer which catalyzes the reaction CO + H2O + Acceptor = CO2 + Reduced acceptor and is involved in the synthesis of acetyl-CoA from CO2 and H2.; GO: 0006730 one-carbon compound metabolic process.
Probab=23.24  E-value=43  Score=13.07  Aligned_cols=43  Identities=16%  Similarity=0.311  Sum_probs=23.3

Q ss_pred             EECCC-CHHHHHHHHHHHCCCCEECCHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             61379-999999976310137501202333321000000111111246
Q gi|254781103|r  178 LRRKL-SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDID  224 (598)
Q Consensus       178 i~r~i-s~~~~~~I~~~~lpGi~~~~~~~R~YP~~~lashiiGyv~~d  224 (598)
                      ++.++ ..|+...+.+  +|-..|++. +|.||- .+..=.+|-+-.|
T Consensus        44 ~~e~~PA~E~l~~~~~--lp~~~fePp-~e~YPG-~i~eV~lG~~K~e   87 (401)
T TIGR00381        44 VKEEVPAVEELKIVKE--LPRAEFEPP-VEEYPG-KIEEVKLGATKAE   87 (401)
T ss_pred             CCCCCCCCCCHHHHHH--HHHHHCCCC-CCCCCC-EEEEEECCCCCCC
T ss_conf             3100673000122788--776425787-434787-0456633674368


No 71 
>pfam01011 PQQ PQQ enzyme repeat. The family represent a single repeat of a beta propeller. This propeller has been found in several enzymes which utilize pyrrolo-quinoline quinone as a prosthetic group.
Probab=22.89  E-value=37  Score=13.46  Aligned_cols=19  Identities=21%  Similarity=0.209  Sum_probs=14.8

Q ss_pred             CCCCEEEEEECCCHHHHHH
Q ss_conf             3431112230232032111
Q gi|254781103|r  281 AESVGTVILNVSTGEVISM  299 (598)
Q Consensus       281 a~~gavVvmd~~TGeILAm  299 (598)
                      ...|.+.++|.+||+++=-
T Consensus         7 ~~~G~l~AlD~~tGk~~W~   25 (38)
T pfam01011         7 TADGRLYALDAKTGKVLWK   25 (38)
T ss_pred             CCCCEEEEEECCCCCEEEE
T ss_conf             4588699988778827899


No 72 
>TIGR01312 XylB xylulokinase; InterPro: IPR006000   The ability to metabolise xylose, one of the most abundant sugars in nature, is dependent on its conversion to xylulose-5-phosphate, which then enters the non-oxidative pentose phosphate pathway . Xylulose-5-phosphate is produced from xylose by the sequential action of two enzymes; xylose isomerase, which converts xylose to xylulose, and xylulokinase, which subsequently phosphorylates xylulose.   This entry represents bacterial xylulokinase. In addition to its role in xylose metabolism this enzyme may also have a biosynthetic role. 1-deoxy-D-xylulose 5-phosphate serves as a precursor for the biosynthesis of the vitamins thiamine and pyridoxal and for the formation of isopentenyl pyrophosphate and dimethylallyl pyrophosphate via the nonmevalonate pathway of terpenoid biosynthesis. Xylulokinase catalyses the phosphorylation of 1-deoxy-D-xylulose at the hydroxy group of C-5 . This reaction therefore constitutes a potential salvage pathway for the generation of 1-deoxy-D-xylulose 5-phosphate from exogenous or endogenous 1-deoxy-D-xylulose as starting material for the biosynthesis of terpenoids, thiamine and pyridoxal. ; GO: 0004856 xylulokinase activity, 0005997 xylulose metabolic process.
Probab=22.46  E-value=16  Score=15.86  Aligned_cols=44  Identities=14%  Similarity=0.293  Sum_probs=27.6

Q ss_pred             CCCCEEEC-CCCEEEEEEEEEEEEEEEHHHH--CCHHHHHHHHHHHH
Q ss_conf             79974576-4870816869779999973380--99899999998880
Q gi|254781103|r  114 MSRPDIID-RNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVL  157 (598)
Q Consensus       114 a~RG~I~D-RNG~~LA~n~~~y~i~i~P~~i--~~~~~~~~~L~~il  157 (598)
                      +.-+.++| .+|++|+.....|.|+-.-.--  .|++..++.+...+
T Consensus         9 ~~K~llvd~e~g~Vi~~~~~~~~~~~p~pg~sEQdP~~W~~A~~~a~   55 (494)
T TIGR01312         9 GVKALLVDAEKGEVIASGSASYTVISPHPGWSEQDPEDWWEATEEAI   55 (494)
T ss_pred             EEEEEEEECCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             14688997367717775303423205878856459699999999999


