HHsearch results for GI: 254781103 and protein with PDBid: 3a3d_A

>3a3d_A PBP4, penicillin-binding protein 4; DACB, hydrolase; 1.60A {Haemophilus influenzae} PDB: 3a3e_A* 3a3f_A* 3a3i_A*
Probab=95.28  E-value=0.0068  Score=35.82  Aligned_cols=38  Identities=13%  Similarity=0.238  Sum_probs=27.4

Q ss_pred             EEEEECCEEEECCCCCCCCCCCEEEEEEEEECCC-CEEEEEEEEECCCCC
Q ss_conf             5766724035126887668862179999974288-809999998078888
Q gi|254781103|r  516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD-PQYIVLSFMDSPKIK  564 (598)
Q Consensus       516 ~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~d-P~~~v~V~v~~p~~~  564 (598)
                      .|.+||||-.           ....++||....| ..|+++++++++...
T Consensus       390 ~v~aKTGtL~-----------~v~sLaGyi~~~~G~~~~fsi~~N~~~~~  428 (453)
T 3a3d_A          390 NVIAKTGSLK-----------GVYNLAGFMTNARGEKVAFVQFINGYSTG  428 (453)
T ss_dssp             TCEEEEEEET-----------TEEEEEEEEECTTSCEEEEEEEEESCCSS
T ss_pred             EEEEEEECCC-----------CCEEEEEEEECCCCCEEEEEEEECCCCCC
T ss_conf             4999872637-----------84587999996998999999998599997