HHsearch results for GI: 254781103 and protein with PDBid: 2wad_A

>2wad_A Penicillin-binding protein 2B; peptidoglycan synthesis, transmembrane, antibiotic resistance, cell shape, peptidoglycan, cell membrane; 2.18A {Streptococcus pneumoniae} PDB: 2wae_A 2waf_A
Probab=100.00  E-value=0  Score=759.34  Aligned_cols=516  Identities=19%  Similarity=0.209  Sum_probs=414.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEECCHH-----HHCEEEEEEECCCCCEEECCCCEEEEEEEEEEEE
Q ss_conf             75778888664799999999999999986431343441532-----3210004665179974576487081686977999
Q gi|254781103|r   62 RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP-----IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSL  136 (598)
Q Consensus        62 ~~kk~~~~~k~Ri~il~~v~~ii~~il~~rl~~lq~~~~~~-----~~~~~~~~~i~a~RG~I~DRNG~~LA~n~~~y~i  136 (598)
                      +||...+..+.|+.+++++|+++|++|++||+++|+++++.     ..++.+...+++.||.||||||++||.|.+.|+|
T Consensus         1 ~~~~~~~~i~~R~~~l~~~~~~~~~~l~~rL~~lQi~~~~~y~~~~~~~~~~~~~~~~~RG~IyDrnG~~LA~n~~~~~l   80 (680)
T 2wad_A            1 MRKFNSHSIPIRLNLLFSIVILLFMTIIGRLLYMQVLNKDFYEKKLASASQTKVTTSSARGEIYDASGKPLVENTLKQVV   80 (680)
T ss_dssp             -------------------------------------------------CEEEEECCCCCCCEECTTSCBSEEEEEEEEE
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHCCEEEEEECCCCCEEECCCCCEEEEEEEEEEE
T ss_conf             98743576449999998678899999999999853201699999997266089995388983991899998861146799


Q ss_pred             EEEHHHHCCHHHHH---HHHHHHHCCCC----H-----------HHHHH-------------------------------
Q ss_conf             99733809989999---99988807999----8-----------99999-------------------------------
Q gi|254781103|r  137 YVEPHKVISPDEII---EKLQIVLPNLD----S-----------EMIRR-------------------------------  167 (598)
Q Consensus       137 ~i~P~~i~~~~~~~---~~L~~il~~~~----~-----------~~i~~-------------------------------  167 (598)
                      .++|......++..   ..|+..+...+    .           +...+                               
T Consensus        81 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (680)
T 2wad_A           81 SFTRSNKMTATDLKEIAKKLLTYVSISSPNLTERQLADYYLADPEIYKKTVEALPSEKRLDSDGNRLSESELYNNAVDSV  160 (680)
T ss_dssp             EEECCTTCCHHHHHHHHHHHTTTSCCCCCCCCHHHHHHHHHTSHHHHHHHHTTCC-------------CHHHHHHHHHHS
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99822024423599999999887357727777887777751388888888876456776665554402999988766442


Q ss_pred             -------------------HHHCCC---CEEEEECCCCHHHHHHHHH--HHCCCCEECCHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             -------------------851367---6289613799999999763--1013750120233332100000011111124
Q gi|254781103|r  168 -------------------KLSSET---KFQWLRRKLSPQQQKRILS--FGLPGVGFRLEKSRFYPAASHASHVVGYVDI  223 (598)
Q Consensus       168 -------------------~l~~~~---~~~~i~r~is~~~~~~I~~--~~lpGi~~~~~~~R~YP~~~lashiiGyv~~  223 (598)
                                         ......   ......+.++.++...+.+  ..+|||.+..++.|.||.+.+ +|+|||++.
T Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~pGv~~~~~~~r~yp~~~~-a~vlGyv~~  239 (680)
T 2wad_A          161 PTSQLNYTEDEKKEIYLFSQLNAVGNFATGTIATDPLNDSQVAVIASISKEMPGISISTSWDRKILETSL-SSIVGSVSS  239 (680)
T ss_dssp             SCSCCCCCHHHHHHHHHHHHHHTSCTTCEEECCCSCCCHHHHHHHHHHGGGSTTEEEEEEEEEEECSSTT-HHHHCCBCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHCCCCCEEEEEEEEECCCCHHH-HHHCCCCCC
T ss_conf             3565434477788899998752012455314531679999999999864428976788512001760666-866085113