No 73 
>KOG4827 consensus
Probab=21.52  E-value=48  Score=12.75  Aligned_cols=80  Identities=20%  Similarity=0.263  Sum_probs=41.1

Q ss_pred             EEEEHHHHHHHHHHHHHHHCCCCCCCCCEEEE-E--ECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCC-----------C
Q ss_conf             25552576777776442100113234311122-3--02320321112100147311134443232222-----------2
Q gi|254781103|r  257 RLALDLRIQNIVHQELVENKKKYNAESVGTVI-L--NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR-----------I  322 (598)
Q Consensus       257 ~lTID~~lQ~~~e~~l~~~~~~~~a~~gavVv-m--d~~TGeILAmas~P~~dpn~~~~~~~~~~~Nr-----------a  322 (598)
                      .|-+|...|..+|.+..+  +.+.+.+|..-+ .  -..-|+-+-   .-.|||+++.....+.+.|.           .
T Consensus        60 pTdldkk~QftlEhaFGd--kdF~~anGtfSaR~ks~shgGkn~~---klrf~~~dF~aeekdaF~n~lkgddf~kiqL~  134 (279)
T KOG4827          60 PTDLDKKAQFTLEHAFGD--KDFEAANGTFSARAKSSSHGGKNFL---KLRFDPCDFLAEEKDAFHNFLKGDDFEKIQLH  134 (279)
T ss_pred             CCCCCCHHHHHHHHHCCC--CCCCCCCCEEEEEEECCCCCCCCEE---EECCCHHHHHHHHHHHHHHHHHCCCHHHHCCC
T ss_conf             644442335668765062--2123246646787512567874403---52158235545577899999844307662044


Q ss_pred             CCCCCCCCCCCHHHHHHHH
Q ss_conf             3324566432012356544
Q gi|254781103|r  323 SYGIFEMGSIFKVFTIAMG  341 (598)
Q Consensus       323 ~~~~yePGStfKp~t~aaa  341 (598)
                      ....++||--|-+.++++-
T Consensus       135 s~~i~PpgrefviasV~aR  153 (279)
T KOG4827         135 SLTIFPPGREFVIASVAAR  153 (279)
T ss_pred             CCEECCCCCHHHHHHHHEE
T ss_conf             3024588502332321100


No 74 
>KOG3318 consensus
Probab=20.89  E-value=17  Score=15.58  Aligned_cols=18  Identities=39%  Similarity=0.503  Sum_probs=13.5

Q ss_pred             CCCCCCCCCCCCCHHHHH
Q ss_conf             223324566432012356
Q gi|254781103|r  321 RISYGIFEMGSIFKVFTI  338 (598)
Q Consensus       321 ra~~~~yePGStfKp~t~  338 (598)
                      |.+.+.+..|||||||--
T Consensus        99 ~PikAl~st~stFkp~eg  116 (178)
T KOG3318          99 RPIKALFSTGSTFKPFEG  116 (178)
T ss_pred             HHHHHHHHHHHHCCCCCC
T ss_conf             779999862022111358


No 75 
>pfam11119 DUF2633 Protein of unknown function (DUF2633). This family is conserved largely in the Bacillaceae family. Several members are named as YfgG. The function is not known.
Probab=20.78  E-value=28  Score=14.26  Aligned_cols=22  Identities=36%  Similarity=0.439  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHEEEEE
Q ss_conf             9999999999999864313434
Q gi|254781103|r   76 MTIVVCLVIYIILAIRIIQYGN   97 (598)
Q Consensus        76 il~~v~~ii~~il~~rl~~lq~   97 (598)
                      +.-+++++-|++|+.||+|..+
T Consensus         9 mt~iVLLISFiilFgRl~Y~aI   30 (59)
T pfam11119         9 MTKIVLLISFIIFFGRLIYSAI   30 (59)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             2568999999999999999877


No 76 
>PRK00051 hisI phosphoribosyl-AMP cyclohydrolase; Reviewed
Probab=20.50  E-value=49  Score=12.67  Aligned_cols=23  Identities=30%  Similarity=0.534  Sum_probs=16.9

Q ss_pred             CCCCC-CCEEEEEECCCHHHHHHH
Q ss_conf             13234-311122302320321112
Q gi|254781103|r  278 KYNAE-SVGTVILNVSTGEVISMV  300 (598)
Q Consensus       278 ~~~a~-~gavVvmd~~TGeILAma  300 (598)
                      +++.+ -.-+|+-|..||+||-++
T Consensus        13 k~~~~GLiPaIvqd~~tg~VLMla   36 (130)
T PRK00051         13 KFDAKGLVPAIAQDAETGEVLMVA   36 (130)
T ss_pred             CCCCCCCEEEEEEECCCCCEEEEE
T ss_conf             758899658999986999899999


Done!