HHsearch results for GI: 254781103 and protein with PDBid: 2olv_A

>2olv_A Penicillin-binding protein 2; transpeptidase fold, glycosyltransferase family 51, lysozyme fold; HET: M0E; 2.80A {Staphylococcus aureus} SCOP: d.2.1.10 e.3.1.1 PDB: 2olu_A* 3dwk_A*
Probab=100.00  E-value=0  Score=450.90  Aligned_cols=306  Identities=19%  Similarity=0.209  Sum_probs=250.0

Q ss_pred             CCCCCCEEEEHHHHHHHHHHHHHHHCCC-CCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             6886742555257677777644210011-323431112230232032111210014731113444323222223324566
Q gi|254781103|r  251 KNLQPIRLALDLRIQNIVHQELVENKKK-YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM  329 (598)
Q Consensus       251 ~~g~dI~lTID~~lQ~~~e~~l~~~~~~-~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yeP  329 (598)
                      +.|..|+||||.++|+.+++++.+.... .....+++|+|||+||+||||++.++|+++         ..|++.++.+||
T Consensus       268 ~~G~~I~TTlD~~~Q~~~~~~~~~~~~~~~~~~~~a~vv~d~~TG~IlAmvgg~~~~~~---------~~~~~~~~~r~p  338 (669)
T 2olv_A          268 QSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQVGATILDSKTGGLVAISGGRDFKDV---------VNRNQATDPHPT  338 (669)
T ss_dssp             TBTCEEEESCCHHHHHHHHHHHHHCCCCSSTTEEEEEEEEETTTCBEEEEESSTTCCTT---------TSCCTTSSCEEC
T ss_pred             HCCCEEEEEECHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCEEEEECCCCCHHC---------CCHHHHHCCCCC
T ss_conf             26858999522223235555544322035656416899997899918999627741000---------330545220456


Q ss_pred             CCCCHHHHH-HHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCC-CCCCCHHHHHHCCCCCEEEEEEEC----CCCCCCH
Q ss_conf             432012356-5443024032044213367632221011234543-230039998550367123543202----3333200
Q gi|254781103|r  330 GSIFKVFTI-AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADA----MGIQGHK  403 (598)
Q Consensus       330 GStfKp~t~-aaaLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~-~g~it~~~al~~S~Nv~~~~i~~~----lg~~~~~  403 (598)
                      |||||||++ +++++.+.+.+++.++|+..+..++++++||++. +|.+++++||++|||++|+++++.    +|.+.+.
T Consensus       339 GStfKp~~~~aa~~e~~~~~~~~~~~~~~~~~~~~~~~~N~~~~~~G~vtl~~Al~~S~N~~av~l~~~lg~~~g~~~~~  418 (669)
T 2olv_A          339 GSSLKPFLAYGPAIENMKWATNHAIQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPK  418 (669)
T ss_dssp             GGGGHHHHTHHHHHHHHCCCTTBEEECCSCEESSSCEECCSSCSCCCEEEHHHHHHTTCHHHHHHHHHHHHHHTCTTHHH
T ss_pred             CCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             64333124544442266432221134666543467654368887667548999987486289999999998876478999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCC-CEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCC-
Q ss_conf             11012225763446865421111223355441001146875-2130010022110011078230108999863078850-
Q gi|254781103|r  404 EFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHG-LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV-  481 (598)
Q Consensus       404 ~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg-~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~-  481 (598)
                      +++.+||+..+.+++                  .++++|+| ..+||||||++|++|||+|.+++||+|+++.+.++++ 
T Consensus       419 ~~~~~~Gi~~~~~~~------------------~~~~lg~g~~~vtplqma~ayat~ANgG~~~~P~~I~~I~d~~G~~i  480 (669)
T 2olv_A          419 KFAAKLGLNYEGDIG------------------PSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETI  480 (669)
T ss_dssp             HHHHTTTCCCSSCCC------------------HHHHTTCTTCEECHHHHHHHHHHHHTTSEEECCBCEEEEECTTSCEE
T ss_pred             HHHHHCCCCCCCCCC------------------CHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCCEE
T ss_conf             999980999523467------------------40103576332468899999999862993515679988887999986


Q ss_pred             -----CCCCCCHHHHHHHHHHHHHHHC-CCCEEECCCCCEEEEEECCEEEECCCC-----CCCCCCCEEEEEEEEECCCC
Q ss_conf             -----3201899999999999998733-884641047973576672403512688-----76688621799999742888
Q gi|254781103|r  482 -----SRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKK-----RYSDTLNFNSFLAVFPTTDP  550 (598)
Q Consensus       482 -----~~~vis~~~a~~l~~~l~~vv~-~GTg~~a~~~g~~vaGKTGTAq~~~~g-----~y~~~~