BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781103|ref|YP_003065516.1| penicillin-binding
transmembrane protein [Candidatus Liberibacter asiaticus str. psy62]
         (598 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040780|gb|ACT57576.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 598

 Score = 1231 bits (3186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 598/598 (100%), Positives = 598/598 (100%)

Query: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60
           MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ
Sbjct: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII
Sbjct: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR
Sbjct: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
           KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL
Sbjct: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
           TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV
Sbjct: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK
Sbjct: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP
Sbjct: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK
Sbjct: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS
Sbjct: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
Sbjct: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598


>gi|315122413|ref|YP_004062902.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495815|gb|ADR52414.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 577

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/598 (75%), Positives = 512/598 (85%), Gaps = 21/598 (3%)

Query: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60
           MIFPFI +S+F+ FFSM        N + N  NI  +NME             + Q  F 
Sbjct: 1   MIFPFIILSRFQAFFSM--------NTTSNGENIQIKNME-------------NRQRRFH 39

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           KRR+KVIA SKNRIG+TIV C++IYII AIR+IQYGN+  EPI    N++EYG SRPDII
Sbjct: 40  KRRKKVIAQSKNRIGITIVFCIIIYIIFAIRLIQYGNLQLEPIIHLTNVEEYGTSRPDII 99

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNGEILATDI TFSLY EPHKVIS DEII+KLQ+VLPNLD ++IRRKL S+TKFQWLRR
Sbjct: 100 DRNGEILATDIRTFSLYAEPHKVISADEIIKKLQVVLPNLDIKVIRRKLLSKTKFQWLRR 159

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
           +LSPQQQKRIL+FGLPG+GFR+EK RFYPA+SH  HVVGYVDIDN GI+GIEKF+DMQGL
Sbjct: 160 QLSPQQQKRILNFGLPGLGFRIEKRRFYPASSHTLHVVGYVDIDNHGISGIEKFIDMQGL 219

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
           T   T  KGEKNL PIRL+LDLRIQNIVHQ LVEN +KY AES GTVI+NVSTGE+ISMV
Sbjct: 220 TSRSTIEKGEKNLPPIRLSLDLRIQNIVHQSLVENMQKYKAESAGTVIINVSTGEIISMV 279

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           SIPD+DPHEA KG KEGW NR+SYGIFEMGSIFK FTIAM IDSGLFTVKD FDTR PI+
Sbjct: 280 SIPDHDPHEAVKGGKEGWLNRVSYGIFEMGSIFKAFTIAMAIDSGLFTVKDSFDTRYPIQ 339

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
            GK+ I+D+HP +R+LTI EIFRYSSNIGAA+IADA+GI+ HK FL++LGLL+KLETELP
Sbjct: 340 QGKYFINDFHPHSRMLTIAEIFRYSSNIGAARIADAIGIEEHKNFLHKLGLLTKLETELP 399

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           EI+APSYPS+WKR+HSLTISFGHGLSTTPLQTAVAAAALIN G+LIPPTFM+RSREE+EK
Sbjct: 400 EIKAPSYPSKWKRVHSLTISFGHGLSTTPLQTAVAAAALINGGQLIPPTFMVRSREEAEK 459

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
            SRI+LKK TV+TMRSLLREGV  GSG+RAFVPGFEVGGKTGTAQKVI  RYS+ LNFN+
Sbjct: 460 KSRIILKKKTVETMRSLLREGVMSGSGKRAFVPGFEVGGKTGTAQKVIGNRYSNELNFNT 519

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           FLA FP ++PQY+VLSFMDSPKIKE+NQLTAGINVAPMVG+IIRRSASMLGVKP FLK
Sbjct: 520 FLATFPASNPQYVVLSFMDSPKIKEQNQLTAGINVAPMVGDIIRRSASMLGVKPTFLK 577


>gi|15965935|ref|NP_386288.1| penicillin-binding transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|307308245|ref|ZP_07587954.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C]
 gi|307319712|ref|ZP_07599137.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83]
 gi|15075204|emb|CAC46761.1| Probable peptidoglycan synthetase FtsI [Sinorhizobium meliloti
           1021]
 gi|306894643|gb|EFN25404.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83]
 gi|306901243|gb|EFN31849.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C]
          Length = 582

 Score =  635 bits (1638), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 298/570 (52%), Positives = 406/570 (71%), Gaps = 13/570 (2%)

Query: 28  SHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYII 87
           +H SA  + R  +SG N+             F+  R+K  + +K+R+ + I    ++Y +
Sbjct: 14  AHFSAGGNNRPADSGLNVA------------FEGTRKKSASRAKSRVAIIIASFGLVYAV 61

Query: 88  LAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD 147
           +  R++QYG   PE ++     D    SRPDI+DRNGE+LATDI T SLY EPHK++  D
Sbjct: 62  IGGRLVQYGLAQPETVSSIGRADSLMASRPDILDRNGEVLATDIRTVSLYAEPHKIVDAD 121

Query: 148 EIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRF 207
           E +E+L  VLP+L++  I  KL S ++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RF
Sbjct: 122 EAVERLATVLPDLNAREIYNKLKSNSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRF 181

Query: 208 YPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQN 266
           YP    A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P+RL++D+R+QN
Sbjct: 182 YPGGPTAAHILGHVNIDNRGVAGMERYIDEQGLADLAAIGMTSDAKLEPVRLSIDVRVQN 241

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           IV   +    K Y A + G V+L+V TGEV++M S+PDYDP+   +G +EGW NR+S G 
Sbjct: 242 IVRDVIDAGMKNYQAIAAGAVVLDVHTGEVLAMASVPDYDPNRPAEGAEEGWMNRMSNGT 301

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           FEMGS FK FTIAMG+DSG  T+ D FD   PI++G   I D+H + R+LT+PEIF+YSS
Sbjct: 302 FEMGSTFKTFTIAMGLDSGKVTLNDSFDATAPIRIGGFTIKDFHGKRRVLTVPEIFQYSS 361

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS 446
           NIG A+IAD +GI GHKEFL R+GLL++L TELPE++APS P +WK+I+S+TISFGHG+S
Sbjct: 362 NIGTAKIADLIGIPGHKEFLTRIGLLTRLPTELPEVKAPSQPREWKKINSITISFGHGVS 421

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTPLQTAVA AAL+N G+LIPPTF+ RS E + +++  V+KK+T + MR LLR     GS
Sbjct: 422 TTPLQTAVAGAALVNGGKLIPPTFLPRSEEAASELASAVVKKSTSEDMRYLLRWNGIAGS 481

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G+RA VPGF VGGKTGTA KV+  RY+  LNFN+FLA FP  DP+Y+VL+F+D+PK  E 
Sbjct: 482 GKRALVPGFNVGGKTGTADKVVNGRYASDLNFNAFLAAFPIDDPKYMVLTFIDAPKTGEG 541

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              TAG N APMV +II RSA +LGV+P F
Sbjct: 542 GGRTAGSNAAPMVRDIISRSAPLLGVEPKF 571


>gi|150397289|ref|YP_001327756.1| peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419]
 gi|150028804|gb|ABR60921.1| Peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419]
          Length = 582

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 295/570 (51%), Positives = 405/570 (71%), Gaps = 13/570 (2%)

Query: 28  SHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYII 87
           +H SA    R  + G N+             F+  R++  + +K+R+ + I    V+Y +
Sbjct: 14  AHFSAGGDHRTTDGGLNVT------------FEGTRKRSASRAKSRVAIMIASFGVVYAV 61

Query: 88  LAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD 147
           +  R++QYG   PE ++     D    SRPDI+DRNGE+LATDI T SLY EPHK++  D
Sbjct: 62  IGGRLVQYGLAQPETVSSIGRADTLMASRPDILDRNGEVLATDIRTVSLYAEPHKIVDAD 121

Query: 148 EIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRF 207
           E +E+L  VLP+L++  I  KL S+++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RF
Sbjct: 122 EAVERLATVLPDLNAREIYNKLKSDSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRF 181

Query: 208 YPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQN 266
           YP    A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P+RL++D+R+QN
Sbjct: 182 YPGGPTAAHILGHVNIDNRGVAGMERYIDEQGLADLAAIGMTSDAKLEPVRLSIDVRVQN 241

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           IV   +    K Y A + G V+L+V TGEV++M S+PDYDP+   +G +EGW NR+S G 
Sbjct: 242 IVRDVVDSGMKNYEAIAAGAVVLDVHTGEVLAMASVPDYDPNRPAEGAEEGWMNRMSNGT 301

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           FEMGS FK FTIAMG+DSG  T+ D FD   PI++G   I D+H + R+LT+PEIF+YSS
Sbjct: 302 FEMGSTFKTFTIAMGLDSGKVTLNDSFDATRPIRIGGFTIKDFHGKRRVLTVPEIFQYSS 361

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS 446
           NIG A+IAD +GI GHKEFL R+GLL++L TELPE+++PS P +WK+I+S+TISFGHG+S
Sbjct: 362 NIGTAKIADLIGIPGHKEFLTRMGLLTRLPTELPEVKSPSQPREWKKINSITISFGHGVS 421

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTPLQTAVA AAL+N G+LIPP+F+ RS EE+ +++  V+KK+T   MR LLR     GS
Sbjct: 422 TTPLQTAVAGAALVNGGKLIPPSFLPRSEEEASELASAVVKKSTSDDMRYLLRRNGIAGS 481

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G+RA VPGF VGGKTGTA KV+  RY+  LNFN+FLA FP  +P+Y+VL+F+D+PK  E 
Sbjct: 482 GKRALVPGFNVGGKTGTADKVVNGRYASDLNFNAFLAAFPIDNPKYMVLTFIDAPKTGEG 541

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              TAG N APMV +II RSA +LGV+P F
Sbjct: 542 GGRTAGSNAAPMVRDIISRSAPLLGVEPKF 571


>gi|227822657|ref|YP_002826629.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234]
 gi|227341658|gb|ACP25876.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234]
          Length = 582

 Score =  626 bits (1614), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 295/570 (51%), Positives = 402/570 (70%), Gaps = 13/570 (2%)

Query: 28  SHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYII 87
           +H SA  + R  E+G N+             FQ  R+K  + +++R+ + I    + Y +
Sbjct: 14  AHFSAGGNNRPGEAGVNVT------------FQGTRKKNASQARSRVAIVIASFGIAYAV 61

Query: 88  LAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD 147
           +  R++QYG   PE ++     D    SRPDI+DRNGEILATDI T SLY EPHK++  D
Sbjct: 62  IGGRLVQYGVAQPETVSSIGRADNLMASRPDILDRNGEILATDIRTVSLYAEPHKIVDAD 121

Query: 148 EIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRF 207
           E +E+L  VLP+L++  I  KL S ++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RF
Sbjct: 122 EAVERLATVLPDLNAREIYNKLKSNSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRF 181

Query: 208 YPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQN 266
           YP    A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P++L++D+R+QN
Sbjct: 182 YPGGPTAAHILGHVNIDNRGVAGMERYIDSQGLADLAAIGMTSDAKLEPVKLSIDVRVQN 241

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           IV   +    K Y A + G V+++V TGEV++M S+PDYDP++  +G +EGW NR+S G 
Sbjct: 242 IVRDVIDSGMKNYQAIAAGAVVMDVHTGEVLAMASVPDYDPNKPAEGAEEGWMNRMSNGT 301

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           FEMGS FK FTIAMG+DSG  T+   FD   PI++G   I D+H + R+LT+PEIF+YSS
Sbjct: 302 FEMGSTFKTFTIAMGLDSGKVTLNSSFDATAPIRIGGFTIKDFHGKRRVLTVPEIFQYSS 361

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS 446
           NIG A++AD +GI GHKEFL RLGLLSKL TELPE++ P+ P +WK+I+S+TISFGHG+S
Sbjct: 362 NIGTAKVADLVGIPGHKEFLTRLGLLSKLPTELPEVKTPTQPREWKKINSITISFGHGVS 421

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTPLQTAVA AAL+N G+LIPPTF+ R+ E + +++  V+KK+T   MR LLR     GS
Sbjct: 422 TTPLQTAVAGAALVNGGKLIPPTFLPRTEEAANELATAVVKKSTSDDMRFLLRWNGIAGS 481

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G+RA VPGF VGGKTGTA KV+  RY +  NFN+FLA FP  DP+YIVL+F+D+PK  E 
Sbjct: 482 GKRALVPGFNVGGKTGTADKVVNGRYVNDQNFNAFLAAFPIDDPKYIVLTFIDAPKTGEG 541

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              TAG N APMV +II RSA +LGV+P F
Sbjct: 542 GGRTAGSNAAPMVRDIISRSAPLLGVEPKF 571


>gi|325293471|ref|YP_004279335.1| penicillin binding protein 2 [Agrobacterium sp. H13-3]
 gi|325061324|gb|ADY65015.1| penicillin binding protein 2 [Agrobacterium sp. H13-3]
          Length = 580

 Score =  609 bits (1571), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 287/542 (52%), Positives = 392/542 (72%), Gaps = 2/542 (0%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
           F+  R+K  A +K+R+G+ I   +  Y ++  R++QYG    E ++     D    SRPD
Sbjct: 30  FEGARKKRAAQAKSRVGLIIFGFIAFYGVVGGRLVQYGLAEQETVSSIAPADRLMASRPD 89

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           ++DRNGE+LATDI T SL+ EPH+++  DE IEKL+ VLP+LD     +KLSS ++FQWL
Sbjct: 90  LLDRNGEVLATDIRTVSLFAEPHRIVDIDEAIEKLRTVLPDLDQRGTYQKLSSNSRFQWL 149

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           RR+L+P+QQ +IL+ G+PGVGFR EK RFYP    A+HVVG+V+IDNRG+ G+E+++D Q
Sbjct: 150 RRQLTPKQQSQILALGIPGVGFRPEKRRFYPGGPTAAHVVGHVNIDNRGVAGMERYVDSQ 209

Query: 239 GLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           GL  +       ++ L+P++L++DLR+Q+IV + +     K+ A   G V+L+V TGEV+
Sbjct: 210 GLADLTALGMTSDQPLEPVKLSIDLRVQSIVREVVTSAITKFQAIGAGAVVLDVHTGEVL 269

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN 357
           +M S+PDYDP+   +G KEGW NR+S G FEMGS FK FTIAMG+DSG   + D+FD R 
Sbjct: 270 AMASVPDYDPNNPAEGAKEGWLNRMSNGTFEMGSTFKSFTIAMGLDSGRVRLGDMFDARY 329

Query: 358 PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLET 417
           PI++G   I D+H + R+L++PEIF+YSSNIG A+IAD +G +GHKEFL RLGLL++++T
Sbjct: 330 PIRIGGFTIKDFHGKGRMLSVPEIFQYSSNIGTAKIADTVGTEGHKEFLTRLGLLTRMQT 389

Query: 418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           ELPE+  PS P +WK+I+S+TISFGHG+STTPLQTAVA AAL+N G+LI PTF+ R+RE+
Sbjct: 390 ELPEVALPSQPREWKKINSITISFGHGVSTTPLQTAVAGAALVNGGKLIEPTFLPRTREQ 449

Query: 478 SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN 537
           +++V++ VLK    K MR L       GSGR A V GF VGGKTGTA KV+  RY    N
Sbjct: 450 ADQVAKQVLKPGASKDMRFLFEWNGVNGSGRNARVDGFNVGGKTGTADKVVNGRYVHDKN 509

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT-AGINVAPMVGNIIRRSASMLGVKPVF 596
           FN+FL+ FP  DPQY+VLSF+D PK  + N    AG + APMV +II R+A++LGVKP F
Sbjct: 510 FNAFLSAFPMDDPQYVVLSFIDEPKTDKGNGAALAGTSAAPMVHDIISRTAAVLGVKPKF 569

Query: 597 LK 598
            K
Sbjct: 570 GK 571


>gi|15889384|ref|NP_355065.1| penicillin binding protein 2 [Agrobacterium tumefaciens str. C58]
 gi|15157234|gb|AAK87850.1| penicillin binding protein 2 [Agrobacterium tumefaciens str. C58]
          Length = 580

 Score =  608 bits (1568), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 285/542 (52%), Positives = 392/542 (72%), Gaps = 2/542 (0%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
           F+  R+K  A +K+R+G+ I   +  Y ++  R++QYG    E ++     D    SRPD
Sbjct: 30  FEGARKKRAAQAKSRVGLLIFGFIAFYAVVGGRLVQYGMAEQETVSSIAPADRLMASRPD 89

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           ++DRNGE+LATDI T SL+ EPH+++  DE IEKL+ VLP+LD     +KL+S ++FQWL
Sbjct: 90  LLDRNGEVLATDIRTVSLFAEPHRIVDIDEAIEKLRTVLPDLDQRGTYQKLTSNSRFQWL 149

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           RR+L+P+QQ +IL+ G+PGVGFR EK RFYP    A+HVVG+V+IDNRG+ G+E+++D Q
Sbjct: 150 RRQLTPKQQSQILALGIPGVGFRPEKRRFYPGGPTAAHVVGHVNIDNRGVAGMERYVDSQ 209

Query: 239 GLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           GL  +       ++ L+P++L++DLR+Q+IV + +     K+ A   G V+L+V TGEV+
Sbjct: 210 GLADLTALGMTSDQPLEPVKLSIDLRVQSIVREVVTAAIAKFQAIGAGAVVLDVHTGEVL 269

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN 357
           +M S+PDYDP+   +G KEGW NR+S G FEMGS FK FTIAMG+DSG   + D+FD R 
Sbjct: 270 AMASVPDYDPNNPAEGAKEGWLNRMSNGTFEMGSTFKSFTIAMGLDSGRVRLGDMFDARY 329

Query: 358 PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLET 417
           PI++G   I D+H + R+L++PEIF++SSNIG A+IAD +G +GHKEFL RLGLL++++T
Sbjct: 330 PIRIGGFTIKDFHGKGRMLSVPEIFQFSSNIGTAKIADTVGTEGHKEFLTRLGLLTRMQT 389

Query: 418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           ELPE+  PS P +WK+I+S+TISFGHG+STTPLQTAVA AAL+N G+LI PTF+ R+RE+
Sbjct: 390 ELPEVALPSQPREWKKINSITISFGHGVSTTPLQTAVAGAALVNGGKLIEPTFLPRTREQ 449

Query: 478 SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN 537
           +++V++ VLK    K MR L       GSGR A V GF VGGKTGTA KV+  RY    N
Sbjct: 450 ADQVAKQVLKPGASKDMRFLFEWNGVNGSGRNARVDGFNVGGKTGTADKVVNGRYVHDKN 509

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT-AGINVAPMVGNIIRRSASMLGVKPVF 596
           FN+FL+ FP  DPQY+VLSF+D PK  + N    AG + APMV +II R+A++LGVKP F
Sbjct: 510 FNAFLSAFPMDDPQYVVLSFIDEPKTDKGNGAALAGTSAAPMVHDIITRTAAVLGVKPKF 569

Query: 597 LK 598
            K
Sbjct: 570 GK 571


>gi|222086450|ref|YP_002544984.1| cell division penicillin-binding protein [Agrobacterium radiobacter
           K84]
 gi|221723898|gb|ACM27054.1| cell division penicillin-binding protein [Agrobacterium radiobacter
           K84]
          Length = 583

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 276/546 (50%), Positives = 388/546 (71%), Gaps = 2/546 (0%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM 114
           G   F+  R++    +K+R+ + +    ++Y I+  R+ Q+    P+  +  +  D    
Sbjct: 29  GSSTFEGVRKRKSNQAKSRVVLLVASFTIVYCIIGGRLAQFAMTAPDTTSSILPPDRLMA 88

