BLAST/PSIBLAST alignment of GI: 254781103 and GI: 227822657 at iteration 1
>gi|227822657|ref|YP_002826629.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234] Length = 582
>gi|227341658|gb|ACP25876.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234] Length = 582
 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 295/570 (51%), Positives = 402/570 (70%), Gaps = 13/570 (2%)

Query: 28  SHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYII 87
           +H SA  + R  E+G N+             FQ  R+K  + +++R+ + I    + Y +
Sbjct: 14  AHFSAGGNNRPGEAGVNVT------------FQGTRKKNASQARSRVAIVIASFGIAYAV 61

Query: 88  LAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD 147
           +  R++QYG   PE ++     D    SRPDI+DRNGEILATDI T SLY EPHK++  D
Sbjct: 62  IGGRLVQYGVAQPETVSSIGRADNLMASRPDILDRNGEILATDIRTVSLYAEPHKIVDAD 121

Query: 148 EIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRF 207
           E +E+L  VLP+L++  I  KL S ++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RF
Sbjct: 122 EAVERLATVLPDLNAREIYNKLKSNSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRF 181

Query: 208 YPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQN 266
           YP    A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P++L++D+R+QN
Sbjct: 182 YPGGPTAAHILGHVNIDNRGVAGMERYIDSQGLADLAAIGMTSDAKLEPVKLSIDVRVQN 241

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           IV   +    K Y A + G V+++V TGEV++M S+PDYDP++  +G +EGW NR+S G 
Sbjct: 242 IVRDVIDSGMKNYQAIAAGAVVMDVHTGEVLAMASVPDYDPNKPAEGAEEGWMNRMSNGT 301

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           FEMGS FK FTIAMG+DSG  T+   FD   PI++G   I D+H + R+LT+PEIF+YSS
Sbjct: 302 FEMGSTFKTFTIAMGLDSGKVTLNSSFDATAPIRIGGFTIKDFHGKRRVLTVPEIFQYSS 361

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS 446
           NIG A++AD +GI GHKEFL RLGLLSKL TELPE++ P+ P +WK+I+S+TISFGHG+S
Sbjct: 362 NIGTAKVADLVGIPGHKEFLTRLGLLSKLPTELPEVKTPTQPREWKKINSITISFGHGVS 421

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTPLQTAVA AAL+N G+LIPPTF+ R+ E + +++  V+KK+T   MR LLR     GS
Sbjct: 422 TTPLQTAVAGAALVNGGKLIPPTFLPRTEEAANELATAVVKKSTSDDMRFLLRWNGIAGS 481

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G+RA VPGF VGGKTGTA KV+  RY +  NFN+FLA FP  DP+YIVL+F+D+PK  E 
Sbjct: 482 GKRALVPGFNVGGKTGTADKVVNGRYVNDQNFNAFLAAFPIDDPKYIVLTFIDAPKTGEG 541

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              TAG N APMV +II RSA +LGV+P F
Sbjct: 542 GGRTAGSNAAPMVRDIISRSAPLLGVEPKF 571