HHsearch results for GI: 254781103 and protein with PDBid: 1zkj_A

>1zkj_A CMY-10, extended-spectrum beta-lactamase; plasmid, class C, hydrolase; 1.55A {Enterobacter aerogenes}
Probab=96.32  E-value=0.0068  Score=35.82  Aligned_cols=81  Identities=17%  Similarity=0.278  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH-
Q ss_conf             7677777644210011323431112230232032111210014731113444323222223324566432012356544-
Q gi|254781103|r  263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG-  341 (598)
Q Consensus       263 ~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaa-  341 (598)
                      +++..+++.+.+.+++.+..+.++.|+  +.|+++.- .+ .|  .+..  ...+.   .....|.-||+-|+||+++. 
T Consensus         8 ~~~~~~d~~i~~~~~~~~ipG~sv~v~--~~g~~~~~-~~-G~--~d~~--~~~~~---t~~t~f~iaSiSK~~ta~~i~   76 (359)
T 1zkj_A            8 PLRPVVDASIQPLLKEHRIPGMAVAVL--KDGKAHYF-NY-GV--ANRE--SGAGV---SEQTLFEIGSVSKTLTATLGA   76 (359)
T ss_dssp             TTHHHHHHHHHHHHHHTTCSEEEEEEE--ETTEEEEE-EE-EB--SCTT--TCCBC---CTTCBEECGGGHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEEE--ECCEEEEE-EE-EE--CCCC--CCCCC---CCCCEEEEEEHHHHHHHHHHH
T ss_conf             689999999999998479985999999--99999998-56-20--2156--69989---999989632379999999999


Q ss_pred             --HHCCCEECCCCCC
Q ss_conf             --3024032044213
Q gi|254781103|r  342 --IDSGLFTVKDLFD  354 (598)
Q Consensus       342 --Le~g~i~~~~~~~  354 (598)
                        .|+|.+++++.+.
T Consensus        77 ~lve~G~l~ldd~v~   91 (359)
T 1zkj_A           77 YAVVKGAMQLDDKAS   91 (359)
T ss_dssp             HHHHTTSCCTTSBGG
T ss_pred             HHHHCCCCCCCCCCC
T ss_conf             999769977433222