BLAST/PSIBLAST alignment of GI: 254781103 and GI: 15965935 at iteration 1
>gi|15965935|ref|NP_386288.1| penicillin-binding transmembrane protein [Sinorhizobium meliloti 1021] Length = 582
>gi|307308245|ref|ZP_07587954.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C] Length = 582
>gi|307319712|ref|ZP_07599137.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83] Length = 582
>gi|15075204|emb|CAC46761.1| Probable peptidoglycan synthetase FtsI [Sinorhizobium meliloti 1021] Length = 582
>gi|306894643|gb|EFN25404.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83] Length = 582
>gi|306901243|gb|EFN31849.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C] Length = 582
 Score =  635 bits (1638), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 298/570 (52%), Positives = 406/570 (71%), Gaps = 13/570 (2%)

Query: 28  SHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYII 87
           +H SA  + R  +SG N+             F+  R+K  + +K+R+ + I    ++Y +
Sbjct: 14  AHFSAGGNNRPADSGLNVA------------FEGTRKKSASRAKSRVAIIIASFGLVYAV 61

Query: 88  LAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD 147
           +  R++QYG   PE ++     D    SRPDI+DRNGE+LATDI T SLY EPHK++  D
Sbjct: 62  IGGRLVQYGLAQPETVSSIGRADSLMASRPDILDRNGEVLATDIRTVSLYAEPHKIVDAD 121

Query: 148 EIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRF 207
           E +E+L  VLP+L++  I  KL S ++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RF
Sbjct: 122 EAVERLATVLPDLNAREIYNKLKSNSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRF 181

Query: 208 YPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQN 266
           YP    A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P+RL++D+R+QN
Sbjct: 182 YPGGPTAAHILGHVNIDNRGVAGMERYIDEQGLADLAAIGMTSDAKLEPVRLSIDVRVQN 241

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           IV   +    K Y A + G V+L+V TGEV++M S+PDYDP+   +G +EGW NR+S G 
Sbjct: 242 IVRDVIDAGMKNYQAIAAGAVVLDVHTGEVLAMASVPDYDPNRPAEGAEEGWMNRMSNGT 301

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           FEMGS FK FTIAMG+DSG  T+ D FD   PI++G   I D+H + R+LT+PEIF+YSS
Sbjct: 302 FEMGSTFKTFTIAMGLDSGKVTLNDSFDATAPIRIGGFTIKDFHGKRRVLTVPEIFQYSS 361

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS 446
           NIG A+IAD +GI GHKEFL R+GLL++L TELPE++APS P +WK+I+S+TISFGHG+S
Sbjct: 362 NIGTAKIADLIGIPGHKEFLTRIGLLTRLPTELPEVKAPSQPREWKKINSITISFGHGVS 421

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTPLQTAVA AAL+N G+LIPPTF+ RS E + +++  V+KK+T + MR LLR     GS
Sbjct: 422 TTPLQTAVAGAALVNGGKLIPPTFLPRSEEAASELASAVVKKSTSEDMRYLLRWNGIAGS 481

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G+RA VPGF VGGKTGTA KV+  RY+  LNFN+FLA FP  DP+Y+VL+F+D+PK  E 
Sbjct: 482 GKRALVPGFNVGGKTGTADKVVNGRYASDLNFNAFLAAFPIDDPKYMVLTFIDAPKTGEG 541

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              TAG N APMV +II RSA +LGV+P F
Sbjct: 542 GGRTAGSNAAPMVRDIISRSAPLLGVEPKF 571