HHsearch results for GI: 254781103 and protein with PDBid: 1yqs_A

>1yqs_A D-alanyl-D-alanine carboxypeptidase; cell well biosynthesis, beta-lactam, beta-sultam, sulfonylation, hydrolase; HET: BSA; 1.05A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1cef_A* 1ceg_A* 1ikg_A* 1iki_A* 1hvb_A* 1pw1_A* 1pw8_A* 1mpl_A* 1pwd_A* 1pwc_A* 1scw_A* 1pwg_A* 3pte_A 1sde_A*
Probab=97.20  E-value=0.0013  Score=40.32  Aligned_cols=76  Identities=20%  Similarity=0.330  Sum_probs=44.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCHHHHH
Q ss_conf             25767777764421001132343111223023203211121001473111344432322222--3324566432012356
Q gi|254781103|r  261 DLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI--SYGIFEMGSIFKVFTI  338 (598)
Q Consensus       261 D~~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra--~~~~yePGStfKp~t~  338 (598)
                      +..+|++++..+.+.     . -|++|++. +.|+|...+ +-      ..+...    +++  ....|+.||+-|+||+
T Consensus         8 ~~~l~~~l~~~~~~g-----~-pG~~v~v~-~~g~i~~~~-~G------~ad~~~----~~p~t~dT~f~i~SvsK~~ta   69 (349)
T 1yqs_A            8 DTGLQAVLHTALSQG-----A-PGAMVRVD-DNGTIHQLS-EG------VADRAT----GRAITTTDRFRVGSVTKSFSA   69 (349)
T ss_dssp             HHHHHHHHHHHHHTT-----C-SEEEEEEE-ETTEEEEEE-EE------BSCTTT----CCBCCTTCBEECGGGHHHHHH
T ss_pred             HHHHHHHHHHHHHCC-----C-CEEEEEEE-ECCEEEEEE-EE------EEECCC----CCCCCCCCEEECEEHHHHHHH
T ss_conf             499999999998779-----9-87999999-899999983-78------861677----988999997963047999999


Q ss_pred             HHHH---HCCCEECCCCCC
Q ss_conf             5443---024032044213
Q gi|254781103|r  339 AMGI---DSGLFTVKDLFD  354 (598)
Q Consensus       339 aaaL---e~g~i~~~~~~~  354 (598)
                      ++++   |+|.+++++.+.
T Consensus        70 ~~i~~Lv~~G~l~ldd~v~   88 (349)
T 1yqs_A           70 VVLLQLVDEGKLDLDASVN   88 (349)
T ss_dssp             HHHHHHHHTTSCCTTSBHH
T ss_pred             HHHHHHHHCCCCCCCCCCC
T ss_conf             9999999879999888210