HHsearch results for GI: 254781103 and protein with PDBid: 1qme_A

>1qme_A Penicillin-binding protein 2X; peptidoglycan synthesis, resistance, cell WALL, transmembrane; 2.4A {Streptococcus pneumoniae} SCOP: d.11.1.1 d.11.1.1 d.175.1.1 e.3.1.1 PDB: 1qmf_A* 1pyy_A* 1rp5_A 1pmd_A 1k25_A 2zc3_B* 2z2l_B* 2z2m_B* 2zc4_B* 2zc3_A* 2z2l_A* 2z2m_A* 2zc4_A* 2zc3_C* 2z2l_C* 2z2m_C* 2zc4_C*
Probab=100.00  E-value=0  Score=783.84  Aligned_cols=496  Identities=20%  Similarity=0.309  Sum_probs=416.3

Q ss_pred             EEECCHHHHCEEEEEEECCCCCEEECCCCEEEEEEEEEEEEEEEHHHHCC-------------HHHHHHHHHHHHCCCCH
Q ss_conf             34415323210004665179974576487081686977999997338099-------------89999999888079998
Q gi|254781103|r   96 GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVIS-------------PDEIIEKLQIVLPNLDS  162 (598)
Q Consensus        96 q~~~~~~~~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i~i~P~~i~~-------------~~~~~~~L~~il~~~~~  162 (598)
                      ..+..++..++.+...++|.||.||||||++||+|.+.|+|+++|....+             .+++++.|+.++ +++.
T Consensus         8 ~~l~~~a~~~~~~~~~ipa~RG~I~DrnG~~LA~~~~~y~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l-~~~~   86 (702)
T 1qme_A            8 TDLAKEAKKVHQTTRTVPAKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYL-DMEE   86 (702)
T ss_dssp             ---------------CCCCCCCCEECTTSCEEEEEECC------------------------------------------
T ss_pred             HHHHHHHHHHHEEEEEECCCCCCEEECCCCEEECCEEEEEEEEECCHHHCCCHHHHCCCCHHHHHHHHHHHHHHC-CCCH
T ss_conf             999999986038887971789838908999885030674899987332111101110124667999999988760-9999


Q ss_pred             HHHHHHHHCC----CCEEEEECCCCHHHHH----HHHHHHCCCCEECCHHHHHHHHCCCCCCCCCCCCCCCC--------
Q ss_conf             9999985136----7628961379999999----97631013750120233332100000011111124687--------
Q gi|254781103|r  163 EMIRRKLSSE----TKFQWLRRKLSPQQQK----RILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------  226 (598)
Q Consensus       163 ~~i~~~l~~~----~~~~~i~r~is~~~~~----~I~~~~lpGi~~~~~~~R~YP~~~lashiiGyv~~d~~--------  226 (598)
                      +.+.+++...    ..|.+..++++.+...    ++..+++|||.+.++++|+||++++++|+|||++.++.        
T Consensus        87 ~~~~~~l~~~~~~~~~~~~~~~~i~~~~~~~~~~~i~~~~l~Gi~~~~~~~R~YP~~~~as~viG~v~~~~~~~~~~~~i  166 (702)
T 1qme_A           87 SYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLL  166 (702)
T ss_dssp             -------------------------------------------------CEEECTTSSSSHHHHCCEEEEECTTSCEEEE
T ss_pred             HHHHHHHHHHHHCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCEEEEECEEEECCCCCCHHCEECCCCCCCCCCCCCCHH
T ss_conf             99999975533033101002257789999999998876789957743060367888510320314343333333200212


Q ss_pred             CCCCCEEECCCCC-----CCEEEEC------------CCCCCCCCCCEEEEHHHHHHHHHHHHHHHCCCCCCCCCEEEEE
Q ss_conf             5123100014668-----5168953------------6667688674255525767777764421001132343111223
Q gi|254781103|r  227 GITGIEKFLDMQG-----LTRVFTT------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL  289 (598)
Q Consensus       227 G~~GlE~~~d~~g-----~~~~~~~------------~~~~~~g~dI~lTID~~lQ~~~e~~l~~~~~~~~a~~gavVvm  289 (598)
                      |++|||++||..+     ....+.+            ...+.+|.||+||||.++|+.+|++|.+.++..++++|++|+|
T Consensus       167 G~~GlE~~~d~~L~G~~g~~~~~~~~~g~~~~~~~~~~~~~~~G~~I~lTID~~lQ~~~e~~l~~~~~~~~~~~g~~Vvm  246 (702)
T 1qme_A          167 GTSGMESSLNSILAGTDGIITYEKDRLGNIVPGTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQEKVKGKYMTATLV  246 (702)
T ss_dssp             ECSHHHHHTHHHHHCBCC---------------------CCBCCCEEEESCCHHHHHHHHHHHHHHHHHHCCSEEEEEEE
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             27888888787538988864211013685211333233467899735997789999999999999998616752379999


