HHsearch results for GI: 254781103 and protein with PDBid: 3ita_A

>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A*
Probab=97.70  E-value=9.5e-06  Score=53.99  Aligned_cols=109  Identities=15%  Similarity=0.227  Sum_probs=75.5

Q ss_pred             CCCEEEEEECCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH---CCCEECCCCCCCCCC
Q ss_conf             43111223023203211121001473111344432322222332456643201235654430---240320442133676
Q gi|254781103|r  282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID---SGLFTVKDLFDTRNP  358 (598)
Q Consensus       282 ~~gavVvmd~~TGeILAmas~P~~dpn~~~~~~~~~~~Nra~~~~yePGStfKp~t~aaaLe---~g~i~~~~~~~~~~~  358 (598)
                      ..-++++||..||+||.--                   |  ....++|+|+-|++|+..+||   .|.+++++.+..+..
T Consensus        12 ~a~aaiv~d~~tG~iL~~k-------------------n--~~~~~~pASlTKlMTa~v~~e~i~~~~~~l~~~v~vs~~   70 (352)
T 3ita_A           12 DARAWILMDYASGKVLAEG-------------------N--ADEKLDPASLTKIMTSYVVGQALKADKIKLTDMVTVGKD   70 (352)
T ss_dssp             CSSEEEEEETTTCCEEEEE-------------------S--TTCCBCCGGGHHHHHHHHHHHHHHTTSSCTTCEEECCGG
T ss_pred             CEEEEEEEECCCCCCHHHC-------------------C--CCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCEEEECHH
T ss_conf             2159999999999796325-------------------9--099862289999999999999876389997866994699


Q ss_pred             CCC-------CCCCCCCCCCCCCCCCHHH----HHHCCCCCEEEEEEECCCC------CCCHHHCCCCCCCC
Q ss_conf             322-------2101123454323003999----8550367123543202333------32001101222576
Q gi|254781103|r  359 IKV-------GKHVIHDYHPQNRILTIPE----IFRYSSNIGAAQIADAMGI------QGHKEFLYRLGLLS  413 (598)
Q Consensus       359 ~~~-------~~~~i~~~~~~~g~it~~~----al~~S~Nv~~~~i~~~lg~------~~~~~~~~~fG~g~  413 (598)
                      ...       ++..+  +-..+..+|+++    .|..|.|-...-||+.++.      +.+.+.++++|+..
T Consensus        71 a~~~~~~~~~~~s~~--~l~~g~~~tv~dLL~~~li~SaNdAA~aLA~~i~Gs~~~Fv~~MN~kAkelG~~~  140 (352)
T 3ita_A           71 AWATGNPALRGSSVM--FLKPGDQVSVADLNKGVIIQSGNDACIALADYVAGSQESFIGLMNGYAKKLGLTN  140 (352)
T ss_dssp             GSTTTCGGGTTSSCC--CCCTTCEEEHHHHHHHHHTTCCHHHHHHHHHHHHSSHHHHHHHHHHHHHHTTCTT
T ss_pred             HHHHCCCCCCCCCEE--EECCCCEEEHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             985104455687335--4138999999999999887515299999987528999999999999999848998