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SRPDI+DRNG +LATDI T SL+ EP+K+I PDE +E+L+ VLP+LD++   +KL+ +T 
Sbjct: 89  SRPDIVDRNGALLATDIRTVSLFAEPNKIIDPDEAVEELRTVLPDLDTKGTYKKLAVKTS 148

Query: 175 -FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F WLRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  S ASH++GYV+IDNRG+ G+EK
Sbjct: 149 HFAWLRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGSTASHILGYVNIDNRGVAGMEK 208

Query: 234 FLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           ++D QGL  +        + LQP++L++DLR+Q+IVH  +V     + A+  G V+L+V 
Sbjct: 209 YIDDQGLADLAAAGMTNSQPLQPVKLSIDLRVQDIVHDAVVNAVNNFQAKGAGAVVLDVH 268

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGEV++M S PD+DP+   +   EGW NR++ G FEMGS FK FT+AM  DSG  T++D 
Sbjct: 269 TGEVLAMASAPDFDPNYPNESASEGWLNRMTNGTFEMGSTFKTFTMAMAFDSGKVTLRDA 328

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           FD  NPI++G   I D+H Q R+LT+PEIF+YSSNIG A+IAD +GI GHKEFL R+GLL
Sbjct: 329 FDATNPIRIGGFTIKDFHGQRRVLTVPEIFQYSSNIGTAKIADLVGIDGHKEFLTRIGLL 388

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
           SK+ TELPE++ PS P  WK+I+S+TISFGHG+STTPLQTAVA AAL+N G+LI PTF+ 
Sbjct: 389 SKMHTELPEVKMPSQPRVWKKINSITISFGHGVSTTPLQTAVAGAALVNGGKLIDPTFLP 448

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           R+R E++ +++ V+KK+T   +R LL    + GSGR A VPG++VG KTGTA KV+  RY
Sbjct: 449 RNRSEADDIAKTVIKKSTSDNVRFLLDFNGSKGSGRAARVPGYDVGSKTGTADKVVHGRY 508

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGV 592
           S+TLNFN+FLA FP  +PQYI+++F D PK  E     +    AP+  +II R+A +LG+
Sbjct: 509 SNTLNFNTFLAAFPIDNPQYIIMTFCDEPKTGEHGGTISAFTAAPIARDIIARAAPILGI 568

Query: 593 KPVFLK 598
           +P F K
Sbjct: 569 QPSFGK 574


>gi|222149142|ref|YP_002550099.1| penicillin binding protein 2 [Agrobacterium vitis S4]
 gi|221736127|gb|ACM37090.1| penicillin binding protein 2 [Agrobacterium vitis S4]
          Length = 583

 Score =  582 bits (1500), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/543 (50%), Positives = 386/543 (71%), Gaps = 8/543 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
           F+   ++    +K R+G+ I+   ++Y ++  R++QYG  HPE  +  M  D    +RPD
Sbjct: 33  FEGAGKRKADMAKRRVGLLILGFTLVYGVIGGRLVQYGYAHPESTSSIMPPDRLMAARPD 92

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I+DRNG++LATDI T SL+ EPHK++  DE +EKLQ VL +LDS    +KLSS++ FQWL
Sbjct: 93  ILDRNGQVLATDIRTVSLFAEPHKIVDVDEAVEKLQTVLADLDSRDTYKKLSSKSHFQWL 152

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           RR+L+P+QQ +IL+ G+PG+GFR E  RFYP  S A+H+VG+V+IDNRG+ G+EK++D Q
Sbjct: 153 RRQLTPKQQSQILALGIPGIGFRPEIRRFYPGGSTAAHIVGFVNIDNRGMAGMEKYIDNQ 212

Query: 239 GLTRV----FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
           GL  +     T+N     L+P++L++DLR+QNIVH  +   +  + A+S G V+L+V TG
Sbjct: 213 GLADLADLGMTSNA---PLEPVKLSIDLRVQNIVHDVVAAAQVNFKAKSAGAVVLDVETG 269

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           EV+ M S PD+DP++  +G KEGW NR+S G FEMGS FK FT+AMG+D+G   + D+FD
Sbjct: 270 EVLGMASYPDFDPNKPEEGAKEGWLNRMSNGTFEMGSTFKSFTMAMGLDTGRVKLSDVFD 329

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
            R P+K+G   IHD+H Q++ L++P+IF+YSSNIG A+I D +GI   KE+L RLGLL+K
Sbjct: 330 ARYPLKIGGFTIHDFHGQSKFLSVPDIFKYSSNIGTAKIIDVVGIPEQKEYLNRLGLLTK 389

Query: 415 LETELPEIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           ++TELPE++ PS P  +WK+I S+TISFGHG++TTPLQTAVA AALIN G+LI PTF+ R
Sbjct: 390 MKTELPEVKMPSQPRGEWKKISSVTISFGHGVATTPLQTAVAGAALINGGKLIQPTFLPR 449

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + +E+ +V+  VLK +T   MR L       GSGR A VPG +VGGKTGTA KV+  RY 
Sbjct: 450 TVDEANEVAEAVLKPSTSADMRYLFEYNGINGSGRGARVPGLDVGGKTGTADKVVNGRYD 509

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
             LNFN+FL  FP + P+Y+VLSF+D P   E     +     P+V ++IRR+A +LGV+
Sbjct: 510 SKLNFNAFLGAFPMSKPRYVVLSFIDEPLSGEGGGTISAFTALPIVRDVIRRTAPILGVE 569

Query: 594 PVF 596
           P +
Sbjct: 570 PNY 572


>gi|190892589|ref|YP_001979131.1| cell division penicillin-binding protein [Rhizobium etli CIAT 652]
 gi|190697868|gb|ACE91953.1| cell division penicillin-binding protein [Rhizobium etli CIAT 652]
          Length = 585

 Score =  570 bits (1469), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 267/539 (49%), Positives = 383/539 (71%), Gaps = 6/539 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPDI+DR
Sbjct: 37  RKKKSGQAKSRVGLLILGFMGVYVVIGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDR 96

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NGE+LATDI T SL+ EP+K++ PDE +EKL  VLP LD +   +KLS +T  F WLRR+
Sbjct: 97  NGEVLATDIRTVSLFAEPNKIVDPDEAVEKLATVLPELDVKDTYKKLSVKTSHFAWLRRQ 156

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EKF+D QGL 
Sbjct: 157 LTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKFIDDQGLA 216

Query: 242 RVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            + +     ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV++M 
Sbjct: 217 DLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEVLAMA 276

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD   PI 
Sbjct: 277 SAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMSDTFDASKPIY 336

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L +LGLL+K++TELP
Sbjct: 337 IGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLNKLGLLTKMQTELP 396

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E++ P+ P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+REE+++
Sbjct: 397 EVKMPTQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTREEADQ 456

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           +++ V+KK+T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TLNFNS
Sbjct: 457 IAKQVIKKSTSDEIRYLLDFNGFKGSGRVARVPGFAVGSKTGTADKVVNGRYSSTLNFNS 516

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKER---NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           F+A FP  DP+Y V++F D PK  E+     ++AG    P+   II R+A +LG++P F
Sbjct: 517 FIAAFPINDPKYAVITFCDEPKTGEKQYGGTISAG-TAGPIAREIISRAAPILGIEPKF 574


>gi|327194628|gb|EGE61478.1| cell division penicillin-binding protein [Rhizobium etli CNPAF512]
          Length = 578

 Score =  569 bits (1467), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 267/539 (49%), Positives = 383/539 (71%), Gaps = 6/539 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPDI+DR
Sbjct: 30  RKKKSGQAKSRVGLLILGFMGVYVVIGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDR 89

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NGE+LATDI T SL+ EP+K++ PDE +EKL  VLP LD +   +KLS +T  F WLRR+
Sbjct: 90  NGEVLATDIRTVSLFAEPNKIVDPDEAVEKLATVLPELDVKDTYKKLSVKTSHFAWLRRQ 149

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EKF+D QGL 
Sbjct: 150 LTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKFIDDQGLA 209

Query: 242 RVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            + +     ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV++M 
Sbjct: 210 DLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEVLAMA 269

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD   PI 
Sbjct: 270 SAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMSDTFDASKPIY 329

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L +LGLL+K++TELP
Sbjct: 330 IGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLNKLGLLTKMQTELP 389

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E++ P+ P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+REE+++
Sbjct: 390 EVKMPTQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTREEADQ 449

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           +++ V+KK+T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TLNFNS
Sbjct: 450 IAKQVIKKSTSDEIRYLLDFNGFKGSGRVARVPGFAVGSKTGTADKVVNGRYSATLNFNS 509

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKER---NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           F+A FP  DP+Y V++F D PK  E+     ++AG    P+   II R+A +LG++P F
Sbjct: 510 FIAAFPINDPKYAVITFCDEPKTGEKQYGGTISAG-TAGPIAREIISRAAPILGIEPKF 567


>gi|86358456|ref|YP_470348.1| cell division penicillin-binding protein [Rhizobium etli CFN 42]
 gi|86282558|gb|ABC91621.1| cell division penicillin-binding protein [Rhizobium etli CFN 42]
          Length = 585

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 266/539 (49%), Positives = 380/539 (70%), Gaps = 6/539 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPDI+DR
Sbjct: 37  RKKKTGQAKSRVGLLILGFMSVYVVVGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDR 96

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS ++  F WLRR+
Sbjct: 97  NGEVLATDIRTVSLFAEPNKIVDVDEAVEKLATVLPELDVRDTYKKLSVKSSHFAWLRRQ 156

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EKF+D QGL 
Sbjct: 157 LTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKFIDDQGLA 216

Query: 242 RVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            + +     ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV+ M 
Sbjct: 217 DLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEVLGMA 276

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S PD+DP+   +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD   PI 
Sbjct: 277 SAPDFDPNNPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMSDTFDASKPIY 336

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L +LGLL+K++TELP
Sbjct: 337 IGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLTKLGLLTKMQTELP 396

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E++ P+ P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+REE+++
Sbjct: 397 EVKMPTQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTREEADQ 456

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           +++ V+KK+T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TLNFNS
Sbjct: 457 IAKQVIKKSTSDEIRYLLDFNGFKGSGRVARVPGFAVGSKTGTADKVVNGRYSSTLNFNS 516

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKER---NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           F+A FP  DP+Y V++F D PK  E+     ++AG    P+   IIRR+A +LG++P F
Sbjct: 517 FIAAFPINDPKYAVITFCDEPKTGEKQYGGTISAG-TAGPIAREIIRRAAPILGIEPKF 574


>gi|110634363|ref|YP_674571.1| penicillin-binding protein, transpeptidase [Mesorhizobium sp. BNC1]
 gi|110285347|gb|ABG63406.1| penicillin-binding protein, transpeptidase [Chelativorans sp. BNC1]
          Length = 574

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 269/549 (48%), Positives = 385/549 (70%), Gaps = 7/549 (1%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEY 112
           E    + Q RR+     +++RI + + + L IY  +  R++  G I   P+  ++     
Sbjct: 16  EQASIVLQGRRKATSGRAQSRIVLAMAMILGIYGAIGARLVHLGLIEEAPV--NLPQTRP 73

Query: 113 GMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
             SRPD++DRNGE+LATDI T SL+ EP  +I  DE+IEKLQ VLP+LD E   R+L S+
Sbjct: 74  TASRPDLLDRNGEVLATDIKTSSLFAEPRHIIDIDEVIEKLQKVLPDLDYEQTYRRLDSD 133

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F WLRR+LSP+QQ  IL+ G+PG+GFR EK+RFYP  + ASH++G V+IDN+GI G+E
Sbjct: 134 AGFVWLRRQLSPRQQSDILALGIPGLGFRTEKTRFYPGGATASHILGLVNIDNKGIAGME 193

Query: 233 KFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           +++D QGL  +      G   L+P+RL++DLR Q I+H EL +   +Y+A + G  ILN 
Sbjct: 194 QYVDDQGLADLQALGLAGPDTLEPVRLSIDLRAQYILHDELSQAMDRYHAIAAGGAILNA 253

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++MVS+PDYDP+  +   ++   NR++ G+FEMGS FK+FT AM +DSG   + D
Sbjct: 254 RTGEVVAMVSLPDYDPNNPYNALEKDRINRMTAGVFEMGSTFKLFTTAMALDSGHVKMTD 313

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
            FD   P+++G   I+D+H + R+L++PE+F YSSNIG A++AD +GI+GH+ FL ++GL
Sbjct: 314 RFDASRPLRLGGFTINDFHGKGRVLSVPEVFIYSSNIGTAKMADVVGIEGHRAFLKKVGL 373

Query: 412 LSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           L K++TELPE+  P+ P  WK+I+S+TISFGHG++TTPLQTAV+A A++N G+LIPPTF+
Sbjct: 374 LDKMKTELPEVAQPTEPKVWKKINSVTISFGHGVATTPLQTAVSAVAMVNGGKLIPPTFL 433

Query: 472 IRSREESEKVSRIVLKKNTVKTMRSLLREGV---TGGSGRRAFVPGFEVGGKTGTAQKVI 528
            R+ EE++ V+  V+   T   +R L R  V   TGGSG RA VPGF VGGKTGTA+KV+
Sbjct: 434 PRTEEEAQAVATQVISPETSAQIRYLFRLNVQKGTGGSGSRADVPGFYVGGKTGTAEKVV 493

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSA 587
             RYS+   FN+FLA +P  DP+Y+V+  +D PK ++     T+G+N AP+VGN+IRR+A
Sbjct: 494 NGRYSNDKRFNAFLAAYPINDPEYVVVVILDEPKGEKPGMSATSGLNAAPVVGNVIRRTA 553

Query: 588 SMLGVKPVF 596
            +LGV+P F
Sbjct: 554 PLLGVEPDF 562


>gi|116253054|ref|YP_768892.1| penicillin binding protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257702|emb|CAK08800.1| putative penicillin binding protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 586

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 266/539 (49%), Positives = 377/539 (69%), Gaps = 6/539 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+K    +K+R+G+ I+  + +Y ++  R+++Y     E ++  +  D    SRPDI+DR
Sbjct: 38  RKKKSGQAKSRVGLLILGFMGVYAVIGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDR 97

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS +T  F WLRR+
Sbjct: 98  NGEVLATDIRTVSLFAEPNKIVDADEAVEKLATVLPELDVRDTYKKLSVKTSHFAWLRRQ 157

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ +IL+ G+PG+GFR EK RFYP  + A+H++GYV+IDNRG+ G+EKF+D QGL 
Sbjct: 158 LTPKQQSQILALGIPGIGFRPEKRRFYPGGATAAHILGYVNIDNRGVAGMEKFIDDQGLA 217

Query: 242 RVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            + +     ++ L+P+RL++DLR+QNIV   +V     + A+  G  +++V TGEV++M 
Sbjct: 218 DLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVTNFQAKGAGAAVIDVHTGEVLAMA 277

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +DSG   + D FD    I 
Sbjct: 278 SAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDSGKVKMTDSFDASKSIY 337

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L + GLL+K++TELP
Sbjct: 338 IGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLTKFGLLTKMQTELP 397

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE++++
Sbjct: 398 EVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTREQADE 457

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           ++  V+KK T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TLNFNS
Sbjct: 458 IATQVIKKTTSDEIRYLLDFNGYKGSGRVARVPGFSVGSKTGTADKVVNGRYSATLNFNS 517

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKER---NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           F+A FP  DP+Y V++F D PK  E+     ++AG    P+   IIRR+A +LG++P F
Sbjct: 518 FIAAFPMNDPRYAVITFCDEPKSGEKAYGGTISAG-TAGPIAREIIRRAAPILGIEPKF 575


>gi|209550180|ref|YP_002282097.1| peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535936|gb|ACI55871.1| Peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 586

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 264/539 (48%), Positives = 377/539 (69%), Gaps = 6/539 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPDI+DR
Sbjct: 38  RKKKSGQAKSRVGLLILGFMGVYVVIGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDR 97

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS +T  F WLRR+
Sbjct: 98  NGEVLATDIRTVSLFAEPNKIVDADEAVEKLATVLPELDVRDTYKKLSVKTSHFAWLRRQ 157

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EK++D QGL 
Sbjct: 158 LTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKYIDDQGLA 217

Query: 242 RVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            + +     ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV++M 
Sbjct: 218 DLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEVLAMA 277

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD    I 
Sbjct: 278 SAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMTDTFDASKSIY 337

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L + GLL+K++TELP
Sbjct: 338 IGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLTKFGLLTKMQTELP 397

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ RSRE++++
Sbjct: 398 EVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRSREQADE 457

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           ++  V+KK T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TLNFNS
Sbjct: 458 IATQVIKKTTSDEIRYLLDFNGYKGSGRVARVPGFAVGSKTGTADKVVNGRYSATLNFNS 517

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKER---NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           F+A FP  DP+Y V++F D PK  E+     ++AG    P+   II R+A +LG++P F
Sbjct: 518 FIAAFPINDPKYAVITFCDEPKTGEKQYGGTISAG-TAGPIAREIISRAAPILGIEPKF 575


>gi|239832315|ref|ZP_04680644.1| Penicillin-binding protein 2 [Ochrobactrum intermedium LMG 3301]
 gi|239824582|gb|EEQ96150.1| Penicillin-binding protein 2 [Ochrobactrum intermedium LMG 3301]
          Length = 604

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/570 (48%), Positives = 385/570 (67%), Gaps = 16/570 (2%)

Query: 37  RNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG 96
           +NM++G+ +   G     G   F   R+K    ++NR+ M I   + IY ++  ++I +G
Sbjct: 9   KNMQAGNGVEPVGDEKLAGNMAFVGSRKKHGNRARNRLWMAIACFVGIYGVMGGKLIYFG 68

Query: 97  NIHPEPIAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEII 150
            I  E      N D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE I
Sbjct: 69  VIGGE------NEDNAGPAVQQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETI 122

Query: 151 EKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPA 210
           E L  VLP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP 
Sbjct: 123 EMLSTVLPDLDWEATYKRLKSGAGFVWVKRGLTPRQQSQIMALGVPGIGFRTEKRRFYPG 182

Query: 211 ASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVH 269
              ASH++G V++DN+GI G+EK++D QGLT + +      ++L+P+RL++D+R+Q+I+ 
Sbjct: 183 GPTASHILGLVNVDNQGIAGMEKYIDSQGLTDLRSVGLATGQSLEPVRLSIDIRVQHIMR 242

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
             LV+  ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EM
Sbjct: 243 DVLVKAMERYRAIAAGAVVLNVKTGEVIAMASVPDFDPNNPVHALDKDRLNRMSAGTYEM 302

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K FT AM +DSG F +    D   P+  G+  I D+H + R+LT+PE+F +SSNIG
Sbjct: 303 GSTIKSFTTAMALDSGKFNLNSRLDASRPLVFGRQTIRDFHGKGRVLTLPEVFIFSSNIG 362

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTP 449
           + + ADA+GI+GH+ FL ++GLL +L+TELPE+  P  P  WK++HS+TISFGHG+ TTP
Sbjct: 363 SGREADAVGIEGHRAFLKKIGLLDRLQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTP 422

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQTAV AAAL+N G+L+PPTF+ R++ E+++V++ ++       MR L R   T  GGSG
Sbjct: 423 LQTAVGAAALMNGGKLMPPTFLTRTQAEADQVAKQIIHPQVSADMRYLYRLNATAQGGSG 482

