HHsearch results for GI: 254781103 and protein with PDBid: 3g4p_A

>3g4p_A Beta-lactamase OXA-24; plasmid, B-lactamases, enzyme mechanism, carbapenem, resistance, hydrolase; HET: KCX; 1.97A {Acinetobacter baumannii} PDB: 2jc7_A* 3fyz_A* 3fzc_A* 3fv7_A*
Probab=100.00  E-value=0  Score=320.93  Aligned_cols=238  Identities=13%  Similarity=0.082  Sum_probs=180.8

Q ss_pred             HHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             77777644210011323431112230232032111210014731113444323222223324566432012356544302
Q gi|254781103|r  265 QNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS  344 (598)
Q Consensus       265 Q~~~e~~l~~~~~~~~a~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe~  344 (598)
                      ++..|+++...++..++ .|++|++|++||+++++.                  +|||.+ .|+|||||||+++++|||+
T Consensus         4 ~~~~~~~~~~~~~~~~~-~G~~v~~d~~~~~~~~~~------------------~~ra~~-~~~PGSTfK~~~~~aaLe~   63 (244)
T 3g4p_A            4 SQQHEKAIKSYFDEAQT-QGVIIIKEGKNLSTYGNA------------------LARANK-EYVPASTFKMLNALIGLEN   63 (244)
T ss_dssp             HHHHHHHHHHHHHHTTC-CEEEEEEETTEEEEEESC------------------GGGGGC-CBCCGGGHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHCCCC-CEEEEEEECCCCCEECCC------------------HHHHCC-CCCCCCHHHHHHHHHHHHC
T ss_conf             58999999998601378-638999978988664354------------------001137-8799647999999999986


Q ss_pred             CCEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCCCCCCCCCCCCCCCC
Q ss_conf             40320442133676322210112345432300399985503671235432023333200110122257634468654211
Q gi|254781103|r  345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA  424 (598)
Q Consensus       345 g~i~~~~~~~~~~~~~~~~~~i~~~~~~~g~it~~~al~~S~Nv~~~~i~~~lg~~~~~~~~~~fG~g~~t~idlp~e~~  424 (598)
                      |.++|++.++|++...    ...+   ++|.+++++||++|||++|++++.++|++.+.+++++|||+.+   ++|+.. 
T Consensus        64 G~~~~~~~~~~~g~~~----~~~~---~~g~~~l~~Al~~S~N~~~~~l~~~lG~~~~~~~~~~~G~~~~---~~~~~~-  132 (244)
T 3g4p_A           64 HKATTNEIFKWDGKKR----TYPM---WEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNT---NIGTQV-  132 (244)
T ss_dssp             TSCCSSCCBCCCSCCC----SSGG---GSSCBCHHHHHHTTCHHHHHHHHHHHCHHHHHHHHHHHTCTTC---CCTTCT-
T ss_pred             CCCCCCCCCCCCCCCC----CCCC---CCCCCCHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHCCCCCC---CCCCCC-
T ss_conf             9999742234789650----5788---7888699999996385999999987083878999997899998---898655-


Q ss_pred             CCCCCCCCCCCCEECCCCC-CCEEEHHHCCCCCCHHHHCCEECCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHC
Q ss_conf             1122335544100114687-521300100221100110782301089998630788503201899999999999998733
Q gi|254781103|r  425 PSYPSQWKRIHSLTISFGH-GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT  503 (598)
Q Consensus       425 g~~p~~~~~~~~~~~~~Gq-g~~~TPlqla~~~atiAN~G~~~~P~lv~~~~~~~~~~~~~vis~~~a~~l~~~l~~vv~  503 (598)
                                   ..++++ ++.+||+||+++|++|||+|..                    +++++++.++++|+.++ 
T Consensus       133 -------------~~~~~~g~~~iTp~q~a~~~~~lan~g~~--------------------~~~~~~~~v~~~m~~~~-  178 (244)
T 3g4p_A          133 -------------DNFWLVGPLKITPVQEVNFADDLAHNRLP--------------------FKLETQEEVKKMLLIKE-  178 (244)
T ss_dssp             -------------TTHHHHSSCCBCHHHHHHHHHHHHTTCSS--------------------SCHHHHHHHHHTTEEEE-
T ss_pred             -------------CCCCCCCCCEECHHHHHHHHHHHHCCCCC--------------------CCHHHHHHHHHHHHHHH-
T ss_conf             -------------56110787018699999999999709805--------------------58558999999999755-


Q ss_pred             CCCEEECCCCCEEEEEECCEEEECCCCCCCCCCCEEEEEEEEECCC-CEEEEEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             8846410479735766724035126887668862179999974288-809999998078888888743214678999999
Q gi|254781103|r  504 GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD-PQYIVLSFMDSPKIKERNQLTAGINVAPMVGNI  582 (598)
Q Consensus       504 ~GTg~~a~~~g~~vaGKTGTAq~~~~g~y~~~~~~~~FvG~~P~~d-P~~~v~V~v~~p~~~~~~~~~Gg~~AaPi~~~I  582 (598)
                              .+|+++||||||+|.       .+.+++||+||+|..| |.|+++|+++.++      ..++..|+||+++|
T Consensus       179 --------~~g~~~aGKTGT~~~-------~~~~~~WFvG~~~~~~~~~~~~~v~~~~~~------~~~~~~a~~I~~~i  237 (244)
T 3g4p_A          179 --------VNGSKIYAKSGWGMG-------VTPQVGWLTGWVEQANGKKIPFSLNLEMKE------GMSGSIRNEITYKS  237 (244)
T ss_dssp             --------ETTEEEEEEEEEECS-------SSSEEEEEEEEEECTTSCEEEEEEEEEECT------TCCTHHHHHHHHHH
T ss_pred             --------HHCEEEEEEEECCCC-------CCCCCEEEEEEEECCCCCEEEEEEEEECCC------CCCHHHHHHHHHHH
T ss_conf             --------432223785871126-------899878999976869898899999963798------66559999999999


Q ss_pred             HHHHHHHCCC
Q ss_conf             9999998189
Q gi|254781103|r  583 IRRSASMLGV  592 (598)
Q Consensus       583 ~~~~~~~~~i  592 (598)
                          +.-|||
T Consensus       238 ----l~~lg~  243 (244)
T 3g4p_A          238 ----LENLGI  243 (244)
T ss_dssp             ----HHHTTC
T ss_pred             ----HHHCCC
T ss_conf             ----998289