Q ss_pred             ---------------------CCCCCCCCEEECCCC-----CCCEEEECC----------CCCCCCCCCEEEEHHHHHHH
Q ss_conf             ---------------------687512310001466-----851689536----------66768867425552576777
Q gi|254781103|r  224 ---------------------DNRGITGIEKFLDMQ-----GLTRVFTTN----------KGEKNLQPIRLALDLRIQNI  267 (598)
Q Consensus       224 ---------------------d~~G~~GlE~~~d~~-----g~~~~~~~~----------~~~~~g~dI~lTID~~lQ~~  267 (598)
                                           |..|++|||++||+.     |......+.          ..+.+|.||+||||.++|..
T Consensus       240 ~~~~~~~~~~~~~~~~~~~~~d~vG~~GlE~~yd~~L~G~~g~~~~~~d~~g~~~~~~~~~~~~~G~~i~lTiD~~lQ~~  319 (680)
T 2wad_A          240 EKAGLPAEEAESYLKKGYSLNDRVGTSYLEKQYEEVLQGKRPVKEIHLDKHGDMESVENIEEGSKGKNIKLTIDLAFQDS  319 (680)
T ss_dssp             STTCSCGGGHHHHHHHTCCTTCCCBCSHHHHHTHHHHSCBCCEEEEEECTTSCEEEEEEEECCBCCCEEEESCCHHHHHH
T ss_pred             CCCCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCCCCEEEECCHHHCCCCCCCCCCCCCCCEEEEEHHHHHHH
T ss_conf             34454366666544138766552565150677764038776875389743010012223467888875132206869999


Q ss_pred             HHHHHHHHCCCCC-------CCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             7764421001132-------343111223023203211121001473111344432322222332456643201235654
Q gi|254781103|r  268 VHQELVENKKKYN-------AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM  340 (598)
Q Consensus       268 ~e~~l~~~~~~~~-------a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aa  340 (598)
                      ++++|.++++...       ...+++|||||+||+||||+|.| ||+++.   ...++.|||+++.||||||||||++++
T Consensus       320 ~~~~l~~~~~~~~~~~~~~~~~~~~~vv~dp~tG~IlAm~~~~-~~~~~~---~~~~~~n~a~~~~~~PGStfKp~~~~a  395 (680)
T 2wad_A          320 VDALLKSYFNSELGNGGAKYSEGVYAVALNPQTGAVLSMSGLK-HDLKTG---ELTPDSLGTVTNVFVPGSVVKAATISS  395 (680)
T ss_dssp             HHHHHHHHHHHHHHHSTTTTCCEEEEEEECTTTCBEEEEEEEE-ECTTTC---CEEECTTHHHHCCBCCGGGGHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCCHHHCCCCC-CCCCCC---HHHHHHHCCCCCCCCCCCCHHHHHHHH
T ss_conf             9999999998665203566778669999966658044136763-122100---134544201111357875216788999


Q ss_pred             HHHCCCEECCCCCCCCCCCCCCCCCCCCCCCC---CCCCCHHHHHHCCCCCEEEEEEECC------------------CC
Q ss_conf             43024032044213367632221011234543---2300399985503671235432023------------------33
Q gi|254781103|r  341 GIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ---NRILTIPEIFRYSSNIGAAQIADAM------------------GI  399 (598)
Q Consensus       341 aLe~g~i~~~~~~~~~~~~~~~~~~i~~~~~~---~g~it~~~al~~S~Nv~~~~i~~~l------------------g~  399 (598)
                      |||+|.++|++.++|++.+..++.+++||...   +|.+|+++||++|||++|+++++++                  |.
T Consensus       396 ALe~g~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~g~itl~~Al~~S~N~~~~~~a~~~~~~~~~~~~~~~~~~~~~g~  475 (680)
T 2wad_A          396 GWENGVLSGNQTLTDQPIVFQGSAPIYSWYKLAYGSFPITAVEALEYSSNAYVVQTALGIMGQTYQPNMFVGTSNLESAM  475 (680)
T ss_dssp             HHHTTSCCSSCCEEECCBCBTTSCCBCCTTTTTTCSEEECHHHHHHHTCHHHHHHHHHHHTTCCCCTTBCCCCTTHHHHH
T ss_pred             HHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCHHHHHHHHHHCCCCCCCHHHHCHHHHHHHH
T ss_conf             99708999873571378422368864210136778877205636450755999999987502445403330426787654