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-R 566
           +RA VPG+ VGGKTGTA+KV+  RYS  + FN+FLA FP  DP Y+VL+ +D PK +E +
Sbjct: 483 KRATVPGYRVGGKTGTAEKVVHGRYSKDVRFNAFLASFPMDDPTYVVLTIIDEPKPEEGK 542

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              TAG+N APMV  IIRRSAS LGVKP F
Sbjct: 543 FSATAGLNAAPMVSEIIRRSASFLGVKPDF 572


>gi|159184602|ref|NP_354091.2| penicillin-binding protein [Agrobacterium tumefaciens str. C58]
 gi|159139904|gb|AAK86876.2| penicillin-binding protein [Agrobacterium tumefaciens str. C58]
          Length = 586

 Score =  559 bits (1440), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 265/534 (49%), Positives = 371/534 (69%), Gaps = 12/534 (2%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           +G+ I V   IY+++A R++QYG   P   A          SRPDI+DRNG +LATD+  
Sbjct: 42  LGIVIAVFAAIYVVVAARLVQYGLAEPVATAWINTGANAVASRPDIVDRNGMLLATDLNM 101

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
            SLY +P +V+ PDE++EKL  V+PNLD     R+L S+T FQWLRR+L+P+QQ  IL+ 
Sbjct: 102 VSLYADPRRVVDPDEVVEKLASVIPNLDWRETHRRLRSDTGFQWLRRQLTPRQQADILNL 161

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT--RVFTTNKGEK 251
           G+PG+GFR EK RFYP    ASH++G+V++DN+G+ G+E++LD QGL   R      G  
Sbjct: 162 GIPGIGFRPEKRRFYPGGPAASHIIGHVNVDNQGLAGMERYLDQQGLADLRAVGLASGAP 221

Query: 252 NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAF 311
            L+P++L++D+R+QNIV + +V+ K  Y AE+ G+VIL+V TGEV++M S+PDYDP+E  
Sbjct: 222 -LEPVKLSIDMRVQNIVREVVVKAKSAYEAEAAGSVILDVETGEVLAMASVPDYDPNEPS 280

Query: 312 K---------GKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           +           ++GWFNR+S   FEMGS FK FT+AMG+D+G  T+  + D   PI++G
Sbjct: 281 RTLADGSIDRDYEKGWFNRMSNATFEMGSTFKSFTLAMGLDAGAITLNSVVDASRPIRMG 340

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
              I D+  +NR L+IPE+F+YSSNIG A +AD +G++GH++FL +LGLL+K++TE+P +
Sbjct: 341 GFTIKDFKGRNRPLSIPEVFQYSSNIGTAAVADKVGVEGHQQFLTKLGLLTKMDTEMPGV 400

Query: 423 QAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
             P+ P  WK+I+S+TISFGHG++TTPLQTAVAAAALIN G L+ PTF+ RS+E++  +S
Sbjct: 401 ATPTQPRVWKKINSVTISFGHGVATTPLQTAVAAAALINGGNLMSPTFLPRSKEDAASIS 460

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFL 542
           R V+++ T   MR L       GSGR A V GF VGGKTGTA KVI  RY+  +NFN+F+
Sbjct: 461 RSVIEQKTSADMRYLFNWNGIKGSGRGAQVEGFHVGGKTGTADKVINGRYAKNINFNAFV 520

Query: 543 AVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           A FP   P+Y+VL+ +D+PK       TA    APM   II ++A +LGVKP F
Sbjct: 521 AGFPMHKPKYVVLTMIDAPKTGVNGGRTAASTAAPMTREIIAQTAGLLGVKPRF 574


>gi|241205563|ref|YP_002976659.1| peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859453|gb|ACS57120.1| Peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 586

 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 265/539 (49%), Positives = 376/539 (69%), Gaps = 6/539 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+K    +K+R+G+ I+  + +Y ++  R+++Y     E ++  +  D    SRPDI+DR
Sbjct: 38  RKKKSGQAKSRVGLLILGFMGVYAVIGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDR 97

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS +T  F WLRR+
Sbjct: 98  NGEVLATDIRTVSLFAEPNKIVDADEAVEKLATVLPELDVRDTYKKLSVKTSHFAWLRRQ 157

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ +IL+ G+PG+GFR EK RFYP  + A+H++GYV+IDNRG+ G+EKF+D QGL 
Sbjct: 158 LTPKQQSQILALGIPGIGFRPEKRRFYPGGATAAHILGYVNIDNRGVAGMEKFIDDQGLA 217

Query: 242 RVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            + +     ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV++M 
Sbjct: 218 DLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVTNFQSKGAGAAVIDVHTGEVLAMA 277

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +DSG   + D FD    I 
Sbjct: 278 SAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDSGKVKMTDSFDASKSIY 337

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   KE+L + GLL+K++TELP
Sbjct: 338 IGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKEYLTKFGLLTKMQTELP 397

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE++++
Sbjct: 398 EVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTREQADE 457

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           ++  V+KK T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TLNFNS
Sbjct: 458 IATQVIKKTTSDEIRYLLDFNGYKGSGRVARVPGFGVGSKTGTADKVVNGRYSATLNFNS 517

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKER---NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           F+A FP  DP+Y V++F D PK  E+     ++AG    P+   II R+A +LG++P F
Sbjct: 518 FIAAFPINDPRYAVITFCDEPKTGEKAYGGTISAG-TAGPIAREIISRAAPILGIEPKF 575


>gi|325292446|ref|YP_004278310.1| penicillin-binding protein [Agrobacterium sp. H13-3]
 gi|325060299|gb|ADY63990.1| penicillin-binding protein [Agrobacterium sp. H13-3]
          Length = 586

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 276/566 (48%), Positives = 387/566 (68%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H + Q+         L    RR+V A  K R+G+ I V +V+Y ++A R++QYG    EP
Sbjct: 13  HFIIQRSPFQGRDAILGSAARRRVDA--KKRLGILIAVFVVVYGVVAARLVQYG--LAEP 68

Query: 103 IAPS-MNIDEYGM-SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
           IA + +N     + SRPDI+DRNG +LATD+   SLY +P +V+  DE++EKL  V+PNL
Sbjct: 69  IATAWINTGATAVASRPDILDRNGTLLATDLNMVSLYADPRRVVDADEVVEKLATVIPNL 128

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           D     R+L S++ FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RFYP    ASH++G+
Sbjct: 129 DWRETHRRLRSDSGFQWLRRQLTPRQQADILNLGIPGIGFRPEKRRFYPGGPAASHIIGH 188

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFTTNKGEKN-LQPIRLALDLRIQNIVHQELVENKKKY 279
           V++DN+G+ G+E++LD QGL  +  T       L+P+RL++DLR+QNIV + +++ K  Y
Sbjct: 189 VNVDNQGLAGMERYLDQQGLADLRATGLASGAPLEPVRLSIDLRVQNIVREVVLKAKTAY 248

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKG---------KKEGWFNRISYGIFEMG 330
            AE+ G+VIL+V TGEV++M S+PDYDP+E  +           ++GWFNR+S   FEMG
Sbjct: 249 QAEAAGSVILDVETGEVLAMASVPDYDPNEPSRTLADGSIDREYEKGWFNRMSNATFEMG 308

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA 390
           S FK FT+AMG+D+G  T+  + D   PI++G   I D+  +NR L+IPE+F+YSSNIG 
Sbjct: 309 STFKSFTLAMGLDAGAITLNSVVDASRPIRMGGFTIKDFKGRNRPLSIPEVFQYSSNIGT 368

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPL 450
           A +AD +G++GH++FL +LGLLS+++TE+P +  P+ P  WK+I+S+TISFGHG++TTPL
Sbjct: 369 AAVADKVGVEGHQQFLTKLGLLSRMDTEMPGVATPTQPRTWKKINSVTISFGHGVATTPL 428

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           QTAVAAAALIN G LI PTF+ RSRE++  +SR V+   T   MR L       GSGR A
Sbjct: 429 QTAVAAAALINGGSLISPTFLPRSREDAAVLSRTVINGKTSADMRYLFNWNGIKGSGRGA 488

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF VGGKTGTA KVI  RY+  +NFN+F+A FP   P+Y+VL+ +D+P+       T
Sbjct: 489 QVEGFHVGGKTGTADKVINGRYAKDINFNAFVAGFPMHKPKYVVLTMIDAPRTGVNGGRT 548

Query: 571 AGINVAPMVGNIIRRSASMLGVKPVF 596
           A    APM   II ++A +LGVKP F
Sbjct: 549 AASTAAPMTREIITQTAGLLGVKPRF 574


>gi|13471555|ref|NP_103121.1| penicillin-binding protein [Mesorhizobium loti MAFF303099]
 gi|14022297|dbj|BAB48907.1| penicillin-binding protein [Mesorhizobium loti MAFF303099]
          Length = 569

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/559 (47%), Positives = 380/559 (67%), Gaps = 8/559 (1%)

Query: 42  GHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE 101
           G  L ++    EDG  + +  R+      K RI MT+ V   I+  ++ R++  G   P+
Sbjct: 3   GKLLKRRARTGEDGSIVVEGARKATGGKGKARIVMTMAVFFGIFSTISGRLVYLGFQTPD 62

Query: 102 -PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
               P   I     SRPDI+DRNGE+LATDI T SL+ EP +++  DE IEKL  VLP +
Sbjct: 63  LSGGPQSRIT---ASRPDIVDRNGEVLATDIKTASLFAEPRRIVDADEAIEKLSTVLPEI 119

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           D E    KL S   F WL+R+L+P+QQ  I+  G+PG GFR EK RFYP+   +S++VG 
Sbjct: 120 DYEQTYHKLKSGAGFVWLQRQLTPKQQADIMQLGIPGFGFRTEKRRFYPSGETSSYIVGL 179

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKY 279
            +IDN+GI+G+EK++D QGL+ +  +     K+L+P++L++DLR+Q++V  E+    ++Y
Sbjct: 180 TNIDNQGISGMEKYIDEQGLSDLQASGLAVAKDLKPVKLSIDLRVQHVVRDEIAAGLERY 239

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
            A   G V+LNV TGEVI+M S+PD+DP+  +  +++   NR+S G++EMGS FK FT A
Sbjct: 240 RAIGAGAVVLNVKTGEVIAMASVPDFDPNNPYNAQEKDRLNRMSAGLYEMGSTFKSFTSA 299

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           M +DSG  T+   FD  +PI+VG   IHD+H +NR+L++PE+F YSSNIG+A+ A+ +GI
Sbjct: 300 MALDSGKATMNSRFDASHPIRVGHQAIHDFHGKNRVLSLPEVFLYSSNIGSAREAELVGI 359

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
           +GH+EFL+RLG+L +++TELPE+  P+ P  WK+++S TI+FGHG+STTPLQ AV  AAL
Sbjct: 360 EGHREFLHRLGILERMQTELPEVARPTEPKVWKQVNSFTIAFGHGVSTTPLQAAVGCAAL 419

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
           +N G L+ PTF++R+++E+  +++ V+ + TV+ MR L       GS R A VPG+ VGG
Sbjct: 420 MNGGYLMNPTFLVRTQQEAMAIAKKVVSEKTVEGMRYLYSLNAEKGSARNARVPGYRVGG 479

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAP 577
           KTGTA+KVI  RYS  LNFN+F+A FP  DPQY+V +  D+P   E+  +T  A  N   
Sbjct: 480 KTGTAEKVINGRYSKELNFNTFVAAFPIEDPQYLVFTIADAPH-PEKPGMTDVAAANAGV 538

Query: 578 MVGNIIRRSASMLGVKPVF 596
           M GNIIRRSA+MLGVKP F
Sbjct: 539 MAGNIIRRSAAMLGVKPDF 557


>gi|260462084|ref|ZP_05810328.1| Peptidoglycan glycosyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259031944|gb|EEW33211.1| Peptidoglycan glycosyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 569

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 266/559 (47%), Positives = 377/559 (67%), Gaps = 8/559 (1%)

Query: 42  GHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE 101
           G  L ++   +EDG  +    R+      K RI MT+ V   I+ +++ R++  G   P+
Sbjct: 3   GKLLKRRARTVEDGSIVVDGARKATGGKGKARIVMTMAVFFGIFSVISGRLVYLGFQTPD 62

Query: 102 -PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
               P   +     SRPDI+DRNGE+LATDI T SL+ EP +++  DE IEKL  VLP +
Sbjct: 63  LSGGPQSRVT---ASRPDIVDRNGEVLATDIKTASLFAEPRRIVDADEAIEKLSTVLPEI 119

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           D E    KL S   F WL+R+L+P+QQ  I+  G+PG GFR EK RFYP+   +S++VG 
Sbjct: 120 DYEQTYHKLKSGAGFVWLQRQLTPKQQADIMQLGIPGFGFRTEKRRFYPSGETSSYIVGL 179

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKY 279
            +IDN+GI+G+EK++D QGL+ +  +     K+L+P++L++DLRIQ++V  E+    ++Y
Sbjct: 180 TNIDNQGISGMEKYIDEQGLSDLQASGLAVAKDLKPVKLSIDLRIQHVVRDEIAAGLERY 239

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
            A   G V+LNV TGEV++M S+PD+DP+  +  +++   NR+S G++EMGS FK FT A
Sbjct: 240 RALGAGAVVLNVKTGEVVAMASVPDFDPNNPYNAQEKDRLNRMSAGLYEMGSTFKSFTSA 299

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           M +DSG  T+   FD  +PI+VG   IHD+H +NR+L++PE+F YSSNIG+A+ A+ +GI
Sbjct: 300 MALDSGKATMASRFDASHPIRVGHQAIHDFHGKNRVLSLPEVFLYSSNIGSAREAELVGI 359

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
            GH+EFL+RLG+L K++TELPE+  P+ P  WK+++S TI+FGHG+STTPLQ AV  AAL
Sbjct: 360 AGHREFLHRLGILDKMQTELPEVARPTEPKVWKQVNSFTIAFGHGVSTTPLQAAVGCAAL 419

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
           +N G L+ PTF++RS +E+   ++ V+   TV+ MR L       GS R A VPG+ VGG
Sbjct: 420 MNGGYLMEPTFLVRSEQEAMATAKKVVSDKTVEGMRYLYTLNAEKGSARNARVPGYRVGG 479

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAP 577
           KTGTA+KVI  RYS  LNFN+F+A FP  DPQY+V +  D+P   E+  +T  A  N   
Sbjct: 480 KTGTAEKVINGRYSKDLNFNTFVAAFPMDDPQYLVFTIADAPH-PEKPGMTDVAAANAGV 538

Query: 578 MVGNIIRRSASMLGVKPVF 596
           + GNIIRRSA+MLGVKP F
Sbjct: 539 IAGNIIRRSAAMLGVKPDF 557


>gi|153009068|ref|YP_001370283.1| peptidoglycan glycosyltransferase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560956|gb|ABS14454.1| Peptidoglycan glycosyltransferase [Ochrobactrum anthropi ATCC
           49188]
          Length = 594

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/552 (48%), Positives = 376/552 (68%), Gaps = 16/552 (2%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYG- 113
           G   F   R+K    ++NR+ M I   + IY ++  ++I +G I  E      N D  G 
Sbjct: 17  GNMAFVGSRKKHGNRARNRLWMAIACFVGIYGVMGGKLIYFGVIGGE------NEDNAGP 70

Query: 114 -----MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRK 168
                 SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD E   ++
Sbjct: 71  AVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDWEATYKR 130

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
           L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V++DN+GI
Sbjct: 131 LKSGAGFVWIKRGLTPRQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVNVDNQGI 190

Query: 229 TGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
            G+EK++D QGLT + +      ++L+P+RL++D+R+Q+I+   LV+  ++Y A + G V
Sbjct: 191 AGMEKYIDSQGLTDLRSVGLATGQSLEPVRLSIDIRVQHIMRDVLVKAMERYRAIAAGAV 250

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM +DSG F
Sbjct: 251 VLNVKTGEVIAMASVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMALDSGKF 310

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
            ++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+GH+ FL 
Sbjct: 311 NLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEGHRAFLK 370

Query: 408 RLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N G+L+ 
Sbjct: 371 KIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMNGGKLME 430

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQ 525
           PTF++R++ ++++V++ V+       MR L R   T  GGSG+RA VPG+ VGGKTGTA+
Sbjct: 431 PTFLMRTQAQADQVAKQVIHPQVSADMRYLYRLNATAQGGSGKRATVPGYRVGGKTGTAE 490

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIR 584
           KV+  RYS  + FN+FLA FP  DP Y+VL+ +D PK +E +   TAG+N APMV  IIR
Sbjct: 491 KVVHGRYSKDVRFNAFLASFPMDDPTYVVLTIIDEPKPEEGKFSATAGLNAAPMVSEIIR 550

Query: 585 RSASMLGVKPVF 596
           RSAS LGVKP F
Sbjct: 551 RSASFLGVKPDF 562


>gi|319782842|ref|YP_004142318.1| peptidoglycan glycosyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168730|gb|ADV12268.1| Peptidoglycan glycosyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 569

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 263/559 (47%), Positives = 377/559 (67%), Gaps = 8/559 (1%)

Query: 42  GHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE 101
           G  L ++    EDG  + +  R+      + RI MT+ V   I+  ++ R++  G   P+
Sbjct: 3   GKLLKRRARTSEDGSIVVEGARKATGGKGRTRIVMTMAVFFGIFSTISGRLVYLGFQTPD 62

Query: 102 -PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
               P   +     SRPDI+DRNGE+LATDI T SL+ EP +++  DE IEKL  VLP++
Sbjct: 63  MSGGPQSRVT---ASRPDIVDRNGEVLATDIKTASLFAEPRRIVDADEAIEKLSTVLPDI 119

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           D E    KL S   F WL+R+L+P+QQ  I+  G+PG GFR EK RFYP+   +S++VG 
Sbjct: 120 DYEQTYHKLKSGAGFVWLQRQLTPKQQSDIMQLGIPGFGFRTEKRRFYPSGETSSYIVGL 179

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKY 279
            +IDN+GI+G+EK++D QGL+ +  +     K+L+P++L++DLR+Q++V  E+    ++Y
Sbjct: 180 TNIDNQGISGMEKYVDEQGLSDLQASGLAIAKDLKPVKLSIDLRVQHVVRDEIAAGLERY 239

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
            A   G V+LNV TGEV++M S+PD+DP+  +  + +   NR+S G++EMGS FK FT A
Sbjct: 240 RAMGTGAVVLNVKTGEVVAMASVPDFDPNNPYNAQDKDRLNRMSAGLYEMGSTFKSFTSA 299

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           M +DSG  T+   FD  +PI+VG   IHD+H +NR+L++PE+F YSSNIG+A+ A+ +GI
Sbjct: 300 MALDSGKATMASRFDASHPIRVGHQAIHDFHGKNRVLSLPEVFLYSSNIGSAREAEMVGI 359

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
           +GH+EFL+RLG+L +++TELPE   P+ P  WK+++S TI+FGHG+STTPLQ AV  AAL
Sbjct: 360 EGHREFLHRLGILDRMQTELPETARPTEPKVWKQVNSFTIAFGHGVSTTPLQAAVGCAAL 419

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
           +N G L+ PTF++R++ E+   ++ V+ + TV+ MR L       GS R A VPG+ VGG
Sbjct: 420 MNGGFLMNPTFLVRTQAEAMATAKRVVSEKTVEGMRYLYSLNAEKGSARNARVPGYRVGG 479

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAP 577
           KTGTA+KVI  RYS  LNFN+F+A FP  DPQY+V +  D+P   E+  +T  A  N   
Sbjct: 480 KTGTAEKVINGRYSKDLNFNTFVAAFPMDDPQYLVFTIADAPH-PEKPGMTDVAAANAGV 538