Q ss_pred             ECCCHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             0232032111210014731113444-323222223324566432012356544302403204421336763222101123
Q gi|254781103|r  290 NVSTGEVISMVSIPDYDPHEAFKGK-KEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD  368 (598)
Q Consensus       290 d~~TGeILAmas~P~~dpn~~~~~~-~~~~~Nra~~~~yePGStfKp~t~aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~  368 (598)
                      ||+||+||||||+|+||||.+.... ...|.|+++++.||||||||||++++|||+|.+++++.++|. .+.+++..++|
T Consensus       247 d~~TG~IlAmas~p~~d~n~~~~~~~~~~~~~~~~~~~~~PGStfK~~t~aaALe~g~~~~~~~~~~~-~~~~~~~~~~~  325 (702)
T 1qme_A          247 SAKTGEILATTQRPTFDADTKEGITEDFVWRDILYQSNYEPGSTMKVMMLAAAIDNNTFPGGEVFNSS-ELKIADATIRD  325 (702)
T ss_dssp             ETTTCBEEEEEEESCCCTTTCTTCCTTCCCCCTTTSCCBCCGGGGHHHHHHHHHHTTCCCTTCEEECS-CEEETTEEECC
T ss_pred             ECCCCEEEEEECCCCCCCCCCCCCCCHHHHCCCCEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEECC-CCEECCCCCCC
T ss_conf             77899089983257777554434563222025310112577520229989999976973233023013-40436852102


Q ss_pred             CC-----CCCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCC
Q ss_conf             45-----4323003999855036712354320233332001101222576344686542111122335544100114687
Q gi|254781103|r  369 YH-----PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGH  443 (598)
Q Consensus       369 ~~-----~~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gq  443 (598)
                      |+     .++|.+|+++||++|||++|+++++++|.+.+.+++++|||++++++|+|+|..|.+|. |...++++++|||
T Consensus       326 ~~~~~~~~~~G~itl~~al~~S~N~~~~~l~~~lG~~~~~~~~~~fG~g~~t~i~~~~e~~g~~p~-~~~~~~a~~~~Gq  404 (702)
T 1qme_A          326 WDVNEGLTGGRMMTFSQGFAHSSNVGMTLLEQKMGDATWLDYLNRFKFGVPTRFGLTDEYAGQLPA-DNIVNIAQSSFGQ  404 (702)
T ss_dssp             HHHHTTSCSCCEEEHHHHHHTTCHHHHHHHHHHHCHHHHHHHHHHTTTTSCCCCSSSSCCCCBCCC-SSHHHHHHGGGTC
T ss_pred             CCCCCCCCCCCEEEHHHHCCCCCCHHHHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC-CCCCCCCHHHHCC
T ss_conf             446766778720013441252337125666542584367889886078866688875345776876-5533333143079


Q ss_pred             CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCC--------CCCCCCHHHHHHHHHHHHHHHC---------CCC
Q ss_conf             52130010022110011078230108999863078850--------3201899999999999998733---------884
Q gi|254781103|r  444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVT---------GGS  506 (598)
Q Consensus       444 g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~--------~~~vis~~~a~~l~~~l~~vv~---------~GT  506 (598)
                      ++++||||||++|++|||+|.+++||+|+++.+.++.+        .+++++++++..++++|+.|+.         .||
T Consensus       405 ~~~vTPlqma~ayaaiANgG~~~~P~lV~~I~d~~g~~i~~~~~~~~~~~is~~~a~~~~~~m~~vv~~~~~gt~~~~gt  484 (702)
T 1qme_A          405 GISVTQTQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVLVGTDPVYGTMYNHST  484 (702)
T ss_dssp             SCBBCHHHHHHHHHHHHTTTCEECCBCEEEEEETTTTEEEECCCCEEECCSCHHHHHHHHHHHHHHHHCTTTCTTEETTT
T ss_pred             CCCCCHHHHHHHHHHHHCCCEEEEEEEEEEEECCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHEECCCCCEEECCCC
T ss_conf             86679999999999997198596108999998699978740487335766899999999999998622245540312677


Q ss_pred             EE-ECCCCCEEEEEECCEEEECC--CCCCCC--CCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             64-10479735766724035126--887668--86217999997428880999999807888888874321467899999
Q gi|254781103|r  507 GR-RAFVPGFEVGGKTGTAQKVI--KKRYSD--TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN  581 (598)
Q Consensus       507 g~-~a~~~g~~vaGKTGTAq~~~--~g~y~~--~~~~~~FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~  581 (598)
                      |+ .+.++||+|||||||||+..  .++|..  ..+++||+||||++||+|+|+|+|++|+..  .+.+||.+|+|||++
T Consensus       485 g~~~a~~~g~~vaGKTGTAq~~~~~~~~~~~~~~~~~~sfvg~~P~~~P~~~~~V~v~~p~~~--~g~~gg~va~pi~~~  562 (702)
T 1qme_A          485 GKPTVTVPGQNVALKSGTAQIADEKNGGYLVGLTDYIFSAVSMSPAENPDFILYVTVQQPEHY--SGIQLGEFANPILER  562 (702)
T ss_dssp             TEESSCBTTBCCEEEEEEEECBCGGGSSBCCSTTCEEEEEEEEESSSSCSEEEEEEEESCSSC--CHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCEEEEEEECCCCCCCCCCCEECCCCCEEEEEEEEEECCCCCEEEEEEEECCCCC--CCCCHHHHHHHHHHH
T ss_conf             754436899789999950302477788410156550699999978799819999999788866--787215899999999


Q ss_pred             HH--HHHHHHCCCCCCC
Q ss_conf             99--9999981899855
Q gi|254781103|r  582 II--RRSASMLGVKPVF  596 (598)
Q Consensus       582 I~--~~~~~~~~i~P~~  596 (598)
                      |+  ...+++..++|+.
T Consensus       563 i~~~~~~l~~~~~~~~~  579 (702)
T 1qme_A          563 ASAMKDSLNLQTTAKAL  579 (702)
T ss_dssp