Q ss_pred             CCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCC
Q ss_conf             32001101222576344686542111122335544100114687521300100221100110782301089998630788
Q gi|254781103|r  400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE  479 (598)
Q Consensus       400 ~~~~~~~~~fG~g~~t~idlp~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~  479 (598)
                      +++.+++++|||++++++|||+|+.|.+|+.|...++++++||||+++||||||++|++|||+|++++||+|+++.|.++
T Consensus       476 ~kl~~~~~~~G~~~~~~i~lp~E~~G~~~~~~~~~~~~~~~~Gqg~~vTPlqma~aya~iaN~G~~~~P~~v~~I~d~~~  555 (680)
T 2wad_A          476 GKLRSTFGEYGLGSATGIDLPDESTGLVPKEYNFANFITNAFGQFDNYTPMQLAQYVATIANNGVRLAPHIVEGIYDNND  555 (680)
T ss_dssp             HHHHHHHHHTTSSSCCCCSSSCCCCCBCCSSCCHHHHHHHTTTSSSBBCHHHHHHHHHHHHTTTEEECCBSEEEEEEECT
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEEEEEECCCC
T ss_conf             68899999709986568866544567677523333223223577677899999999999975975972089998744777


Q ss_pred             C--------------CCCCCCCHHHHHHHHHHHHHHHC----CCCEEEC-CCCCEEEEEECCEEEECCCCCCCCCCCEEE
Q ss_conf             5--------------03201899999999999998733----8846410-479735766724035126887668862179
Q gi|254781103|r  480 K--------------VSRIVLKKNTVKTMRSLLREGVT----GGSGRRA-FVPGFEVGGKTGTAQKVIKKRYSDTLNFNS  540 (598)
Q Consensus       480 ~--------------~~~~vis~~~a~~l~~~l~~vv~----~GTg~~a-~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~  540 (598)
                      .              ..+.+++++++..+++||+.||+    .|||+.+ ..++|+|||||||||+...+++  +.+++|
T Consensus       556 ~~~~~~~~~~~~~~~~~~~~~s~~~~~~l~~~m~~Vv~gt~~~gt~~~~~~~~~~~vaGKTGTAq~~~~~~~--~~~~aw  633 (680)
T 2wad_A          556 KGGLGELIQAIDTKEINKVNISESDMAILHQGFYQVSHGTSPLTTGRAFSDGATVSISGKTGTGESYVAGGQ--EATNTN  633 (680)
T ss_dssp             TSSEEEEEEECCCCEEEECSSCHHHHHHHHHHHHHHHHCCSTTCCCGGGTTTCSSCCEEEECC--------------CCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCEEEEECCCCCCCCCCCC--CCCCEE
T ss_conf             555673012368752465679999999999999998728786634563215799889998434352579998--667089


Q ss_pred             EEEEEECCCCEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             99997428880999999807888888874321467899999999999981
Q gi|254781103|r  541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASML  590 (598)
Q Consensus       541 FvG~~P~~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I~~~~~~~~  590 (598)
                      |+||+|++||+|+|+|||+++      +.+|+.+|+||||+||+......
T Consensus       634 FvGy~P~~~P~~~v~V~v~~~------~~~g~~~A~~i~~~i~~~y~~~~  677 (680)
T 2wad_A          634 AVAYAPTENPQIAVAVVFPHN------TNLTKNVGPAIARDIINLYNQHH  677 (680)
T ss_dssp             EEEEESTTSCCEEEEEECTTC------CCCSCCHHHHHHHHHHHHHHHHS
T ss_pred             EEEEEECCCCEEEEEEEEECC------CCHHHHHHHHHHHHHHHHHHHHC
T ss_conf             999997689869999999689------95388899999999999998558