Query: 578 MVGNIIRRSASMLGVKPVF 596
           M GNIIRRSA+MLGVKP F
Sbjct: 539 MAGNIIRRSAAMLGVKPDF 557


>gi|90418200|ref|ZP_01226112.1| penicillin-binding protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90337872|gb|EAS51523.1| penicillin-binding protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 579

 Score =  545 bits (1405), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 266/552 (48%), Positives = 377/552 (68%), Gaps = 4/552 (0%)

Query: 49  GCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMN 108
           G  + D     + RR +    +++R  + + + + IY ++  R++ +G    E  A    
Sbjct: 17  GTMLPDCDHFGRPRRHRGGPKNRSRFVIAMGLFVGIYGVIGGRLVMWGVAPTESAAAYGA 76

Query: 109 IDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRK 168
            D+    RPD++DRNGE+LATDI T SL+ EP ++I PDE  E L  V+P+LD + + R+
Sbjct: 77  ADKIMSDRPDLLDRNGEVLATDIKTASLFAEPRRIIDPDEASELLLGVMPDLDPKWLYRR 136

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
           L+S   F WLRR+L+P QQ+ +L  G+PG+GFR EK RFYP  + A  +VG+ ++DN+G 
Sbjct: 137 LASNAGFVWLRRELTPGQQQAVLDLGIPGIGFRTEKRRFYPGGTTAGFIVGHTNVDNQGT 196

Query: 229 TGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
            G+EK++D QG   +         +L+P++L+LDLR+Q+IV  EL     +Y A + G V
Sbjct: 197 AGMEKYIDDQGYRALQDAGLAVGTDLEPVKLSLDLRVQHIVRDELAAAMARYKAIAAGGV 256

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +L+V TGEV++M S+PDYDP++  +   +   NR+S G++EMGS FK FT AM +DSG  
Sbjct: 257 VLDVHTGEVVAMTSLPDYDPNQPSQALDKDRMNRMSAGLYEMGSTFKAFTTAMALDSGKV 316

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
            + D FD   PI++G   I D+H + R+L++PE+F YSSNIG+A+ A+A+GI+GH+EFL 
Sbjct: 317 KITDSFDATRPIRMGGFTISDFHGKRRVLSVPEVFIYSSNIGSAKEAEAVGIEGHQEFLT 376

Query: 408 RLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           R+GLLS++ TELPE+  P+ P  WK+I+S+TISFGHG+STTPL TAVAAAAL+N G+LIP
Sbjct: 377 RVGLLSRMTTELPEVATPTQPKVWKQINSVTISFGHGVSTTPLNTAVAAAALMNGGKLIP 436

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFEVGGKTGTAQ 525
           PTF+ RSR E+E V+  VL + T   MR L R  V    GSG +A V G+ VGGKTGTA 
Sbjct: 437 PTFLPRSRAEAEAVATRVLSEKTSDEMRYLFRLNVADQRGSGNKADVTGYRVGGKTGTAN 496

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIR 584
           KV+  RYSDT  FN+FL+ FP  +P+YIVL  +D PK ++ +   TAG+N AP VGNIIR
Sbjct: 497 KVVNGRYSDTKKFNAFLSAFPIDNPRYIVLVVIDEPKPEDGQYYATAGMNAAPTVGNIIR 556

Query: 585 RSASMLGVKPVF 596
           RSA++LGV+P F
Sbjct: 557 RSATLLGVRPEF 568


>gi|254694121|ref|ZP_05155949.1| penicillin-binding protein [Brucella abortus bv. 3 str. Tulya]
 gi|261214421|ref|ZP_05928702.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260916028|gb|EEX82889.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 607

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQASADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|23502308|ref|NP_698435.1| penicillin-binding protein [Brucella suis 1330]
 gi|62290330|ref|YP_222123.1| penicillin-binding protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700254|ref|YP_414828.1| beta-lactamase class A [Brucella melitensis biovar Abortus 2308]
 gi|161619385|ref|YP_001593272.1| penicillin-binding protein 2 [Brucella canis ATCC 23365]
 gi|189024563|ref|YP_001935331.1| penicillin-binding protein [Brucella abortus S19]
 gi|237815837|ref|ZP_04594834.1| Penicillin-binding protein 2 [Brucella abortus str. 2308 A]
 gi|254689631|ref|ZP_05152885.1| penicillin-binding protein [Brucella abortus bv. 6 str. 870]
 gi|254697773|ref|ZP_05159601.1| penicillin-binding protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702158|ref|ZP_05163986.1| penicillin-binding protein [Brucella suis bv. 5 str. 513]
 gi|254704695|ref|ZP_05166523.1| penicillin-binding protein [Brucella suis bv. 3 str. 686]
 gi|254708109|ref|ZP_05169937.1| penicillin-binding protein [Brucella pinnipedialis M163/99/10]
 gi|254710478|ref|ZP_05172289.1| penicillin-binding protein [Brucella pinnipedialis B2/94]
 gi|254714471|ref|ZP_05176282.1| penicillin-binding protein [Brucella ceti M644/93/1]
 gi|254717369|ref|ZP_05179180.1| penicillin-binding protein [Brucella ceti M13/05/1]
 gi|254730662|ref|ZP_05189240.1| penicillin-binding protein [Brucella abortus bv. 4 str. 292]
 gi|256031972|ref|ZP_05445586.1| penicillin-binding protein [Brucella pinnipedialis M292/94/1]
 gi|256061494|ref|ZP_05451638.1| penicillin-binding protein [Brucella neotomae 5K33]
 gi|256160171|ref|ZP_05457865.1| penicillin-binding protein [Brucella ceti M490/95/1]
 gi|256255377|ref|ZP_05460913.1| penicillin-binding protein [Brucella ceti B1/94]
 gi|256257881|ref|ZP_05463417.1| penicillin-binding protein [Brucella abortus bv. 9 str. C68]
 gi|256369853|ref|YP_003107364.1| cell division protein/penicillin-binding protein [Brucella microti
           CCM 4915]
 gi|260169109|ref|ZP_05755920.1| cell division protein/penicillin-binding protein [Brucella sp.
           F5/99]
 gi|260546872|ref|ZP_05822611.1| penicillin-binding protein [Brucella abortus NCTC 8038]
 gi|260566058|ref|ZP_05836528.1| penicillin-binding protein [Brucella suis bv. 4 str. 40]
 gi|260755159|ref|ZP_05867507.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758378|ref|ZP_05870726.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260762204|ref|ZP_05874547.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884172|ref|ZP_05895786.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261219200|ref|ZP_05933481.1| peptidoglycan glycosyltransferase [Brucella ceti M13/05/1]
 gi|261222579|ref|ZP_05936860.1| peptidoglycan glycosyltransferase [Brucella ceti B1/94]
 gi|261315612|ref|ZP_05954809.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261318050|ref|ZP_05957247.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis B2/94]
 gi|261322261|ref|ZP_05961458.1| peptidoglycan glycosyltransferase [Brucella ceti M644/93/1]
 gi|261325501|ref|ZP_05964698.1| peptidoglycan glycosyltransferase [Brucella neotomae 5K33]
 gi|261752728|ref|ZP_05996437.1| peptidoglycan glycosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261755388|ref|ZP_05999097.1| peptidoglycan glycosyltransferase [Brucella suis bv. 3 str. 686]
 gi|261758616|ref|ZP_06002325.1| penicillin-binding protein [Brucella sp. F5/99]
 gi|265989081|ref|ZP_06101638.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|265998544|ref|ZP_06111101.1| peptidoglycan glycosyltransferase [Brucella ceti M490/95/1]
 gi|297248717|ref|ZP_06932435.1| cell division protein FtsI (penicillin binding protein 3) [Brucella
           abortus bv. 5 str. B3196]
 gi|23348285|gb|AAN30350.1| penicillin-binding protein [Brucella suis 1330]
 gi|62196462|gb|AAX74762.1| penicillin-binding protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616355|emb|CAJ11412.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A
           (P-loop):Penicillin-bi [Brucella melitensis biovar
           Abortus 2308]
 gi|161336196|gb|ABX62501.1| Penicillin-binding protein 2 [Brucella canis ATCC 23365]
 gi|189020135|gb|ACD72857.1| penicillin-binding protein [Brucella abortus S19]
 gi|237789135|gb|EEP63346.1| Penicillin-binding protein 2 [Brucella abortus str. 2308 A]
 gi|256000016|gb|ACU48415.1| cell division protein/penicillin-binding protein [Brucella microti
           CCM 4915]
 gi|260095922|gb|EEW79799.1| penicillin-binding protein [Brucella abortus NCTC 8038]
 gi|260155576|gb|EEW90656.1| penicillin-binding protein [Brucella suis bv. 4 str. 40]
 gi|260668696|gb|EEX55636.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672636|gb|EEX59457.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675267|gb|EEX62088.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260873700|gb|EEX80769.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260921163|gb|EEX87816.1| peptidoglycan glycosyltransferase [Brucella ceti B1/94]
 gi|260924289|gb|EEX90857.1| peptidoglycan glycosyltransferase [Brucella ceti M13/05/1]
 gi|261294951|gb|EEX98447.1| peptidoglycan glycosyltransferase [Brucella ceti M644/93/1]
 gi|261297273|gb|EEY00770.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis B2/94]
 gi|261301481|gb|EEY04978.1| peptidoglycan glycosyltransferase [Brucella neotomae 5K33]
 gi|261304638|gb|EEY08135.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261738600|gb|EEY26596.1| penicillin-binding protein [Brucella sp. F5/99]
 gi|261742481|gb|EEY30407.1| peptidoglycan glycosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261745141|gb|EEY33067.1| peptidoglycan glycosyltransferase [Brucella suis bv. 3 str. 686]
 gi|262553168|gb|EEZ09002.1| peptidoglycan glycosyltransferase [Brucella ceti M490/95/1]
 gi|264661278|gb|EEZ31539.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|297175886|gb|EFH35233.1| cell division protein FtsI (penicillin binding protein 3) [Brucella
           abortus bv. 5 str. B3196]
          Length = 607

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|225627888|ref|ZP_03785924.1| Penicillin-binding protein 2 [Brucella ceti str. Cudo]
 gi|225617051|gb|EEH14097.1| Penicillin-binding protein 2 [Brucella ceti str. Cudo]
          Length = 603

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 14  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 70

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 71  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 127

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 128 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 187

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 188 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 247

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 248 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 307

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 308 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 367

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 368 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 427

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 428 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 487

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 488 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 547

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 548 LNAAPMVAEIIRRSASFLGVSPDFRK 573


>gi|306844336|ref|ZP_07476928.1| penicillin-binding protein [Brucella sp. BO1]
 gi|306275408|gb|EFM57149.1| penicillin-binding protein [Brucella sp. BO1]
          Length = 607

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGDVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|163843693|ref|YP_001628097.1| penicillin-binding protein 2 [Brucella suis ATCC 23445]
 gi|163674416|gb|ABY38527.1| Penicillin-binding protein 2 [Brucella suis ATCC 23445]
          Length = 607

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDENLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|294852763|ref|ZP_06793436.1| cell division protein FtsI [Brucella sp. NVSL 07-0026]
 gi|294821352|gb|EFG38351.1| cell division protein FtsI [Brucella sp. NVSL 07-0026]
          Length = 607

 Score =  540 bits (1390), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 268/566 (47%), Positives = 373/566 (65%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G   I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGSQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|254719468|ref|ZP_05181279.1| penicillin-binding protein [Brucella sp. 83/13]
 gi|265984474|ref|ZP_06097209.1| peptidoglycan glycosyltransferase [Brucella sp. 83/13]
 gi|306839247|ref|ZP_07472064.1| penicillin-binding protein [Brucella sp. NF 2653]
 gi|264663066|gb|EEZ33327.1| peptidoglycan glycosyltransferase [Brucella sp. 83/13]
 gi|306405794|gb|EFM62056.1| penicillin-binding protein [Brucella sp. NF 2653]
          Length = 607

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPSGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEV++M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVLAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|306843216|ref|ZP_07475827.1| penicillin-binding protein [Brucella sp. BO2]
 gi|306286581|gb|EFM58158.1| penicillin-binding protein [Brucella sp. BO2]
          Length = 603

 Score =  539 bits (1389), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/566 (47%), Positives = 374/566 (66%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 14  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 70

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 71  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 127

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 128 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 187

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 188 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 247

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEV++M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 248 MERYRAIAAGAVVLNVKTGEVLAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 307

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 308 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 367

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 368 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 427

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 428 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 487

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 488 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 547

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 548 LNAAPMVAEIIRRSASFLGVSPDFRK 573


>gi|225852919|ref|YP_002733152.1| penicillin-binding protein 2 [Brucella melitensis ATCC 23457]
 gi|256113990|ref|ZP_05454773.1| Penicillin-binding protein 2 [Brucella melitensis bv. 3 str. Ether]
 gi|256263600|ref|ZP_05466132.1| penicillin-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|265995332|ref|ZP_06107889.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|225641284|gb|ACO01198.1| Penicillin-binding protein 2 [Brucella melitensis ATCC 23457]
 gi|262766445|gb|EEZ12234.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093651|gb|EEZ17656.1| penicillin-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409461|gb|ADZ66526.1| penicillin-binding protein 2 [Brucella melitensis M28]
 gi|326539167|gb|ADZ87382.1| penicillin-binding protein 2 [Brucella melitensis M5-90]
          Length = 607

 Score =  539 bits (1388), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/566 (47%), Positives = 373/566 (65%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+  TPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMATPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|17986856|ref|NP_539490.1| penicillin-binding protein 2 [Brucella melitensis bv. 1 str. 16M]
 gi|256045067|ref|ZP_05447968.1| penicillin-binding protein 2 [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565334|ref|ZP_05835818.1| penicillin-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991494|ref|ZP_06104051.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17982493|gb|AAL51754.1| penicillin-binding protein 2 [Brucella melitensis bv. 1 str. 16M]
 gi|260151402|gb|EEW86496.1| penicillin-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002278|gb|EEZ14853.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 607

 Score =  538 bits (1387), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/566 (47%), Positives = 373/566 (65%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+  TPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMATPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSGRRA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|148559272|ref|YP_001259330.1| penicillin-binding protein [Brucella ovis ATCC 25840]
 gi|148370529|gb|ABQ60508.1| penicillin-binding protein [Brucella ovis ATCC 25840]
          Length = 607

 Score =  536 bits (1382), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 267/566 (47%), Positives = 373/566 (65%), Gaps = 16/566 (2%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIG--- 74

Query: 103 IAPSMNIDEYG------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV 156
               ++ D  G       SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  V
Sbjct: 75  ---GVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTV 131

Query: 157 LPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASH 216
           LP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH
Sbjct: 132 LPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASH 191

Query: 217 VVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-KNLQPIRLALDLRIQNIVHQELVEN 275
           ++G V++DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+ 
Sbjct: 192 ILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKA 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K 
Sbjct: 252 MERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKS 311

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT AM +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + AD
Sbjct: 312 FTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREAD 371

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           A+GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV 
Sbjct: 372 AVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVG 431

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVP 513
           AAAL+N G+LI PTF+ R+  ++ + S+ V+       MR L R   T  GGSG RA VP
Sbjct: 432 AAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGWRATVP 491

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAG 572
           G+ VGGKTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E +   TAG
Sbjct: 492 GYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAG 551

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
           +N APMV  IIRRSAS LGV P F K
Sbjct: 552 LNAAPMVAEIIRRSASFLGVSPDFRK 577


>gi|222109144|ref|YP_002551409.1| penicillin-binding protein [Agrobacterium vitis S4]
 gi|221738418|gb|ACM39283.1| penicillin-binding protein [Agrobacterium vitis S4]
          Length = 585

 Score =  528 bits (1361), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 256/543 (47%), Positives = 361/543 (66%), Gaps = 16/543 (2%)

Query: 69  HSKNRIGMTIVVCL----VIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM-SRPDIIDRN 123
           H  N     I+V +    V+Y ++  R++QYG   P  +  S++   +G+ SRPDI+DRN
Sbjct: 32  HKGNEARQRILVLMGGFCVLYTVIGARLVQYGTASPL-VTSSISAPGFGIASRPDIVDRN 90

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           GE+LATD+   SLY EP K++  DE +EKL  V+  +D     +KL S++ FQWLRR+L+
Sbjct: 91  GELLATDLNMVSLYAEPRKIVDIDEAVEKLSTVIKGIDWADTYKKLQSKSAFQWLRRRLT 150

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
           P+QQ  IL+ G+PG+GFR EK RFYP  + A+H++G+V+IDN+G+ G+E+++D QGL  +
Sbjct: 151 PRQQADILALGIPGIGFRPEKQRFYPGGATAAHILGHVNIDNKGLAGMERYIDQQGLADL 210

Query: 244 FTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                    +L P+RL++DLR+QNIVH  + E    Y AE+ G V+L+  TGE+++M S+
Sbjct: 211 RAAGLTDNAHLDPVRLSIDLRVQNIVHDVIAEAMINYKAEAAGAVVLDAETGEILAMASV 270

Query: 303 PDYDPHEAF---------KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           PDY+P+E           K  ++GWFNR+S   +EMGS FK FT+AMG+D G   +  + 
Sbjct: 271 PDYNPNEPSRTLPDGSVDKEYEKGWFNRMSNATYEMGSTFKSFTLAMGLDEGKIGLNSVL 330

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D   PIK+G   IHD H Q R LT+PE+F+YSSNIG A+IA  + ++ H+ FL +LGLLS
Sbjct: 331 DASRPIKMGGFTIHDDHGQGRPLTVPEVFQYSSNIGTAKIATMVNLKDHQAFLTKLGLLS 390

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           K+ TELPE+  P+ P  WK ++ +TISFGHG++TTPLQTAVA AALIN G+L  PTF+ R
Sbjct: 391 KMTTELPEVATPTQPRVWKPLNQVTISFGHGVATTPLQTAVAGAALINGGKLFSPTFLAR 450

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           S +E++ V + V++  T   MR L       GSGR A V GF VGGKTGTA KVI  +Y+
Sbjct: 451 SPDEADVVVKQVIQPKTSADMRYLFHWNGIKGSGRNAQVQGFNVGGKTGTADKVINGKYA 510

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
             LNFN++LA FP   P+Y+VL+ +D+P   E+    A    APM   +I RSA++LGV+
Sbjct: 511 AHLNFNAYLAGFPIDKPRYVVLTVIDAPLTGEKGGRLAAYTAAPMAKEVISRSAALLGVQ 570

Query: 594 PVF 596
           P F
Sbjct: 571 PRF 573


>gi|222080855|ref|YP_002540218.1| cell division penicillin-binding protein [Agrobacterium radiobacter
           K84]
 gi|221725534|gb|ACM28623.1| cell division penicillin-binding protein [Agrobacterium radiobacter
           K84]
          Length = 573

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/546 (47%), Positives = 368/546 (67%), Gaps = 15/546 (2%)

Query: 62  RRRKVIA------HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM- 114
           RRR ++A       +K+RI     V  + Y+ +  +++ + +   +P   + NI    + 
Sbjct: 24  RRRNIVASGRKNRQAKSRILTLAGVLTMAYLAICGKLVYFDS---QPAVDTANIPSGPVI 80

Query: 115 -SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE- 172
             RPDI+DRNGE+LATDI T S++ EP  ++  DE +EKL  + P+LD + + +KLS + 
Sbjct: 81  AWRPDIVDRNGELLATDIRTVSMFAEPFHIVDVDEAVEKLSTLFPDLDKKTLYQKLSDKR 140

