HHsearch results for GI: 254781103 and protein with PDBid: 2ffy_A

>2ffy_A Beta-lactamase; AMPC, deacylation, transition state, boronic acid, hydrolase; HET: SM3; 1.07A {Escherichia coli} SCOP: e.3.1.1 PDB: 1pi5_A* 1pi4_A* 2hds_A* 1c3b_A* 1fco_A* 1ga9_A* 1iem_A* 1kds_A* 1kdw_A* 1ke0_A* 1ke3_A* 1iel_A 1kvm_A* 1l2s_A* 1ll5_A* 1ll9_A* 1llb_A* 1mxo_A* 1my8_A* 1xgi_A* ...
Probab=95.18  E-value=0.021  Score=32.68  Aligned_cols=81  Identities=21%  Similarity=0.294  Sum_probs=44.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             76777776442100113234311122302320321112100147311134443232222233245664320123565443
Q gi|254781103|r  263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGI  342 (598)
Q Consensus       263 ~lQ~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaL  342 (598)
                      ++...+++.+.+.+++.+..+.++.|  .+.|+|.. .++-.   .+..  ...+.   --...|+.||+-|+||+++.+
T Consensus         4 ~~~~~i~~~i~~~~~~~~~pG~~v~v--~~~g~~~~-~~~G~---~~~~--~~~~~---t~~T~f~iaS~tK~~ta~~i~   72 (358)
T 2ffy_A            4 QINDIVHRTITPLIEQQKIPGMAVAV--IYQGKPYY-FTWGY---ADIA--KKQPV---TQQTLFELGSVSKTFTGVLGG   72 (358)
T ss_dssp             HHHHHHHHHHHHHHHHHTCSEEEEEE--EETTEEEE-EEEEE---EETT--TTEEC---CTTCBEECGGGHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEEEE--EECCEEEE-EEEEE---CCCC--CCCCC---CCCCEEECHHHHHHHHHHHHH
T ss_conf             89999999999999838998599999--99999999-83864---0366--69889---999979632268999999999


Q ss_pred             ---HCCCEECCCCCC
Q ss_conf             ---024032044213
Q gi|254781103|r  343 ---DSGLFTVKDLFD  354 (598)
Q Consensus       343 ---e~g~i~~~~~~~  354 (598)
                         |+|.+++++.+.
T Consensus        73 ~lve~G~l~ld~pv~   87 (358)
T 2ffy_A           73 DAIARGEIKLSDPTT   87 (358)
T ss_dssp             HHHHTTSCCTTSBHH
T ss_pred             HHHHCCCCCCCCCHH
T ss_conf             999769999878645