HHsearch alignment for GI: 254781103 and conserved domain: pfam04960

>pfam04960 Glutaminase Glutaminase. This family of enzymes deaminates glutamine to glutamate EC:3.5.1.2.
Probab=95.61  E-value=0.068  Score=30.84  Aligned_cols=98  Identities=20%  Similarity=0.234  Sum_probs=66.7

Q ss_pred             CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH-CCCCEEECCCCCEEEEEECC
Q ss_conf             52130010022110011078230108999863078850320189999999999999873-38846410479735766724
Q gi|254781103|r  444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTG  522 (598)
Q Consensus       444 g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv-~~GTg~~a~~~g~~vaGKTG  522 (598)
T Consensus       175 Si~~t~~dLA~~aatLAn~G~~-------------P~tg~~v~~~~~~~~v~s~M~tcGmYd~SG~fa~~VGlP--aKSG  239 (286)
T pfam04960       175 ALEMSCEDLAVMGATLANGGVN-------------PITGERVVSPDVARQILALMLTCGMYDASGDFAYRVGLP--AKSG  239 (286)
T ss_pred             CHHCCHHHHHHHHHHHHCCCCC-------------CCCCCEECCHHHHHHHHHHHHHCCCCCCCCHHHHHCCCC--CCCC
T ss_conf             7044299999999999768968-------------998896269999999999998768865500046516871--0467


Q ss_pred             EEEECCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             035126887668862179999974288809999998078888888743214678999
Q gi|254781103|r  523 TAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMV  579 (598)
Q Consensus       523 TAq~~~~g~y~~~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~  579 (598)
T Consensus       240 Vg--------------GgIlavvPg---~~gIav~S--P~LD----~~GNSv~G~~~  273 (286)
T pfam04960       240 VG--------------GGILAVVPG---VMGIAVWS--PALD----EAGNSVAGVAA  273 (286)
T ss_pred             CC--------------CEEEEEECC---CCEEEEEC--CCCC----CCCCCHHHHHH
T ss_conf             67--------------538999379---61799988--8768----88886999999