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
           + F WLRR+L+P+QQ  +L  G+P +GFR E  RFYP    A+H++GYVDIDN G+ GIE
Sbjct: 141 SHFAWLRRQLTPKQQNEVLGLGIPAIGFRPEVKRFYPGGRTAAHILGYVDIDNHGVAGIE 200

Query: 233 KFLDMQGLTRVFTTNKGEKN-LQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           K+LD QGL+ + +     ++ LQP+ L++DLR+QNIVH  + +   +Y A+S G VIL++
Sbjct: 201 KYLDGQGLSDLTSAGMTSRDSLQPVHLSIDLRVQNIVHDVVSDAIGQYQAQSAGAVILDI 260

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++M S PD+DP++  +   +GW NR+S G  EMGS+FK F+IAM ID+G   + D
Sbjct: 261 HTGEVLAMASAPDFDPNDP-QADIKGWLNRMSDGTDEMGSVFKTFSIAMAIDTGTVKLTD 319

Query: 352 LFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FD   P+  G   IHD      R LT+PEIFRYSSNIG A+I D +G+   K +L R G
Sbjct: 320 TFDASAPLHYGGFTIHDDRDVPRRWLTVPEIFRYSSNIGTAKIMDKVGMDVQKTYLTRFG 379

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           LLS+++TELPE++APS P  WK+I+S+TI+FGHG++TTP+QTAVA AALI+ G LI PTF
Sbjct: 380 LLSRMQTELPEVKAPSQPKVWKKINSITIAFGHGVATTPMQTAVAGAALIDGGELIEPTF 439

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           + R+REE+EK  ++V+KK+T   +R L +     G+G+ A VPGF VGGKTGTA KVI  
Sbjct: 440 LPRTREEAEKTEKMVVKKSTSDVIRYLFKLNGEQGTGKTADVPGFHVGGKTGTANKVING 499

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASML 590
            YS  L+FNSFLA FP  +P+Y+VLSF+D P     N   A    APMV +I+ R+A +L
Sbjct: 500 VYSHKLSFNSFLAAFPMENPRYVVLSFIDQPLTGLHNLNLAAETAAPMVHDIVSRAAPLL 559

Query: 591 GVKPVF 596
           GV+P F
Sbjct: 560 GVEPNF 565


>gi|114704928|ref|ZP_01437836.1| probable penicillin-binding transmembrane protein [Fulvimarina
           pelagi HTCC2506]
 gi|114539713|gb|EAU42833.1| probable penicillin-binding transmembrane protein [Fulvimarina
           pelagi HTCC2506]
          Length = 575

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 254/538 (47%), Positives = 366/538 (68%), Gaps = 8/538 (1%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R   +  +K+R  + I++ + +Y ++  R++ +G +  E I      D+   SRPD++DR
Sbjct: 27  RLSAVPGNKSRFVIAIMLFIGVYAVIGARLVTWGTVPNERITAFRAADQIMASRPDLVDR 86

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NG++LATDI   SL+ EP K++  +E  E L  VLP+L+ + +   LSS+  F WLRR+L
Sbjct: 87  NGQVLATDIKVASLFAEPKKIVDANEASELLLSVLPDLEPKWLYDNLSSDAGFLWLRREL 146

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +P QQ+ IL  G+PG+GFR EK RFYP    A  V G+V++DN+GI G+EK+LD QG   
Sbjct: 147 TPSQQQAILDLGVPGIGFRTEKKRFYPGGPTAGFVTGHVNVDNQGIAGMEKYLDDQGYLA 206

Query: 243 VFTTNKG---EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
           +   N G   +  ++P+ L++DLR+Q+I+  EL     +Y + + G V+L+V TGEVI+M
Sbjct: 207 L--QNSGLAIDAEMEPVALSIDLRVQHILRDELAAAMTRYRSIAAGGVVLDVKTGEVIAM 264

Query: 300 VSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPI 359
            S+PDYDP++  +  ++   NR S G+FEMGS FK FT AM +DSG   ++  FD   PI
Sbjct: 265 TSLPDYDPNDPKQALEKDRMNRTSAGLFEMGSTFKAFTSAMALDSGEANLQSRFDASKPI 324

Query: 360 KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETEL 419
            +G H I D+H ++R+LT+ E+F YSSNIG+A+ A+ +GIQGH++FL R+GLL+KL TEL
Sbjct: 325 YIGGHRISDFHGKHRVLTLEEVFIYSSNIGSAKEAEIVGIQGHQDFLTRMGLLTKLPTEL 384

Query: 420 PEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE 479
           PE+  P+ P +WK+++S+TIS+GHG+STTPLQTAVAAAAL+N G  IPPTFM R  +++ 
Sbjct: 385 PEVATPTQPKEWKQVNSITISYGHGVSTTPLQTAVAAAALVNGGVWIPPTFMPRGEDDAM 444

Query: 480 KVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN 537
            +++ V+   T   MR L R  V    GSG  A + G+ VGGKTGTA KV   RYS+T  
Sbjct: 445 VLAKQVVSPKTSADMRHLFRLNVEDQRGSGNYAEIDGYGVGGKTGTANKVENGRYSNTKK 504

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           FN+FL+ FP  DP+Y+VL F+D PK +  +   TAG+N AP VGN+IRR+A++L VKP
Sbjct: 505 FNAFLSAFPMDDPRYVVLVFIDEPKPEPGKYYATAGMNAAPTVGNVIRRAAALLKVKP 562


>gi|307944900|ref|ZP_07660237.1| penicillin-binding protein, transpeptidase [Roseibium sp.
           TrichSKD4]
 gi|307771824|gb|EFO31048.1| penicillin-binding protein, transpeptidase [Roseibium sp.
           TrichSKD4]
          Length = 571

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 252/532 (47%), Positives = 355/532 (66%), Gaps = 9/532 (1%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNI-DEYGMSRPDIIDRNGEILAT 129
           K+R+   +    +IY+ +  R++Q   +   P +  ++  D    SRPD++DRNGEILAT
Sbjct: 32  KSRVFFAMAAFAMIYVAMGARLVQLAQMEEAPSSAWISAQDTIAASRPDLLDRNGEILAT 91

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T SLY EP +++  DE  E +  +LP LD+  IRR+L S+  F WL+R+++P Q  +
Sbjct: 92  DIKTASLYAEPRRILDIDETYEGITRILPELDTPTIRRRLESKAGFVWLKREITPAQADQ 151

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV----FT 245
           I   GLPGVGF  E  RFYP    A H+VG V++DN+G+ G+EK++D QGL  +    FT
Sbjct: 152 IHDLGLPGVGFLSENQRFYPGGPTAGHIVGSVNVDNQGLAGVEKYIDGQGLADLQSVGFT 211

Query: 246 TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
           T+K    ++P+ LA+DLR+Q++V  ELV+  ++Y A +   ++L+V TGEVI+M S+PDY
Sbjct: 212 TDKA---MEPVSLAVDLRVQHVVRDELVKAMERYKAIAAVGIVLDVHTGEVIAMSSLPDY 268

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP++  +  ++   NR + G+FEMGS+FK FT AM +DSG  +V D FD   PI+     
Sbjct: 269 DPNDRAQALEKDRLNRATGGVFEMGSVFKAFTTAMALDSGRVSVNDSFDATRPIRAAGRT 328

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           I D+H +NRIL++PEIF YSSNIG A++  A G+   +EFL R+GL ++L+TELPE  AP
Sbjct: 329 ISDFHGKNRILSVPEIFIYSSNIGTAKMMLATGVSKQQEFLGRIGLTNRLKTELPENAAP 388

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  + ++TISFGHG+S TP+QTAVAAAA++N G+LIPPTF  R + E+E++   V
Sbjct: 389 LLPPRWNDLAAMTISFGHGISVTPMQTAVAAAAMVNGGKLIPPTFFPREQAEAEELGTQV 448

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +     K MR L R  V  GSG+R+ VPG+ VGGKTGTA+K+   RY      NSFL+ F
Sbjct: 449 ISPQVSKVMRYLFRLNVLSGSGKRSEVPGYVVGGKTGTAEKIENGRYVSNKRRNSFLSAF 508

Query: 546 PTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           P  DP+Y+VL  +D PK + +    TAG+N AP VG IIRR+A MLGV P F
Sbjct: 509 PMNDPKYVVLVVIDEPKPERKGIGATAGLNAAPTVGAIIRRAAPMLGVLPRF 560


>gi|118590898|ref|ZP_01548298.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [Stappia aggregata
           IAM 12614]
 gi|118436420|gb|EAV43061.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [Stappia aggregata
           IAM 12614]
          Length = 570

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 249/535 (46%), Positives = 361/535 (67%), Gaps = 11/535 (2%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNI-DEYGMSRPDIIDRNGEILAT 129
           K+R+ + ++    +Y+ +A R++    +   P    ++  D    SRPD++DRNGEILAT
Sbjct: 31  KSRVYVAMLAFACVYVAIAGRLVMLAQMEEAPSHAWISAQDSVAASRPDLVDRNGEILAT 90

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T SLY EP +++  DE +E L  +LP+L+  ++RR+L S   F WL+R+++PQQ +R
Sbjct: 91  DIKTASLYAEPRRIMDVDEAVEGLIRILPDLNEGLVRRRLESGAGFVWLKREMTPQQAER 150

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV----FT 245
           + + GLPG+GF  E  RFYP    A H+VG V++DN+G+ GIEK++D   L  +    FT
Sbjct: 151 VHNLGLPGIGFLSENQRFYPGGPTAGHIVGSVNVDNQGLAGIEKYIDDSWLRDLQSLGFT 210

Query: 246 TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
           +++    ++P++L++DLR+Q++V  ELV+  ++Y A +   ++L+  TGEV++M S+PDY
Sbjct: 211 SDR---TMEPVKLSVDLRVQHVVRDELVKAMERYKAIAAAGIVLDAKTGEVVAMSSLPDY 267

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP++  +  ++   NR + G+FEMGS+FK FT AM +DSG  ++ D FD   PI+ G   
Sbjct: 268 DPNDRSQALEKDRLNRATGGVFEMGSVFKTFTTAMALDSGAVSINDSFDATRPIRAGGRT 327

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           I D+H ++RIL++PEIF YSSNIG A++  A GI   ++FL RL L  +L+TELPE  AP
Sbjct: 328 ISDFHGKHRILSVPEIFIYSSNIGTAKMMLATGIARQQDFLKRLHLTDRLQTELPENAAP 387

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  + ++TISFGHG+S TP+QTAVAAAAL+N G L+PPTF+ RS E+ +K+ + V
Sbjct: 388 LLPPKWNELAAMTISFGHGISVTPMQTAVAAAALVNGGTLLPPTFLPRSPEDVQKLGKQV 447

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +   T + MR L R  V  GSGRRA VPG+ VGGKTGTA+K+   RY      NSFL+ F
Sbjct: 448 VSPETSRIMRYLFRLNVLSGSGRRADVPGYTVGGKTGTAEKIENGRYVSNKRRNSFLSAF 507

Query: 546 PTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           P  DP+Y+VL  +D PK  ER  +  TAG+N APMVG I+RR+A MLGV P F K
Sbjct: 508 PMDDPRYVVLVVIDEPK-PEREGIGATAGLNAAPMVGAIVRRAAPMLGVMPRFSK 561


>gi|163868719|ref|YP_001609931.1| cell division protein/penicillin-binding protein [Bartonella
           tribocorum CIP 105476]
 gi|161018378|emb|CAK01936.1| Cell division protein/penicillin-binding protein [Bartonella
           tribocorum CIP 105476]
          Length = 580

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/539 (47%), Positives = 361/539 (66%), Gaps = 17/539 (3%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYG-------MSRPDIIDR 122
           S+ R+  ++   L++Y I+   +I YG            I+E         M+RPDI+DR
Sbjct: 31  SRPRLLFSLFCFLILYGIMGACLISYG-------VEGGQIEEARGPGVLPLMARPDIVDR 83

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NG +LATDI T+SL+ EP ++I  DE IE L  VLP+L+ +   ++L  +T F W++R L
Sbjct: 84  NGRLLATDIKTYSLFAEPRRIIDVDETIELLSTVLPDLNWQETYKRLKRKTGFSWIQRGL 143

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +P Q+ +I++ G+PG+GFR E  RFYP     SH++G V++DN+GI G+EK++D  GL+ 
Sbjct: 144 TPMQKTQIMALGIPGIGFRTEIRRFYPDGPITSHILGMVNVDNQGIAGMEKYIDDTGLSA 203

Query: 243 VFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
           +       E++L+ + L++D+R+Q IVH EL++  K+Y A + G VILN+ TGEV+++ S
Sbjct: 204 LRAAGLAMEESLKQVHLSIDVRVQAIVHDELIQAMKRYKAIAAGAVILNIHTGEVLALAS 263

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +PD+DP    +  K    NR++ G FEMGSI K FT AM +DS +F +  + D   PIK 
Sbjct: 264 LPDFDPGNPIEALKSDRLNRMTAGTFEMGSIIKSFTTAMALDSNIFHLNSIIDASKPIKA 323

Query: 362 GK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
              + IHD+H +NR LT+ E+F YSSNIG+A+ A A+GI  H++FL +LGLL +L TELP
Sbjct: 324 SSGYTIHDFHGKNRPLTLWEVFIYSSNIGSAKEALAIGIDKHRDFLQKLGLLDRLTTELP 383

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           EI  P  P  WK IHS+TISFGHG++TTPLQTAV AAAL+N G LI PTF+ R++E++  
Sbjct: 384 EIAHPIVPHHWKDIHSMTISFGHGMATTPLQTAVGAAALMNGGWLIAPTFLKRTKEQTLH 443

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
            ++ VL+  T + MR L +     GSGR A V G+ VGGKTGTA+KV   +YS T NFNS
Sbjct: 444 HAKQVLQAKTSQNMRYLYQLNSDIGSGRNAKVEGYRVGGKTGTAEKVENGKYSKTKNFNS 503

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           FLA FP  DP Y+VL+ +D PK +E +N  TAG+N  PM+ NI+RRSAS LGVKP F K
Sbjct: 504 FLAAFPIDDPAYVVLTIIDEPKPEEGKNSATAGMNAGPMLANIVRRSASFLGVKPDFKK 562


>gi|304392261|ref|ZP_07374203.1| penicillin-binding protein 2 [Ahrensia sp. R2A130]
 gi|303296490|gb|EFL90848.1| penicillin-binding protein 2 [Ahrensia sp. R2A130]
          Length = 578

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 253/543 (46%), Positives = 364/543 (67%), Gaps = 10/543 (1%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN---IHPEP-IAPSMNIDEYGMSR 116
           +RR  +   +++R+ + +   + ++ I+  R++         P   I   M I+    +R
Sbjct: 26  RRREDLATQTRDRLIVVMCGVVAVFSIIQGRLVYLAADDVTGPRARIGADMAIEA---TR 82

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
           P I+DRNG+++A DI T SL+ EP  +    E  + L  VLP+L  E + ++L  +  F 
Sbjct: 83  PRILDRNGQVMALDIETQSLFAEPKLIERAQETYDMLATVLPDLPEEKLVKRLKGDAGFI 142

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L+P+QQ  IL+ GLPG+GFR E  R+YP  + ASH++G+ +IDN+GI GIEK LD
Sbjct: 143 WVKRELTPRQQADILALGLPGIGFRPETKRYYPGGATASHILGHTNIDNQGIAGIEKHLD 202

Query: 237 MQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
              L        G +K L+P++L++D+R+Q+ V Q LV   +KY A +   V+L+ +TGE
Sbjct: 203 DSWLRDFHAAGFGVKKELKPVQLSVDMRVQHFVRQALVTAMEKYRAIAAAGVVLDANTGE 262

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           VI+M S+PDYDP+      K+   NR+S G+FEMGS FK FT AM +DSG   ++  FD 
Sbjct: 263 VIAMSSLPDYDPNNPVDALKKDRLNRMSAGLFEMGSTFKTFTTAMALDSGKVNLRSRFDA 322

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
             P+++G+  I+D+H + R+L++PE+F YSSNIG A++AD +GI GHKEFL R+GLL K+
Sbjct: 323 TKPLRIGRFTINDFHGKRRVLSVPEVFIYSSNIGTAKMADVVGIPGHKEFLTRIGLLDKM 382

Query: 416 ET-ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
           +  ELPE+  P+ P +WK+++S+TIS+GHG+STTPLQTAVAAA+L+N GRLIPPT   RS
Sbjct: 383 QGFELPEVAKPTQPKKWKKVNSITISYGHGVSTTPLQTAVAAASLVNGGRLIPPTLFPRS 442

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSD 534
            + +    + VLK  T   MR L+R  V  GSG+R+ VPGF VGGKTGTA+KV+  RYS+
Sbjct: 443 ADAAAMAGKQVLKPQTTDAMRYLMRLNVLKGSGKRSDVPGFLVGGKTGTAEKVVNGRYSN 502

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKI-KERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              FN+FLA FP  DP+YIVL  +D PK  K +   TAG+N AP+VG I+RRSA +LGV+
Sbjct: 503 DKRFNAFLATFPVNDPRYIVLVIVDEPKPEKGKKYATAGMNAAPVVGEIVRRSAPLLGVE 562

Query: 594 PVF 596
           P F
Sbjct: 563 PDF 565


>gi|49474462|ref|YP_032504.1| penicillin-binding protein [Bartonella quintana str. Toulouse]
 gi|49239966|emb|CAF26371.1| Penicillin-binding protein [Bartonella quintana str. Toulouse]
          Length = 580

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/533 (48%), Positives = 364/533 (68%), Gaps = 5/533 (0%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM-SRPDIIDRNGEILA 128
           ++ R+  +++  L++Y ++   +I YG +    I  +       + +RPDIIDRNG +LA
Sbjct: 31  ARPRLLFSLLCFLILYGVIGACLISYG-LEGGQIEEAKGPGVLQLTARPDIIDRNGRLLA 89

Query: 129 TDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQK 188
           TDI T+SL+ EP +VI  DE IE L  VL +L+     ++L  ++ F W++R L+P Q+ 
Sbjct: 90  TDIKTYSLFAEPRRVIDVDETIELLSTVLSDLNWHETYKRLKRKSGFSWIQRGLTPTQKA 149

Query: 189 RILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNK 248
           +I++ G+PG+GFR E  RFYP  S ASH++G V++DN+GI G+EK++D  GL+ + +   
Sbjct: 150 QIMALGIPGIGFRPEIRRFYPGGSVASHILGMVNVDNQGIAGMEKYIDDAGLSALRSAGL 209

Query: 249 G-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDP 307
             E+ L+PI+L++D+RIQ IVH EL++  K+Y A + G VILN+ T EV++MVS+PD+DP
Sbjct: 210 ATEEALKPIQLSIDVRIQAIVHDELIKAMKRYKAIAAGAVILNIHTNEVLAMVSVPDFDP 269

Query: 308 HEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK-HVI 366
                  K    NRI+ G FEMGSI K FT AM +DS +F +  L D   PI+    ++I
Sbjct: 270 GNPVDALKSDRLNRITAGAFEMGSIMKSFTTAMALDSDMFHLNSLIDASKPIQASSGYII 329

Query: 367 HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS 426
           HD+H +NR LT+ E+F YSSNIG+A+ A A+GI+ H+ FL +LGLL +L TELPE+  P 
Sbjct: 330 HDFHGKNRPLTLWEVFIYSSNIGSAKEALAIGIEKHRAFLKKLGLLDRLTTELPEVTHPI 389

