HHsearch results for GI: 254781103 and protein with PDBid: 1o7e_A

>1o7e_A L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrophomonas maltophilia} SCOP: e.3.1.1 PDB: 1n4o_A
Probab=99.41  E-value=1.9e-12  Score=96.57  Aligned_cols=211  Identities=18%  Similarity=0.207  Sum_probs=136.4

Q ss_pred             CEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CCCEECCCCCCCCCCCC
Q ss_conf             111223023203211121001473111344432322222332456643201235654430---24032044213367632
Q gi|254781103|r  284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SGLFTVKDLFDTRNPIK  360 (598)
Q Consensus       284 gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g~i~~~~~~~~~~~~~  360 (598)
                      .++.++|..||++++.      |               + ...|+|.|++|.++++++|+   +|.+++++.+.......
T Consensus        31 ~gv~~~D~~tg~~~~~------n---------------~-d~~~~~AS~~Kl~~~~~~l~~v~~g~l~l~~~v~~~~~~~   88 (276)
T 1o7e_A           31 LGVTLLDTASGRRIGH------R---------------Q-DERFPMCSTFKSMLAATVLSQAERMPALLDRRVPVGEADL   88 (276)
T ss_dssp             EEEEEEETTTCCEEEE------S---------------T-TSCEECGGGGHHHHHHHHHHHHTTCTTTTTCEEEECGGGC
T ss_pred             EEEEEEECCCCCEEEE------C---------------C-CCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEECHHHH
T ss_conf             9999998999988777------7---------------9-9752434999999999999988648967563311047560


Q ss_pred             CCCCCCCCCCCCCCCCCH----HHHHHCCCCCEEEEEEECCC-CCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             221011234543230039----99855036712354320233-3320011012225763446865421111223355441
Q gi|254781103|r  361 VGKHVIHDYHPQNRILTI----PEIFRYSSNIGAAQIADAMG-IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIH  435 (598)
Q Consensus       361 ~~~~~i~~~~~~~g~it~----~~al~~S~Nv~~~~i~~~lg-~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~  435 (598)
                      ..+....... .+..+++    +..+..|.|.....+++.+| .+.+..+++++|.... .++....            +
T Consensus        89 ~~~~~~~~~~-~g~~~t~~~ll~~mi~~SdN~Aa~~l~~~lgg~~~~~~~~~~~~~~~~-~~~~~~~------------~  154 (276)
T 1o7e_A           89 LSHAPVTRRH-AGKDMTVRDLCRATIITSDNTAANLLFGVVGGPPAVTAFLRASGDTVS-RSDRLEP------------E  154 (276)
T ss_dssp             CSSCTTGGGG-TTEEEEHHHHHHHHHHSCCHHHHHHHHHHHTHHHHHHHHHHHHTCSSC-CCCCCTT------------G
T ss_pred             CCCCCCCCCC-CCCCEEHHHHHHHHHHHCHHHHHHHHHHHHCCCHHHHHHHHHHCCCCC-CCCCCCC------------C
T ss_conf             3689742136-888310999999999856489999999995591689999998264011-2345444------------2


Q ss_pred             CEECCCCCC-CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCE-EECCCC
Q ss_conf             001146875-213001002211001107823010899986307885032018999999999999987338846-410479
Q gi|254781103|r  436 SLTISFGHG-LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSG-RRAFVP  513 (598)
Q Consensus       436 ~~~~~~Gqg-~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~~GTg-~~a~~~  513 (598)
                      ......|.+ ...||.+|+..+..+.++                     ..++++....+.++|......... .....+
T Consensus       155 ~~~~~~~~~~~~tt~~~~a~ll~~l~~~---------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~  213 (276)
T 1o7e_A          155 LNSFAKGDPRDTTTPAAMAATLQRVVLG---------------------EVLQPASRQQLADWLIDNETGDACLRAGLGK  213 (276)
T ss_dssp             GGCCBTTBCTTEECHHHHHHHHHHHHTS---------------------SSSCHHHHHHHHHHHHTCSSCTTTHHHHSCT
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHHC---------------------CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             3478899977848499999999999838---------------------8678789999999985683265422245787


Q ss_pred             CEEEEEECCEEEECCCCCCCCCCCEEEEEEE--EECCCCEEEEEEEEECC
Q ss_conf             7357667240351268876688621799999--74288809999998078
Q gi|254781103|r  514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV--FPTTDPQYIVLSFMDSP  561 (598)
Q Consensus       514 g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~--~P~~dP~~~v~V~v~~p  561 (598)
                      +++++.||||..        .+  ..-.+|+  .+-++.+|+++|++..+
T Consensus       214 ~~~v~~KtG~~~--------~~--~~~d~giv~~~~~g~~~iiaV~~~~~  253 (276)
T 1o7e_A          214 RWRVGDKTGSNG--------ED--ARNDIAVLWPVAGGAPWVLTAYLQAG  253 (276)
T ss_dssp             TEEEEEEEEECS--------SS--EEEEEEEEEETTSSCCEEEEEEEECT
T ss_pred             CCEEEEEECCCC--------CC--CEEEEEEEEECCCCCEEEEEEEECCC
T ss_conf             765767614257--------78--63569999965899679999994799