HHsearch results for GI: 254781103 and protein with PDBid: 1z6f_A

>1z6f_A Penicillin-binding protein 5; peptidoglycan synthesis, DD- carboxypeptidase, hydrolase, boronic acid; HET: BO9; 1.60A {Escherichia coli} SCOP: b.105.1.1 e.3.1.1 PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 1nj4_A 1hd8_A 1sdn_A
Probab=98.23  E-value=6.6e-07  Score=61.32  Aligned_cols=111  Identities=18%  Similarity=0.201  Sum_probs=74.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CCCEECCCCCCCCCC
Q ss_conf             43111223023203211121001473111344432322222332456643201235654430---240320442133676
Q gi|254781103|r  282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SGLFTVKDLFDTRNP  358 (598)
Q Consensus       282 ~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g~i~~~~~~~~~~~  358 (598)
                      ..-+++|||..||+||.-                     +-....++|+|+-|.+|+..+||   +|.+++++.+..+..
T Consensus        16 ~a~aaiv~d~~tG~iL~~---------------------kn~~~~~~~ASlTKlMTa~v~le~i~~g~l~~~~~v~vs~~   74 (363)
T 1z6f_A           16 DAESYILIDYNSGKVLAE---------------------QNADVRRDPASLTKMMTSYVIGQAMKAGKFKETDLVTIGND   74 (363)
T ss_dssp             SEEEEEEEETTTCCEEEE---------------------ESTTCCBCCGGGHHHHHHHHHHHHHHTTSCCTTCEEECCGG
T ss_pred             CCEEEEEEECCCCCCHHE---------------------ECCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHH
T ss_conf             520999999999989000---------------------69099818689999999999999987399985656983389


Q ss_pred             CCC-CCCCCCC----CCCCCCCCCHHH----HHHCCCCCEEEEEEECCCC------CCCHHHCCCCCCCC
Q ss_conf             322-2101123----454323003999----8550367123543202333------32001101222576
Q gi|254781103|r  359 IKV-GKHVIHD----YHPQNRILTIPE----IFRYSSNIGAAQIADAMGI------QGHKEFLYRLGLLS  413 (598)
Q Consensus       359 ~~~-~~~~i~~----~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~------~~~~~~~~~fG~g~  413 (598)
                      ... ......+    +-..+..+++++    .|..|.|-.++-||+.++.      +.+.+.++++|+..
T Consensus        75 a~~~~~~~~~~~s~~~l~~ge~~tv~dLl~~lli~SaNdAA~aLAe~~~Gs~~~Fv~~MN~kA~elG~~~  144 (363)
T 1z6f_A           75 AWATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADFAAGSQDAFVGLMNSYVNALGLKN  144 (363)
T ss_dssp             GCGGGCGGGTTSCCCCCCTTCEEEHHHHHHHHHTTCCHHHHHHHHHHHHSSHHHHHHHHHHHHHHTTCSS
T ss_pred             HHHHCCCCCCCCCCCCCCCCCEEEHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             9852366335875113458989999999999876564399999998638999999999999999960566