Query: 427 YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVL 486
            P  WK IHS+TISFGHG++TTPLQTAV AAAL+N G LI PTF+ R++E++ K ++ VL
Sbjct: 390 VPRHWKDIHSMTISFGHGMATTPLQTAVGAAALMNGGWLIAPTFLKRTKEQALKQAKQVL 449

Query: 487 KKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFP 546
           +  T + MR L +     GSGR A V G+ VGGKTGTA+KV   +YS T NFNSFLA FP
Sbjct: 450 QAKTSQNMRYLYKLNSDIGSGRNAKVEGYRVGGKTGTAEKVENGKYSKTKNFNSFLAAFP 509

Query: 547 TTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             DP Y+VL+ +D PK ++ +   TAG+N  PM+ NI+RRSAS LG+KP F K
Sbjct: 510 IEDPAYVVLTIIDEPKPEDGKYAATAGLNAGPMLSNIVRRSASFLGIKPDFKK 562


>gi|319407509|emb|CBI81157.1| Cell division protein/penicillin-binding protein [Bartonella sp.
           1-1C]
          Length = 583

 Score =  508 bits (1308), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/487 (49%), Positives = 343/487 (70%), Gaps = 3/487 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SRPDI+DRNG +LA DI T+SL+ EP ++I  DE IE +  VLP L+ + + ++L   + 
Sbjct: 76  SRPDIVDRNGRLLAKDITTYSLFAEPRRIIDVDETIELISTVLPKLNWQEVHKRLKRNSG 135

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P Q+ +I+  G+PG+GFR E  RFYP  S ASH++G V++DN+G+ G+EK+
Sbjct: 136 FSWIQRGLTPTQKAQIMELGIPGIGFRTEIRRFYPGGSIASHILGMVNVDNQGLAGMEKY 195

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           +D  GL+ +  T    E++L+P++L++D+R+Q IVH EL+E  K+Y A + G +ILN+ T
Sbjct: 196 IDDNGLSVLRATGLATEESLKPVQLSIDIRVQAIVHDELMEAMKRYRAIAAGAIILNIYT 255

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GEV+++ S+PD+ P       K   FNR++ G FEMGSI K FT AM +DSGLF +  + 
Sbjct: 256 GEVLALASVPDFSPANPVDALKSDRFNRMTAGTFEMGSIIKSFTTAMALDSGLFDLNSII 315

Query: 354 DTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           D   PI+  + H I D+H +NR+L + E+F YSSNIG+A+ A A+G+ GH+ FL RLGLL
Sbjct: 316 DASQPIQASRNHFIRDFHGKNRLLKLWEVFIYSSNIGSAKEALAIGVDGHRNFLKRLGLL 375

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
            ++ TELPE+  P YP  WK I+S+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ 
Sbjct: 376 ERISTELPEVAQPIYPHYWKDINSMTISFGHGMATTPLQTAVAAAALMNSGLLIDPTFLK 435

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           RS++E+ K ++ VL   T + MR L +     GSGR A V G+ +GGKTGT++KV   +Y
Sbjct: 436 RSKKEALKYAKQVLHPQTSQDMRYLYKLNSDIGSGRNAKVVGYRIGGKTGTSEKVENGKY 495

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLG 591
           S   NFNSFLA FP  +P YIVL+ +D PK ++ ++  TA +N APM+ NIIRRSA  LG
Sbjct: 496 SKVKNFNSFLAAFPIDNPSYIVLTIIDEPKPEDGKHSATAAMNAAPMLANIIRRSAIFLG 555

Query: 592 VKPVFLK 598
           ++P F K
Sbjct: 556 IEPDFKK 562


>gi|319404516|emb|CBI78121.1| Cell division protein/penicillin-binding protein [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 583

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 243/487 (49%), Positives = 343/487 (70%), Gaps = 3/487 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SRPDI+DRNG +LA DI T+SL+ EP ++I  DE IE +  VLP L+ + + ++L   + 
Sbjct: 76  SRPDIVDRNGRLLAKDITTYSLFAEPRRIIDVDETIELISTVLPKLNWQEVHKRLKRNSG 135

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P Q+ +I+  G+PG+GFR E  RFYP  S ASH++G V++DN+G+ G+EK+
Sbjct: 136 FSWIQRGLTPTQKAQIMELGIPGIGFRTEIRRFYPGGSIASHILGMVNVDNQGLAGMEKY 195

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           +D  GL+ +  T    E++L+P++L++D+R+Q IVH EL+E  K+Y A + G +ILN+ T
Sbjct: 196 IDDNGLSVLRATGLATEESLKPVQLSIDIRVQAIVHDELMEAMKRYRAIAAGAIILNIYT 255

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GEV+++ S+PD+ P       K   FNR++ G FEMGSI K FT AM +DSGLF +  + 
Sbjct: 256 GEVLALASVPDFSPANPVDALKSDRFNRMTAGTFEMGSIIKSFTTAMALDSGLFDLNSII 315

Query: 354 DTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           D   PI+  + H I D+H +NR+L + E+F YSSNIG+A+ A A+G+ GH+ FL RLGLL
Sbjct: 316 DASQPIQASRNHFIRDFHGKNRLLKLWEVFIYSSNIGSAREALAIGVDGHRNFLKRLGLL 375

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
            ++ TELPE+  P YP  WK I+S+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ 
Sbjct: 376 ERISTELPEVAQPIYPHYWKDINSMTISFGHGMATTPLQTAVAAAALMNSGLLIDPTFLK 435

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           RS++E+ K ++ VL   T + MR L +     GSGR A V G+ +GGKTGT++KV   +Y
Sbjct: 436 RSKKEALKYAKQVLHPQTSQDMRYLYKLNSDIGSGRNAKVVGYRIGGKTGTSEKVENGKY 495

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLG 591
           S   NFNSFLA FP  +P YIVL+ +D PK ++ ++  TA +N APM+ NIIRRSA  LG
Sbjct: 496 SKVKNFNSFLAAFPIDNPSYIVLTIIDEPKPEDGKHSATAAMNAAPMLANIIRRSAIFLG 555

Query: 592 VKPVFLK 598
           ++P F K
Sbjct: 556 IEPDFKK 562


>gi|319406012|emb|CBI79643.1| Cell division protein/penicillin-binding protein [Bartonella sp. AR
           15-3]
          Length = 583

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 241/483 (49%), Positives = 342/483 (70%), Gaps = 3/483 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SRPDI+DRNG +LA DI T+SL+ EP ++I  DE IE +  VLP L+ + + ++L   + 
Sbjct: 76  SRPDIVDRNGRLLAKDITTYSLFAEPRRIIDVDETIELISTVLPKLNWQEVHKRLKRNSG 135

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P Q+ +I+  G+PG+GFR E  RFYP  S ASH++G V++DN+G+ G+EK+
Sbjct: 136 FSWIQRGLTPTQKAQIMELGIPGIGFRTEIRRFYPGGSIASHILGMVNVDNQGLAGMEKY 195

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           +D  GL+ +  T    E++L+P++L++D+R+Q IVH EL+E  K+Y A + G +ILN+ T
Sbjct: 196 IDDNGLSILRATGLATEESLKPVQLSIDIRVQAIVHDELMEAMKRYKAIAAGAIILNIYT 255

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GEV+++ S+PD+ P       K   FNR++ G FEMGSI K FT AM +DSGLF +  + 
Sbjct: 256 GEVLALASVPDFSPANPVDALKSDRFNRMTAGTFEMGSIIKSFTTAMALDSGLFHLNSII 315

Query: 354 DTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           D   PI+  + H I D+H +NR+LT+ E+F YSSNIG+A+ A A+G+ GH++FL RLGLL
Sbjct: 316 DASQPIQASRNHFIRDFHGKNRLLTLWEVFIYSSNIGSAKEALAIGVDGHRDFLKRLGLL 375

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
            ++ TELPE+  P YP  WK I+S+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ 
Sbjct: 376 DRVSTELPEVAQPIYPHYWKDINSMTISFGHGMATTPLQTAVAAAALMNSGLLIDPTFLK 435

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           RS++E+ K ++ +L   T + MR L +     GSGR A V G+ +GGKTGT++KV   +Y
Sbjct: 436 RSKKEALKYAKQILHPQTSQDMRYLYKLNSDIGSGRNAKVIGYRIGGKTGTSEKVENGKY 495

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLG 591
           S   NFNSFLA FP   P YIVL+ +D PK ++ ++  TA +N APM+ NIIRRSA  LG
Sbjct: 496 SKVKNFNSFLAAFPIDSPSYIVLTVIDEPKPEDGKHSATAAMNAAPMLANIIRRSAIFLG 555

Query: 592 VKP 594
           ++P
Sbjct: 556 IEP 558


>gi|319899163|ref|YP_004159256.1| Cell division protein/penicillin-binding protein [Bartonella
           clarridgeiae 73]
 gi|319403127|emb|CBI76685.1| Cell division protein/penicillin-binding protein [Bartonella
           clarridgeiae 73]
          Length = 559

 Score =  504 bits (1299), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 248/487 (50%), Positives = 342/487 (70%), Gaps = 3/487 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SRPDI+DRNG +LA DI T+SL+ EP ++I  DE IE +  VLP L+ + + ++L   + 
Sbjct: 52  SRPDIVDRNGRLLAKDITTYSLFAEPRRIIDVDETIELISTVLPKLNWQEVYKRLKRNSG 111

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P Q+ +I+  G+PG+GFR E  RFYP  S ASH++G V++DN+G+ G+EK+
Sbjct: 112 FSWIQRGLTPTQKAQIMELGIPGIGFRTEIRRFYPGGSIASHILGMVNVDNQGLAGMEKY 171

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           +D  GL+ +  T    E++L+P++L++D+R+Q IVH EL+E  K+Y A + G VILN+ T
Sbjct: 172 IDDNGLSILRATGLATEESLRPVQLSIDVRVQAIVHDELMEAMKRYKAIAAGAVILNIHT 231

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
            EV++MVS+PD+ P       K   FNRI+ G FEMGSI K FT AM +DSGLF +  + 
Sbjct: 232 SEVLAMVSVPDFSPANPVDALKNNHFNRITAGTFEMGSIIKSFTTAMALDSGLFHLNSII 291

Query: 354 DTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           D   PI+  + H I D+H +NR LT+ E+F YSSNIG+A+ A A+G+  H+ FL RLGLL
Sbjct: 292 DASQPIQATRNHFIRDFHARNRPLTLWEVFIYSSNIGSAKEALAIGVDKHRNFLKRLGLL 351

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
            ++ TELPE+  P YP  WK I+S+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ 
Sbjct: 352 DRMLTELPEVAQPIYPHYWKDINSMTISFGHGIATTPLQTAVAAAALMNGGLLIDPTFLK 411

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           RS+EE+ K ++ VL   T + MR L +     GSGR A V G+ +GGKTGT++KV   +Y
Sbjct: 412 RSKEEALKHAKQVLHPQTSQDMRYLYKLNSDIGSGRNAKVVGYRIGGKTGTSEKVENGKY 471

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK-ERNQLTAGINVAPMVGNIIRRSASMLG 591
           S   NFNSFLA FP  +P YIVL+ +D PK + E++  TA +N AP++ NIIRRSA  LG
Sbjct: 472 SKEKNFNSFLAAFPIDNPSYIVLTIIDEPKPENEKHSATAAMNAAPVLANIIRRSAIFLG 531

Query: 592 VKPVFLK 598
           V+P F K
Sbjct: 532 VEPDFKK 538


>gi|240850898|ref|YP_002972298.1| penicillin-binding protein [Bartonella grahamii as4aup]
 gi|240268021|gb|ACS51609.1| penicillin-binding protein [Bartonella grahamii as4aup]
          Length = 580

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 259/570 (45%), Positives = 371/570 (65%), Gaps = 18/570 (3%)

Query: 39  MESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI 98
           M+S     QK  H+++  +      R+  + S+ R+  ++   L++Y I+   +I YG  
Sbjct: 1   MKSTFLFSQKKKHLKNSLNNHNVSVRRPYS-SRPRLLFSLFCFLILYGIMGACLISYG-- 57

Query: 99  HPEPIAPSMNIDEYG-------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE 151
                     I+E         M+RPDI+DRNG +LATDI T+SL+ EP ++I  DE IE
Sbjct: 58  -----LEGGQIEEAKGPGVLQLMARPDIVDRNGRLLATDIKTYSLFAEPRRIIDVDETIE 112

Query: 152 KLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAA 211
            L  VLP+L+ +   ++L  ++ F W++R L+P Q+ +I++ G+PG+GFR E  RFYP  
Sbjct: 113 LLSTVLPDLNWQETYKRLKRKSGFSWIQRGLTPMQKTQIMALGIPGIGFRTEIRRFYPDG 172

Query: 212 SHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQ 270
              SH++G V++DN+GI G+EK++D  GL+ +       E++L+ ++L++D+R+Q IVH 
Sbjct: 173 PVTSHILGMVNVDNQGIAGMEKYIDDAGLSALRAAGLAMEESLKQVQLSIDVRVQAIVHD 232

Query: 271 ELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG 330
           EL++  K+Y A + G VILN+ TGEV+++ S+PD+DP    +  K    NR++ G FEMG
Sbjct: 233 ELIQAMKRYRAIAAGAVILNIHTGEVLALASLPDFDPGNPIEALKSDRLNRMTAGAFEMG 292

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIG 389
           SI K FT AM +DS +F +  + D   PIK    + IHD+H +NR LT+ E+F YSSNIG
Sbjct: 293 SIIKSFTTAMALDSDIFHLNSIIDASKPIKASSGYTIHDFHGKNRPLTLWEVFIYSSNIG 352

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTP 449
           +A+ A A+GI  H+ FL +LGLL +L TELPE+  P  P  WK IHS+TISFGHG++TTP
Sbjct: 353 SAKEALAIGIDKHRGFLQKLGLLDRLTTELPEVAHPIVPHHWKDIHSMTISFGHGMATTP 412

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
           LQTAV AAAL+N G LI PTF+ R++ ++   ++ VL+  T + MR L +     GSGR 
Sbjct: 413 LQTAVGAAALMNGGWLIAPTFLKRTKGQTLHHAKRVLQAKTSQNMRYLYKLNSDIGSGRN 472

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQ 568
           A V G+ VGGKTGTA+KV   +YS T NFNSFLA FP  DP Y+VL+ +D PK  E +  
Sbjct: 473 AKVEGYRVGGKTGTAEKVENGKYSKTKNFNSFLAAFPIDDPVYVVLTIIDEPKPAEGQRS 532

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            TAG+N  PM+ NI+RR+AS LGVKP F K
Sbjct: 533 ATAGMNAGPMLANIVRRTASFLGVKPDFKK 562


>gi|328542960|ref|YP_004303069.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [polymorphum gilvum
           SL003B-26A1]
 gi|326412706|gb|ADZ69769.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [Polymorphum gilvum
           SL003B-26A1]
          Length = 571

 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 244/530 (46%), Positives = 351/530 (66%), Gaps = 5/530 (0%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNI-DEYGMSRPDIIDRNGEILAT 129
           ++R+ + +     +Y+++  R++    +   P A  ++  D    SRPD++DRNGEILAT
Sbjct: 32  RSRVYLAMAAFAAVYLLIGGRLVLLAQMDETPAAEFISAQDAVAASRPDLVDRNGEILAT 91

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T S+Y EP K++  +E++E L  V P L+S+ +R++LSS   F WL+R++SP QQ+ 
Sbjct: 92  DIRTASVYAEPRKIVDVEEVLEGLGSVFPELNSDTMRQRLSSRAGFIWLKREISPAQQQA 151

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-K 248
           I   GLPG+GF  EK RFYP    A H+VG V+IDN+G+ G+EK +D   L+ + +    
Sbjct: 152 IHRLGLPGIGFLWEKQRFYPGGPTAGHIVGSVNIDNQGLAGMEKHVDDAWLSDLRSIGFA 211

Query: 249 GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            ++ ++P+RLA+DLR+Q++V  EL +  ++Y A +   ++L+  TGEV++M S+PDYDP+
Sbjct: 212 SDRPMEPVRLAVDLRVQHVVRDELAKAMERYQAIAAVGIVLDAHTGEVVAMSSLPDYDPN 271

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD 368
              +   +   NR + G+FEMGS+FK FT AM +DSG  +++D FD   PI+ G   I D
Sbjct: 272 NREEALDKDKLNRATGGVFEMGSVFKTFTTAMALDSGRVSMRDSFDATRPIRAGGRTISD 331

Query: 369 YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP 428
           +H +NRIL++PEIF YSSNIG A++  A GI   + FL +LG+  +L TELPE   P  P
Sbjct: 332 FHGKNRILSVPEIFIYSSNIGTAKMMLATGIDEQQAFLKKLGMTERLPTELPENATPLLP 391

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
            +W  + ++T+SFGHG+S TP+QTAVAAAAL+N GRLIPPTF+ R  + +  ++  V+ +
Sbjct: 392 KRWGELAAITVSFGHGISVTPMQTAVAAAALVNGGRLIPPTFLPRDEQTANSLATRVISE 451

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
              + MR L R  V  GSG+RA VPG+ VGGKTGTA+KV   RY      NSFL+ FP  
Sbjct: 452 EASRAMRYLFRLNVLSGSGKRAEVPGYLVGGKTGTAEKVENGRYVSNKRRNSFLSAFPMD 511

Query: 549 DPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
           DP+Y+VL  +D PK  ER  L  TAG+N AP+ G IIRR+A MLGV P F
Sbjct: 512 DPRYVVLVVLDEPK-PEREGLAATAGLNTAPVTGAIIRRAAPMLGVLPQF 560


>gi|254504086|ref|ZP_05116237.1| penicillin-binding protein dimerization domain family [Labrenzia
           alexandrii DFL-11]
 gi|222440157|gb|EEE46836.1| penicillin-binding protein dimerization domain family [Labrenzia
           alexandrii DFL-11]
          Length = 537

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 244/529 (46%), Positives = 347/529 (65%), Gaps = 7/529 (1%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNI-DEYGMSRPDIIDRNGEILATDIP 132
           + M    C  +Y  +  R+I    +   P    ++  D    SRPD+IDRNGEILATDI 
Sbjct: 3   LAMLAFAC--VYAAIGGRLIYLAQMDEAPSRAWISAQDSVAASRPDLIDRNGEILATDIK 60

Query: 133 TFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILS 192
           T SLY EP +++  DE +E L  +LP+LD  ++RR+L S   F WL+R+++P + +++  
Sbjct: 61  TASLYAEPRRILDVDEAVEGLTRILPDLDEALVRRRLESGAGFVWLKREMTPDKAEQVHD 120

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEK 251
            GLPG+GF  E  RFYP    A H+VG V++DN+G++GIEK++D Q L  + +      +
Sbjct: 121 LGLPGIGFLSENQRFYPGGPTAGHIVGAVNVDNQGLSGIEKYVDDQWLRDLQSIGFASGR 180

Query: 252 NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAF 311
            ++P+RL++DLR+Q++V  ELV+  ++Y A +   ++L+  TGEV++M S+PDYDP++  
Sbjct: 181 TMEPVRLSVDLRVQHVVRDELVKAMERYRAIAAAGIVLDAKTGEVVAMSSLPDYDPNDRS 240

Query: 312 KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHP 371
           +  ++   NR + G+FEMGS+FK FT AM +DSG  T+ D FD   P++     I D+H 
Sbjct: 241 EALEKDRLNRATGGVFEMGSVFKAFTTAMALDSGAVTINDSFDATRPLRAAGRTITDFHG 300

