HHsearch alignment for GI: 254781103 and conserved domain: pfam02113

>pfam02113 Peptidase_S13 D-Ala-D-Ala carboxypeptidase 3 (S13) family.
Probab=90.56  E-value=0.32  Score=26.58  Aligned_cols=123  Identities=17%  Similarity=0.193  Sum_probs=61.4

Q ss_pred             HHHHHHCCCCCEEEEEEECCCC------------CCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCC
Q ss_conf             9998550367123543202333------------3200110122257634468654211112233554410011468752
Q gi|254781103|r  378 IPEIFRYSSNIGAAQIADAMGI------------QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGL  445 (598)
Q Consensus       378 ~~~al~~S~Nv~~~~i~~~lg~------------~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~  445 (598)
T Consensus       235 v~~m~k~S~N~~AE~L~~~lg~~~~~~~s~~~g~~~v~~~L~~~gi~~~-~~~--------------------l~DGSGL  293 (383)
T pfam02113       235 LKKMMKKSDNLIAESLFREIGVAIKRPGSFEAGADAVRSILSTAGIDTA-NLV--------------------LRDGSGL  293 (383)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCC-CCE--------------------EECCCCC
T ss_conf             9999741856999999999998627998889999999999997499955-647--------------------8448988


Q ss_pred             ----EEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEECC----CCC---
Q ss_conf             ----130010022110011078230108999863078850320189999999999999873388464104----797---
Q gi|254781103|r  446 ----STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF----VPG---  514 (598)
Q Consensus       446 ----~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~~GTg~~a~----~~g---  514 (598)
T Consensus       294 Sr~n~is~~~l~~lL~~~~~~~~--------------------------~~~~~~sLPvaG~dGTL~~r~~~~~~~~~~~  347 (383)
T pfam02113       294 SRHNLVTAATLAQLLQAIADQPA--------------------------LQALLDSLPVAGESGTLVGGTLRNRFKGTPA  347 (383)
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCC--------------------------HHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             73345499999999999986943--------------------------8899983982688885555555554457775


Q ss_pred             -EEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCCCE-EEEEEEE
Q ss_conf             -3576672403512688766886217999997428880-9999998
Q gi|254781103|r  515 -FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ-YIVLSFM  558 (598)
Q Consensus       515 -~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~dP~-~~v~V~v  558 (598)
T Consensus       348 ~G~v~aKTGTL~-----------~V~sLaGyv~~~~G~~l~Fsi~~  382 (383)
T pfam02113       348 VGKVRAKTGSLT-----------GVYSLAGYVTTDSGRKLAFSFIS  382 (383)
T ss_pred             CCEEEEEEEECC-----------CCEEEEEEEECCCCCEEEEEEEE
T ss_conf             675999985006-----------95794799997998999999995