HHsearch results for GI: 254781103 and protein with PDBid: 3c5a_A

>3c5a_A Class A carbapenemase KPC-2; beta-lactamase, C-terminal deleted mutant, plasmid, hydrolase; HET: CIT; 1.23A {Escherichia coli} PDB: 2ods_A 2ov5_A* 3e2k_A 3e2l_A*
Probab=99.33  E-value=2.1e-11  Score=89.93  Aligned_cols=250  Identities=16%  Similarity=0.176  Sum_probs=146.5

Q ss_pred             HHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CC
Q ss_conf             764421001132343111223023203211121001473111344432322222332456643201235654430---24
Q gi|254781103|r  269 HQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SG  345 (598)
Q Consensus       269 e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g  345 (598)
                      .+.+.+-.++++++- ++.|+|..||++++.      |+                ...|+|+|++|.+++.++|+   +|
T Consensus         5 ~~~~~~l~~~~~g~v-gv~v~Dl~tG~~~~~------n~----------------d~~~~~AS~~Kl~~a~~~l~~~~~g   61 (264)
T 3c5a_A            5 AEPFAKLEQDFGGSI-GVYAMDTGSGATVSY------RA----------------EERFPLCSSFKGFLAAAVLARSQQQ   61 (264)
T ss_dssp             THHHHHHHHHHTSEE-EEEEEETTTCCEEEE------ST----------------TSCEECGGGHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHCCCEE-EEEEEECCCCCEEEE------CC----------------CCEECCHHHHHHHHHHHHHHHHHHC
T ss_conf             899999998739879-999998999988898------89----------------9758428899999999999851530


Q ss_pred             CEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC----HHHHHHCCCCCEEEEEEECCCC-CCCHHHCCCCCCCCCCCCCCC
Q ss_conf             03204421336763222101123454323003----9998550367123543202333-320011012225763446865
Q gi|254781103|r  346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILT----IPEIFRYSSNIGAAQIADAMGI-QGHKEFLYRLGLLSKLETELP  420 (598)
Q Consensus       346 ~i~~~~~~~~~~~~~~~~~~i~~~~~~~g~it----~~~al~~S~Nv~~~~i~~~lg~-~~~~~~~~~fG~g~~t~idlp  420 (598)
                      .+++++.+.........+...-. ...+..++    +...+..|.|+.+..++..+|. +....+++++|+.. +.++-+
T Consensus        62 ~~~~~~~v~~~~~~~~~~~~~~~-~~~g~~~t~~~ll~~mi~~SdN~Aa~~L~~~ig~~~~~~~~~~~~g~~~-~~~~~~  139 (264)
T 3c5a_A           62 AGLLDTPIRYGKNALVPWSPISE-KYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTT-FRLDRW  139 (264)
T ss_dssp             TTSTTCEECCCGGGCCSSCHHHH-HTTTTCEEHHHHHHHHHHSCCHHHHHHHHHHTTHHHHHHHHHHHTTCSS-CBCCCC
T ss_pred             CCCCCCEEEECHHHCCCCCCCCC-CCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHHHHHHHCHH-HCCCCC
T ss_conf             68856517842766147998411-0578871899999764506938999999999579606799999801422-035677


Q ss_pred             CCCCCCCCCCCCCCCCEECCCCCCCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             42111122335544100114687521300100221100110782301089998630788503201899999999999998
Q gi|254781103|r  421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE  500 (598)
Q Consensus       421 ~e~~g~~p~~~~~~~~~~~~~Gqg~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~  500 (598)
                      .  ....+..+.         ...-..||-+|+.....+.++                     +.+++.....+.+.|..
T Consensus       140 ~--~~~~~~~~~---------~~~n~tta~d~~~ll~~l~~~---------------------~~~~~~~~~~~~~~~~~  187 (264)
T 3c5a_A          140 E--LELNSAIPG---------DARDTSSPRAVTESLQKLTLG---------------------SALAAPQRQQFVDWLKG  187 (264)
T ss_dssp             T--TGGGCCCTT---------CCTTEECHHHHHHHHHHHHTS---------------------SSSCHHHHHHHHHHHHT
T ss_pred             C--CCCCCCCCC---------CCCCCHHHHHHHHHHHHHHHC---------------------CCCCHHHHHHHHHHHHC
T ss_conf             7--755688888---------654513599999999999748---------------------76799999999999735


Q ss_pred             HHCCC-CEEECCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEEC-CCCEEEEEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             73388-464104797357667240351268876688621799999742-8880999999807888888874321467899
Q gi|254781103|r  501 GVTGG-SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPT-TDPQYIVLSFMDSPKIKERNQLTAGINVAPM  578 (598)
Q Consensus       501 vv~~G-Tg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~-~dP~~~v~V~v~~p~~~~~~~~~Gg~~AaPi  578 (598)
                      ..... .-.....+++.++.|||+...         ....+++|++-. +...|+++|+...+.....       ..--+
T Consensus       188 ~~~~~~~~~~~~~~~~~v~~KtG~~~~---------~g~~~d~giv~~~~~~~yiivV~~~~~~~~~~-------~~~~l  251 (264)
T 3c5a_A          188 NTTGNHRIRAAVPADWAVGDKTGTCGV---------YGTANDYAVVWPTGRAPIVLAVYTRAPNKDDK-------HSEAV  251 (264)
T ss_dssp             CSSCTTTGGGGSCTTSEEEEEEEECCG---------GGCEEEEEEEECTTSCCEEEEEEEECSSTTCC-------CCHHH
T ss_pred             CCCCCCCCCCCCCCCCEEEEEEEECCC---------CCCEEEEEEEEECCCCEEEEEEEECCCCCCHH-------HHHHH
T ss_conf             710555445447888668998725588---------87478999998089978999999369998979-------99999


Q ss_pred             HHHHHHHHHHHCC
Q ss_conf             9999999999818
Q gi|254781103|r  579 VGNIIRRSASMLG  591 (598)
Q Consensus       579 ~~~I~~~~~~~~~  591 (598)
                      +.+|.+.++..||
T Consensus       252 i~~is~~v~~~l~  264 (264)
T 3c5a_A          252 IAAAARLALEGLG  264 (264)
T ss_dssp             HHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHC
T ss_conf             9999999999709