Query: 372 QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW 431
           +NRIL++PEIF YSSNIG A++  A G+   KEF+ RL L  +L+TELPE  AP  P +W
Sbjct: 301 KNRILSVPEIFIYSSNIGTAKMMLATGVARQKEFMERLHLTKRLQTELPENAAPLLPPKW 360

Query: 432 KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTV 491
             + ++TISFGHGLS TP+QTAVAAAA++N G L+PPTF+ R++EE + + + V+     
Sbjct: 361 NELAAMTISFGHGLSVTPMQTAVAAAAMVNGGSLLPPTFVPRTQEEVKTLKKQVISPEVS 420

Query: 492 KTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ 551
           + MR L R  V  GSGRRA VPG+ VGGKTGTA+K+    Y      NSFL+ FP  DP+
Sbjct: 421 RMMRYLFRLNVLSGSGRRADVPGYTVGGKTGTAEKIENGVYVSNKRRNSFLSAFPMDDPR 480

Query: 552 YIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           Y+VL  +D PK  ER  +  TAG+N AP  G IIRR+A MLGV P F K
Sbjct: 481 YVVLVVLDEPK-SEREGIGATAGLNTAPTTGAIIRRAAPMLGVMPRFGK 528


>gi|121602507|ref|YP_989234.1| putative penicillin binding protein [Bartonella bacilliformis
           KC583]
 gi|120614684|gb|ABM45285.1| putative penicillin binding protein [Bartonella bacilliformis
           KC583]
          Length = 572

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 248/532 (46%), Positives = 361/532 (67%), Gaps = 5/532 (0%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-RPDIIDRNGEILAT 129
           ++R+  +++  L+ Y I+   +I YG +  + I  +       ++ RPDIIDRNG +LAT
Sbjct: 27  RSRLIFSLICVLIFYSIMGKCLIFYG-LEDDRIEEAKGPGTLQLATRPDIIDRNGRLLAT 85

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T+SL+ EP ++I  DE IE +  VLP LD + I ++L S++ F W++R L+P+Q+++
Sbjct: 86  DIATYSLFAEPRRIIDVDETIELISTVLPKLDFQEIYKRLKSKSGFSWIQRGLTPKQKQQ 145

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-K 248
           I++ G+PG+GFR E  RFYP  S ASH++G V++DN+GI G+EK++D  GL+ + T+   
Sbjct: 146 IMALGIPGIGFRTEIRRFYPGGSVASHILGMVNVDNQGIAGMEKYIDDAGLSVLRTSGLT 205

Query: 249 GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            + +L P++L++D+R+Q IV  EL++  K Y A + G VILN+ TGEV++M S+PD+DP 
Sbjct: 206 TDMSLNPVQLSIDVRVQTIVRDELIKAMKIYKALAAGAVILNIHTGEVLAMASVPDFDPG 265

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK-HVIH 367
                 K    NRI+ G FEMGSI K FT AM +DS +F +  + D   P++  K + IH
Sbjct: 266 NPVDALKSDRLNRITAGAFEMGSIIKSFTTAMALDSEIFHLNSVIDASKPLQASKNYFIH 325

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY 427
           D+H +NR L + EIF YSSNIG+A+ A A+G+ GH++FL R GLL +++ ELPE+  P  
Sbjct: 326 DFHGKNRPLKLWEIFIYSSNIGSAKEALAVGVDGHRDFLKRFGLLDRMKVELPEVANPIL 385

Query: 428 PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLK 487
           P QW+ I+S+TISFGHG++ TPLQT V AAAL+N G LI PT + R+  ++ K ++ VL 
Sbjct: 386 PRQWRDINSMTISFGHGIAITPLQTIVGAAALMNNGWLIEPTLLKRTEAQAMKYAKQVLH 445

Query: 488 KNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPT 547
             T + MR L +     GSGR A V G+ +GGKTGTA+K+   +YS T NFNSFLA FP 
Sbjct: 446 PQTSQEMRYLYKLNSVIGSGRNAQVEGYRIGGKTGTAEKIENGKYSKTKNFNSFLAAFPI 505

Query: 548 TDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            +P Y+VL+ +D P+  E  +L TAG+N AP++ NIIRRSAS LG+K  F K
Sbjct: 506 DNPSYVVLTIIDEPQPGEGKRLATAGMNAAPVLANIIRRSASFLGIKSDFKK 557


>gi|49475861|ref|YP_033902.1| penicillin-binding protein [Bartonella henselae str. Houston-1]
 gi|49238669|emb|CAF27915.1| Penicillin-binding protein [Bartonella henselae str. Houston-1]
          Length = 580

 Score =  499 bits (1285), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 239/487 (49%), Positives = 342/487 (70%), Gaps = 3/487 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDI+DRNG +LATDI T+SL+ EP ++I  DE IE L  VLP+L+ +   ++L  ++ 
Sbjct: 76  ARPDILDRNGRLLATDIKTYSLFAEPRRIIDVDETIELLSTVLPDLNWQETYKRLKKKSS 135

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P Q+ +I++ G+PG+GFR E  RFYP+    SH++G V++DN+GI G+EK+
Sbjct: 136 FSWIQRGLTPLQKAQIMALGIPGIGFRTEIRRFYPSGPVLSHILGMVNVDNQGIAGMEKY 195

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           +D  GL+ +       E +L+P++L++D+R+Q IVH EL++  K+Y A + G VILN+ T
Sbjct: 196 IDDAGLSDLRAAGLATEDSLKPVQLSIDVRVQTIVHDELMKAMKRYKAIAAGAVILNIHT 255

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
            EV+++ S+PD+DP       K    NR++ G FEMGSI K FT AM +DS +F +  + 
Sbjct: 256 SEVLALASLPDFDPGNPVDALKSDRLNRMTAGTFEMGSIIKSFTTAMALDSDIFHLNSII 315

Query: 354 DTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           D   P++  +   IHD+H +NR LT+ E+F YSSNIG+A+ A A+GI GH+ FL RLGLL
Sbjct: 316 DASKPLQASRGFTIHDFHGKNRPLTLWEVFIYSSNIGSAKEAMAIGIDGHRAFLKRLGLL 375

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
            ++ TELPE+  P  P+ WK IHS+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ 
Sbjct: 376 DRMTTELPEVAHPLVPNHWKDIHSMTISFGHGMATTPLQTAVAAAALMNGGWLIAPTFLK 435

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           R+R+++ + ++ VL+  T + MR L +     GSGR A V G+ VGGKTGTA+KV   +Y
Sbjct: 436 RTRDQALQHAKQVLQAKTSQNMRYLYKLNSDIGSGRNAKVEGYRVGGKTGTAEKVENGKY 495

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLG 591
           S T NFNSFLA FP  DP Y+VL+ +D P+ ++ +   TA +N  P++ NIIRRSA+ LG
Sbjct: 496 SKTKNFNSFLAAFPIEDPDYVVLTIIDEPQPEDGKYSATAAMNAGPILANIIRRSANFLG 555

Query: 592 VKPVFLK 598
           +KP F K
Sbjct: 556 IKPDFQK 562


>gi|47779256|gb|AAT38524.1| FtsI [Bartonella bacilliformis]
          Length = 572

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 245/532 (46%), Positives = 359/532 (67%), Gaps = 5/532 (0%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-RPDIIDRNGEILAT 129
           ++R+  +++  L+ Y I+   +I YG +  + I  +       ++ RPDIIDRNG +LAT
Sbjct: 27  RSRLIFSLICVLIFYSIMGKCLIFYG-LEDDRIEEAKGPGTLQLATRPDIIDRNGRLLAT 85

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T+SL+ EP ++I  DE IE +  VLP LD + I ++L S++ F W++R L+P+Q+++
Sbjct: 86  DIATYSLFAEPRRIIDVDETIELISTVLPKLDFQEIYKRLKSKSGFSWIQRGLTPKQKQQ 145

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-K 248
           I++ G+PG+GFR E  RFYP  S ASH++G V++DN+GI G+EK++D  GL+ + T+   
Sbjct: 146 IMALGIPGIGFRTEIRRFYPGGSVASHILGMVNVDNQGIAGMEKYIDDAGLSVLRTSGLT 205

Query: 249 GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            + +L P++L++D+R+Q IV  EL++  K Y A + G VILN+ TGEV++M S+PD+DP 
Sbjct: 206 TDMSLNPVQLSIDVRVQTIVRDELIKAMKIYKALAAGAVILNIHTGEVLAMASVPDFDPG 265

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK-HVIH 367
                 K    NRI+ G FEMGSI K FT AM +DS +F +  + D   P++  K + IH
Sbjct: 266 NPVDALKSDRLNRITAGAFEMGSIIKSFTTAMALDSKIFHLNSVIDASKPLQASKNYFIH 325

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY 427
           D+H +N  L + EIF YSSNIG+A+ A  +G+ GH++FL R GLL +++ +LPE+  P  
Sbjct: 326 DFHGKNPPLKLWEIFIYSSNIGSAKEALPVGVDGHRDFLKRFGLLDRMKVKLPEVANPIL 385

Query: 428 PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLK 487
           P QW+ I+S+TISFGHG++ TPLQT V AAAL+N G LI PT + R+  ++ K ++ VL 
Sbjct: 386 PRQWRDINSMTISFGHGIAITPLQTIVGAAALMNNGWLIEPTLLKRTEAQAMKYAKQVLH 445

Query: 488 KNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPT 547
             T + MR L +     GSGR A V G+ +GGKTGTA+K+   +YS T NFNSFLA FP 
Sbjct: 446 SQTSQEMRYLYKLNSVIGSGRNAQVEGYRIGGKTGTAEKIENGKYSKTKNFNSFLAAFPI 505

Query: 548 TDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            +P Y+VL+ +D P+  E  +L TAG+N AP++ NIIRRSAS LG+K  F K
Sbjct: 506 DNPSYVVLTIIDEPQPGEGKRLATAGMNAAPVLANIIRRSASFLGIKSDFKK 557


>gi|319408830|emb|CBI82487.1| Cell division protein/penicillin-binding protein [Bartonella
           schoenbuchensis R1]
          Length = 535

 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 236/487 (48%), Positives = 334/487 (68%), Gaps = 3/487 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDIIDRNG +LATDI T+SL+ EP ++I  DE IE +  VLP L+ +   ++L  +++
Sbjct: 28  ARPDIIDRNGRLLATDIETYSLFAEPRRIIDIDETIELISTVLPQLNWQETYKRLKRKSR 87

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P Q+ +I++ G+PG+GFR E  RFYP    ASH++G V++DN+GI GIEK+
Sbjct: 88  FSWVQRGLTPTQKAQIMALGIPGIGFRAEVRRFYPGGPIASHILGMVNVDNQGIAGIEKY 147

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           +D  GL+ +       E  L+P++L++D+R+Q IV  EL++  ++Y A + G VILN+ T
Sbjct: 148 IDDTGLSVLRDAGLATEALLKPVQLSIDIRVQAIVRDELMKGMERYKALAAGAVILNIHT 207

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GEV++MVS+PD+DP       K    NR++ G FEMGSI K FT AM +DS +F +  + 
Sbjct: 208 GEVVAMVSVPDFDPGNPVDALKGDRLNRMTAGTFEMGSIIKSFTTAMALDSEVFHLNSII 267

Query: 354 DTRNPIKVG-KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           D   PI+V     I D+H +NR LT+ E+F YSSNIG+A+ A  +GI GH++F  RLGLL
Sbjct: 268 DASKPIQVSHSRFIRDFHGKNRFLTLWEVFVYSSNIGSAREALEIGIDGHRDFFKRLGLL 327

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
            ++ TELPE+ +P  P +W+ I S+TISFGHG++TTPLQTAV  AAL+N G LI PTF+ 
Sbjct: 328 DRMTTELPEVASPVLPRRWRDIDSMTISFGHGMATTPLQTAVGTAALMNGGWLIEPTFLK 387

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           R+  ++ + ++ VL   T + MR L +     GSGR A V G+ +GGKTGTA+KV+  +Y
Sbjct: 388 RTEAQAVQHAKQVLHPRTSQDMRYLYQLNSVIGSGRNAKVEGYRIGGKTGTAEKVVNGKY 447

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSASMLG 591
           S   NFNSFLA FP  +P Y+VL+ +D P+ +E +    A +N APM+ NIIRRSAS LG
Sbjct: 448 SKMKNFNSFLAAFPMDNPSYVVLTIVDEPQPEEGKRSAVAAMNAAPMLANIIRRSASFLG 507

Query: 592 VKPVFLK 598
           VK  F K
Sbjct: 508 VKSDFKK 514


>gi|298293106|ref|YP_003695045.1| peptidoglycan glycosyltransferase [Starkeya novella DSM 506]
 gi|296929617|gb|ADH90426.1| Peptidoglycan glycosyltransferase [Starkeya novella DSM 506]
          Length = 604

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/540 (42%), Positives = 342/540 (63%), Gaps = 4/540 (0%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-SMNIDEYGMSRP 117
           F + R +  A ++ RI + ++V   +Y+ +A R+  + +     +A   +  D    +RP
Sbjct: 45  FGRGRPEPHAVARARILLCMLVFAGVYLAIAGRLAMFASAPDSALARRGLGTDAVASARP 104

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
           DI+DRNG +LATD+ + SL+ EP+++I  DE +E L  VLP+LD   +R++LS++  F W
Sbjct: 105 DILDRNGLVLATDVKSASLFGEPNRIIDVDEAVEALTAVLPDLDGNELRQRLSTKRGFIW 164

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           L+R ++PQQQ+ I + GLPG+GF  E  R YP  +  +HV+G  +IDN+GI GIEK++D 
Sbjct: 165 LKRDITPQQQREIHNLGLPGIGFMTENRRVYPGGTLGAHVMGSTNIDNQGIAGIEKWVDT 224

Query: 238 QGLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
            GL  +       ++  +PI LALDLR+Q+++  EL   K+K+ A +    +++V TGE+
Sbjct: 225 GGLADLHLAGFASDRQQEPIELALDLRVQHVLRDELFTAKEKFKAIAAAGTVVDVRTGEI 284

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++MVS+PD+D ++  +       NR++ G+FEMGS FK  T AM +DSG F +    D R
Sbjct: 285 VAMVSLPDFDANDPARSLDPKNLNRLTTGVFEMGSTFKALTFAMALDSGRFNINSTLDAR 344

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             ++ G+  IHDYH +NR+LT+PE+F YSSNIG A++A A+G+  HK FL + G L +L 
Sbjct: 345 GALQFGRFRIHDYHAENRVLTLPEVFLYSSNIGTAKMALALGVDAHKAFLAKAGQLDRLR 404

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE  AP  P +W  +++ TI+FGHGL+  PLQ  +A  AL+N G LIPPTF+ R+ E
Sbjct: 405 TELPESAAPIVPKRWGELNTATIAFGHGLAVAPLQAVMAVNALVNGGNLIPPTFLKRTPE 464

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           E++ + + ++K  T   MR LLR     GS ++  VPGF  GGKTGTA+KVI  RYS T 
Sbjct: 465 EAQALGKQIIKPETSAKMRYLLRLNAEKGSAKKVNVPGFYAGGKTGTAEKVIGGRYSKTK 524

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKE--RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
              +F  +FP  +PQY+VL  +D P+  E      TAG N AP  G II R   MLG+ P
Sbjct: 525 LLTTFTGIFPMDNPQYLVLVILDEPQAVEGTYGYATAGWNAAPTTGKIISRIGPMLGIMP 584


>gi|299131931|ref|ZP_07025126.1| Peptidoglycan glycosyltransferase [Afipia sp. 1NLS2]
 gi|298592068|gb|EFI52268.1| Peptidoglycan glycosyltransferase [Afipia sp. 1NLS2]
          Length = 579

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 237/564 (42%), Positives = 356/564 (63%), Gaps = 21/564 (3%)

Query: 49  GCHMEDGQDLFQKRRRKVI-------AHSKNRIGMTIVVCLVIYIILAIRIIQYG---NI 98
           G  +   + L Q+  RK++       A ++ R+G+ ++    ++ ++A+R++ YG   + 
Sbjct: 4   GVSVTPAEPLRQRLIRKLLYGNVDRAAKARARVGLAMLAFSAVFAVIALRLVMYGVMGDT 63

Query: 99  HPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
           H      +   D    +RPDI+DRNGEILATDI   SLY EP K+I  DE IE L   LP
Sbjct: 64  HNGRRGGAQ--DAVATARPDILDRNGEILATDIKAASLYAEPRKLIDKDEAIELLTATLP 121

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
           +LD   +R +LSS   F WL+R+L+P+QQ+ +   GLPGVGF  E  R YP     SH++
Sbjct: 122 DLDPGEVRDRLSSRKGFVWLKRELTPKQQRDVFKLGLPGVGFLRENKRVYPTGRDVSHLI 181

Query: 219 GYVDIDNRGITGIEKFLDMQGLTRV----FTTNKGEKNLQPIRLALDLRIQNIVHQELVE 274
           G V+IDN+GI G+EK+LD  GL  +    F T++ +   +PI LA+DLR+++ +  ELV+
Sbjct: 182 GLVNIDNQGIAGMEKWLDGNGLADLHRAGFATDRQQ---EPIELAVDLRVEHALRDELVK 238

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
            K+K++A++   ++ NV TGE+++MVS+PD+DP+   +       NR++ G++EMGS FK
Sbjct: 239 AKEKFHAKAASGIVSNVHTGEIVAMVSLPDFDPNNPKEANDPDRINRLTTGVYEMGSTFK 298

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
            FT+AM +DSG  T+  ++D R P++ G+  IHD HP  R +   E+F YSSNIGAA+IA
Sbjct: 299 AFTLAMALDSGKTTLNSMWDVRTPLQYGRFRIHDDHPLGRAINTKEVFTYSSNIGAARIA 358

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAV 454
            + GI+ HK FL ++G L++L TELPE  +P  P  W  ++++TI+FGHG++  PLQ  +
Sbjct: 359 LSQGIEAHKAFLAKMGQLTRLRTELPESASPILPRHWGELNTVTIAFGHGIAVAPLQAVM 418

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
              AL+N G LIPPTF+ RS  ++ K+++ V+K  T   MR L+R     G+ R+A VPG
Sbjct: 419 GIDALVNGGYLIPPTFLKRSEADAMKLAKRVIKPETSDKMRFLMRLNAEVGTARKADVPG 478

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAG 572
           + +GGKTGTA+KVI  RY+     N+F A+ P  +PQY +L  +D P+        +T+G
Sbjct: 479 YYIGGKTGTAEKVINGRYAKKKVLNAFTAIMPADNPQYQLLVMLDEPQALPETHGFITSG 538

Query: 573 INVAPMVGNIIRRSASMLGVKPVF 596
            N  P  G +I R A +LG+KP F
Sbjct: 539 WNAVPTGGKVIARIAPLLGIKPRF 562


>gi|254470463|ref|ZP_05083867.1| penicillin-binding protein, transpeptidase [Pseudovibrio sp. JE062]
 gi|211960774|gb|EEA95970.1| penicillin-binding protein, transpeptidase [Pseudovibrio sp. JE062]
          Length = 574

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/538 (43%), Positives = 353/538 (65%), Gaps = 9/538 (1%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDE-YGMSRPDIIDRN 123
           +V    ++RI   + + +++Y  +A R+I  G    +P    +        +RPDI+DRN
Sbjct: 25  RVRGPGRSRIVFAMTLFVLVYGAIAGRLILLGLQDGDPAQRFLAAQSTVAQARPDIVDRN 84

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           GEILATDI + +LY EP K+   DE+ + L  VLP LD+  I+++L S   F WL+R+++
Sbjct: 85  GEILATDIKSAALYAEPRKIPDTDEVFDGLISVLPELDTPAIKKRLESNALFTWLKREIT 144

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
            +Q++ I + GLPGVGFR    RFYP     SH++G V++DN+G++G+EK++D   L  +
Sbjct: 145 VEQRQAIHALGLPGVGFRESNKRFYPGGQTVSHILGTVNVDNQGLSGMEKYVDQAWLKDL 204

Query: 244 ----FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
               FT ++   N++P++L++DLR+Q+ V  EL  + + Y A++   V+L   TGEVI+M
Sbjct: 205 QDLGFTQDR---NMEPVKLSVDLRVQHAVRDELRRSMEYYKAKAAMGVVLKADTGEVIAM 261

Query: 300 VSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPI 359
            S+PD+DP+   +  ++   NR++ G+FE+GSIFK  TIAM +DSG   ++D FD   PI
Sbjct: 262 TSLPDFDPNNRQQALEKARMNRVTGGVFELGSIFKGLTIAMALDSGKVKLEDGFDATKPI 321

Query: 360 KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETEL 419
           +V    I D+H + R+L++PE+F YSSNIG  ++    GI+  KEFL ++GL  K+ TE+
Sbjct: 322 RVAGQKIDDFHGKRRVLSVPEVFIYSSNIGTIKVMQRAGIEAQKEFLSKVGLTEKMNTEM 381

Query: 420 PEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE 479
           P +  P  P +W  + ++TISFGHG+  TPLQ AVA A L+N G+ + PTF+ RS EE++
Sbjct: 382 PGVARPLLPPKWNELAAMTISFGHGVGVTPLQMAVAGATLVNGGKYLEPTFLPRSEEEAD 441

Query: 480 KVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFN 539
           K+++ VLK  T + +R L RE V  GSGRRA VPG++VGGKTGTAQKV+  RY++ +  N
Sbjct: 442 KLAKQVLKPETSEILRYLNRENVLRGSGRRAAVPGYDVGGKTGTAQKVVNGRYAEGVYLN 501

Query: 540 SFLAVFPTTDPQYIVLSFMDSP-KIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           SF++ FP ++P+Y+VL  +D P K++ +   TAG N  P   ++IRR A MLGV P F
Sbjct: 502 SFMSAFPMSNPEYLVLIVLDEPQKVEGQRYSTAGWNAVPTTASVIRRIAPMLGVVPDF 559


>gi|209884376|ref|YP_002288233.1| peptidoglycan glycosyltransferase [Oligotropha carboxidovorans OM5]
 gi|209872572|gb|ACI92368.1| peptidoglycan glycosyltransferase [Oligotropha carboxidovorans OM5]
          Length = 581

 Score =  475 bits (1222), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 229/536 (42%), Positives = 346/536 (64%), Gaps = 10/536 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-SMNIDEYGMSRPDIIDRNGEI 126
           A ++ R+G+ ++    ++ ++A+R++ YG +     A    + D    +RPDI+DRNGEI
Sbjct: 32  AKARARVGLVMLAFTAVFAVIALRLVMYGVVGDNHGARRGSSQDAIATARPDILDRNGEI 91

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+   SLY EP ++I  DE IE L   LP+LD   +R +LSS   F WL+R+L+P+Q
Sbjct: 92  LATDVKASSLYAEPRRLIDKDEAIELLTATLPDLDPGEVRDRLSSRKGFVWLKRELTPKQ 151

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV--- 243
           Q  +   GLPGVGF  E  R YP     SH++G V+IDN+GI G+EK+LD  GL  +   
Sbjct: 152 QHDVFKLGLPGVGFLRENKRVYPTGRDVSHLIGIVNIDNQGIAGMEKWLDGNGLADLHRA 211

Query: 244 -FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
            F T++ ++   PI L++DLR+++ +  EL++ K+K+ A++   ++ NV TGE+++MVS+
Sbjct: 212 GFATDRQQR---PIELSVDLRVEHALRDELLKAKEKFRAKAASGIVSNVRTGEIVAMVSL 268

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG  T+  ++D R+ ++ G
Sbjct: 269 PDFDPNNPKEANDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKATLNSMWDARSALQYG 328

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
           +  IHD HP  R +   E+F YSSNIGAA+IA + GI+ HK FL ++G L++L TELPE 
Sbjct: 329 RFRIHDDHPLGRAINTKEVFTYSSNIGAARIALSQGIEAHKAFLGKMGQLTRLRTELPES 388

Query: 423 QAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
            AP  P  W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ RS EE+ K++
Sbjct: 389 AAPLLPRHWGELNTVTIAFGHGIAVAPLQAVMGIDALVNGGYLIPPTFLKRSEEEAMKLA 448

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFL 542
           + V+KK T   MR L+R     G+ R+A VPG+ +GGKTGTA+KVI  RY+     N+F 
Sbjct: 449 KRVIKKETSDKMRFLMRLNAEIGTARKADVPGYYIGGKTGTAEKVINGRYAKKKVLNAFT 508

Query: 543 AVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPVF 596
           A+ P  +P++ +L  +D P+        +T+G N  P  G +I R A +LGV+P F
Sbjct: 509 AILPADNPRFQLLVMLDEPQALPETHGFITSGWNAVPTGGKVIARIAPLLGVEPRF 564


>gi|75675238|ref|YP_317659.1| penicillin-binding protein, transpeptidase [Nitrobacter
           winogradskyi Nb-255]
 gi|74420108|gb|ABA04307.1| Penicillin-binding protein, transpeptidase [Nitrobacter
           winogradskyi Nb-255]
          Length = 579

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/545 (41%), Positives = 350/545 (64%), Gaps = 4/545 (0%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-SMNIDEYGM 114
           ++L   R     A ++ R+G+ I++  +IY ++A R++ +     +     + + D    
Sbjct: 18  RNLLYGRNVDRAAKARVRVGLVIILFALIYTVVAARLVMFAAFPDDRGGRRTASQDAIAT 77

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDIIDRNG++LATDI + SL+ EP ++I  DE +E L   LP+L++  +R++L +   
Sbjct: 78  ARPDIIDRNGQVLATDIKSPSLFGEPRRLIDRDEAVELLTATLPDLETSEVRQRLGTRKG 137

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL+R+++P QQK I S G+PG+GF  E  R YP+    +H++G V+IDN+GI G+EK+
Sbjct: 138 FVWLKREITPAQQKEIHSLGIPGIGFLRENKRVYPSGREVAHLIGLVNIDNQGIAGMEKW 197

Query: 235 LDMQGLTRVFTTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           LD  GL  +         LQ P+ L++DLR+++ +  EL++ K  Y A++   ++ NV T
Sbjct: 198 LDSNGLADLHRAGFATDRLQKPVELSIDLRVEHALRDELLKAKDHYRAKAASGIVSNVRT 257

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+++MVS+PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG + +  ++
Sbjct: 258 GEIVAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGRYGLNSMW 317

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D R P++ G+  IHD H   R + + E+F YSSNIGAA+IA A G++ HK FL R+G + 
Sbjct: 318 DARAPLRYGRFTIHDDHSMGRFINMKEVFTYSSNIGAARIALAQGVEAHKAFLRRMGQMD 377

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           +L TELPE  +P  P +W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ R
Sbjct: 378 RLRTELPESASPILPRKWGELNTVTIAFGHGMAVAPLQAVMGIDALVNGGWLIPPTFLKR 437

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + EE+  V+R V+K+ T   MR LLR     G+ R+A V G+ VGGKTGT++KVI  RY+
Sbjct: 438 TEEEAMAVARRVIKQETSDKMRFLLRLNAEVGTARKADVKGYYVGGKTGTSEKVINGRYA 497

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQ-LTAGINVAPMVGNIIRRSASMLG 591
                NSF A+ P  +P+Y +L  +D P+ +KE +  +T+G N  P  G +I R A +LG
Sbjct: 498 KKRVLNSFTAILPADNPRYQILVMLDEPQPLKETHGFITSGWNAVPTGGKVIARIAPLLG 557

Query: 592 VKPVF 596
           V+P F
Sbjct: 558 VQPRF 562


>gi|92116829|ref|YP_576558.1| peptidoglycan glycosyltransferase [Nitrobacter hamburgensis X14]
 gi|91799723|gb|ABE62098.1| Peptidoglycan glycosyltransferase [Nitrobacter hamburgensis X14]
          Length = 585

 Score =  468 bits (1205), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/568 (40%), Positives = 358/568 (63%), Gaps = 13/568 (2%)

Query: 41  SGHNLCQKGCHMEDG-------QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRII 93
           +G N+  +G H           ++L   R     A ++ R+G+ I+V  +IY ++A R++
Sbjct: 2   TGQNMPDRGSHAPSVAWSQRMIRNLLYGRNVDRAAKARVRVGLVIIVFGLIYAVIAARLV 61

Query: 94  QYGNIHPEPIAP--SMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE 151
            +    P+      + + D    +RPDI+DRNG++LATD+   SL+ EP ++I  DE +E
Sbjct: 62  MFAAF-PDDRGGHRTASQDAIATARPDIVDRNGQVLATDVKAPSLFGEPRRIIDRDEAVE 120

Query: 152 KLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAA 211
            L   LP+L++  +R++L +   F WL+R+++P QQK I + G+PG+GF  E  R YP+ 
Sbjct: 121 LLTATLPDLETAEVRQRLGTRKGFVWLKREITPSQQKEIHNLGIPGIGFLRENKRVYPSG 180

Query: 212 SHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQ-PIRLALDLRIQNIVHQ 270
              +H++G V+IDN+GI G+EK+LD  GL  +         LQ P+ L++DLR+++ +  
Sbjct: 181 REVAHLIGLVNIDNQGIAGMEKWLDSNGLADLHRAGFATDRLQKPVELSVDLRVEHALRD 240

Query: 271 ELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG 330
           ELV+ K+ Y+A++   ++ NV TGE+++MVS+PD+DP+   +       NR++ G++EMG
Sbjct: 241 ELVKAKEHYHAKAASGLVSNVRTGEIVAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMG 300

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA 390
           S FK FT+AM +DSG + +  ++D R P+  G+  IHD H   R + + E+F YSSNIGA
Sbjct: 301 STFKAFTLAMALDSGKYDLNSMWDARAPLHYGRFTIHDDHRLGRFINMKEVFTYSSNIGA 360

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPL 450
           A+IA A G++ HK FL +LG + +L TELPE  AP  P +W  ++++TI++GHG++  PL
Sbjct: 361 ARIALAQGVEAHKAFLRKLGQMDRLRTELPESAAPILPRKWGELNTVTIAYGHGIAVAPL 420

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           Q  +   AL+N G LIPPTF+ RS  ++ K+++ V+KK T   MR LLR     G+ R+A
Sbjct: 421 QAVMGIDALVNGGWLIPPTFLKRSEADAMKLAKRVIKKETSDKMRFLLRLNAEVGTARKA 480

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQ- 568
            V G+ VGGKTGTA+KVI  RY+     N+F A+ P  +PQY +L  +D P+ +KE +  
Sbjct: 481 DVKGYYVGGKTGTAEKVINGRYAKKRVLNAFTAILPADNPQYQLLVMLDEPQPLKETHGF 540

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPVF 596
           +T+G N  P  G +I R A +LGV+P F
Sbjct: 541 ITSGWNAVPTGGKVIARIAPLLGVQPRF 568


>gi|148257425|ref|YP_001242010.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. BTAi1]
 gi|146409598|gb|ABQ38104.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. BTAi1]
          Length = 582

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/533 (41%), Positives = 340/533 (63%), Gaps = 4/533 (0%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-SMNIDEYGMSRPDIIDRNGEI 126
           A ++ RIG+ I+    +Y I+  R++ +      P A  +   D    +RPDI+DRNG +
Sbjct: 33  AKARARIGLAIIAFAAVYAIIGGRLVMFAVGADGPTARRAAQQDAIATARPDIVDRNGAV 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP ++I  DE IE L   LP+LD+  +R +L S   F WL+R++SP+Q
Sbjct: 93  LATDVKTPSLFAEPRRLIDKDEAIELLTATLPDLDTSEVRERLMSRKGFVWLKREMSPKQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ I   GLPGVGF  E  R YP  +  +H++G V+IDN+GI G+EK+LD QGL  +   
Sbjct: 153 QQDIHRLGLPGVGFLRENKRVYPTGNEVAHLIGLVNIDNQGIAGMEKWLDNQGLADLHRA 212

Query: 247 NKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 LQ PI L++DLR+++ +  EL++ K+K+  ++   +++NV TGE+++MVS+PD+
Sbjct: 213 GFATDRLQRPIELSVDLRVEHALRDELLKAKEKFKTKAASGLVVNVRTGEIVAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK FT+AM +D+G + +  L+D R P+  GK  
Sbjct: 273 DPNSPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDTGKYDLNSLWDARGPLHYGKFA 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD  P+ R L++ E+F +SSN+GAA+IA   G++ HK FL ++G   +L TELPE  +P
Sbjct: 333 IHDDEPKGRFLSMKEVFYFSSNVGAARIALTQGVEAHKAFLRKMGQFDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TI+FGHG++  PLQ  +  +AL+N G LIPPTFM R+ EE+  +++ V
Sbjct: 393 ILPKRWAELNTVTIAFGHGMAVAPLQGVMGVSALVNGGLLIPPTFMKRTEEEAMALAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +K  T + MR L+R     G+ R+A V G+ +GGKTGTA+KVI  RY+       F AV 
Sbjct: 453 IKPETSEKMRYLMRLNAEVGTARKADVKGYYIGGKTGTAEKVINGRYAKKKVLTLFTAVI 512

Query: 546 PTTDPQYIVLSFMDSPK-IKER-NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           P   P+Y +L  +D P+ +KE    +T+G N  P  GN+I R   +LG++P F
Sbjct: 513 PADKPRYQLLIMLDEPQPLKETYGFITSGWNAVPTAGNVIARIGPLLGIEPRF 565


>gi|146342504|ref|YP_001207552.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. ORS278]
 gi|146195310|emb|CAL79335.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. ORS278]
          Length = 582

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 220/533 (41%), Positives = 339/533 (63%), Gaps = 4/533 (0%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-SMNIDEYGMSRPDIIDRNGEI 126
           A ++ RIG+ I+    +Y ++  R++ +      P A  +   D    +RPDIIDRNG +
Sbjct: 33  AKARARIGLAIIAFAAVYAVIGGRLVMFAVGSDGPSARRAAQQDAIATARPDIIDRNGAV 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP ++I  DE IE L   LP+LD+  +R ++ S   F WL+R+++P+Q
Sbjct: 93  LATDVKTPSLFAEPRRLIDKDEAIELLTATLPDLDTNEVRERMMSRKGFVWLKREMTPKQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ I   GLPGVGF  E  R YP  +  +H++G V+IDN+GI G+EK+LD QGL  +   
Sbjct: 153 QQDIHRLGLPGVGFLRENKRVYPTGNEVAHLIGLVNIDNQGIAGMEKWLDNQGLADLHRA 212

Query: 247 NKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 LQ PI L++DLR+++ +  EL++ K+K+  ++   +++NV TGE+I+MVS+PD+
Sbjct: 213 GFATDRLQRPIELSVDLRVEHALRDELLKAKEKFKTKAASGLVVNVRTGEIIAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK FT+AM +D+G + +  ++D R  +  GK  
Sbjct: 273 DPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDTGKYDLNSMWDARGALHYGKFA 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD  P+ R L++ E+F +SSN+GAA+IA   G++ HK FL ++G   +L TELPE  +P
Sbjct: 333 IHDDEPKGRFLSMKEVFYFSSNVGAARIALTQGVEAHKAFLRKMGQFDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TISFGHG++  PLQ  +  +AL+N G LIPPTFM R+  E+ ++++ V
Sbjct: 393 ILPKRWSELNTITISFGHGMAVAPLQGVMGVSALVNGGYLIPPTFMKRTEAEAMQIAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +K  T + MR L+R     G+ R+A V G+ +GGKTGTA+KVI  RY+       F AV 
Sbjct: 453 IKPETSEKMRYLMRLNAEVGTARKADVKGYYIGGKTGTAEKVINGRYAKKKVLTLFTAVI 512

Query: 546 PTTDPQYIVLSFMDSPK-IKER-NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           P   P+Y +L  +D P+ +KE    +T+G N  P  GN+I R   +LG++P F
Sbjct: 513 PADKPKYQLLIMLDEPQPLKETYGFITSGWNAVPTAGNVISRIGPLLGIEPRF 565


>gi|316933180|ref|YP_004108162.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315600894|gb|ADU43429.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 584

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 219/537 (40%), Positives = 344/537 (64%), Gaps = 10/537 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIR---IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           A ++ R+G+ ++   V+Y ++A +   I  +G+ H      S   D    +RPDI+DRNG
Sbjct: 33  AKARARVGLAMIAFAVVYGVIAFKLTTIAVFGDSHGARRGVSQ--DAVATARPDIVDRNG 90

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
           +ILATD+ T SL+ EP ++I  DE +E L   LP+L+++ +R +L+S+  F WL+R+++P
Sbjct: 91  QILATDVKTPSLFGEPRRLIDQDEAVELLTATLPDLETQEVRERLASKKGFVWLKREITP 150

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
           +QQ  I   G+PG+GF  E  R YP A+  SH++G V+IDN+GI GIEK+LD  GL  + 
Sbjct: 151 RQQAEIKKLGIPGIGFLRENKRVYPNAAEVSHLIGLVNIDNQGIAGIEKWLDNNGLADLH 210

Query: 245 TTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                   +Q P+ LALD+R+ + +  EL++ K+KY+A++   ++ NV+TGE+++MVS+P
Sbjct: 211 RAGFASDRMQRPVELALDVRVTHALRDELLKAKEKYSAKAASGLVSNVNTGEIVAMVSLP 270

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DP+   +       NR++ G+FEMGS FK  T+AM +D+G  ++  ++D R P+  GK
Sbjct: 271 DFDPNNPREANDPDRINRLTTGVFEMGSTFKTLTLAMALDAGKASLSTMYDARGPLHYGK 330

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHD H   R +++ E+F YSSN+GAA++A +MG+  HK FL ++G L +L TELPE  
Sbjct: 331 FKIHDSHNMGRAISLSEVFTYSSNVGAARVALSMGVDAHKAFLKKVGQLDRLRTELPESA 390

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
           +P  P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ R+ E+++K ++
Sbjct: 391 SPLVPKRWSELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFLKRTEEDAQKFAK 450

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRA--FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            V+KK T   +R L+R     G+ + A     G+ +GGKTGT++KV+  RY+     NSF
Sbjct: 451 RVVKKETSDKIRYLMRLNAEIGTAKTADQIAKGYYIGGKTGTSEKVVNGRYAKKQVLNSF 510

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPVF 596
            A+ P  +PQY VL  +D PK        +T+G N  P  G +I R A +LG++P F
Sbjct: 511 TAILPADNPQYQVLVMLDEPKALPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|85714967|ref|ZP_01045952.1| Penicillin-binding protein, transpeptidase [Nitrobacter sp.
           Nb-311A]
 gi|85698164|gb|EAQ36036.1| Penicillin-binding protein, transpeptidase [Nitrobacter sp.
           Nb-311A]
          Length = 579

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 220/545 (40%), Positives = 348/545 (63%), Gaps = 4/545 (0%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIA-PSMNIDEYGM 114
           ++L   R     A ++ R+G  I++  +IY ++A R++ +     +     + + D    
Sbjct: 18  RNLLYGRNVDRAAKARVRVGFVIILFSLIYAVIAARLVMFAAFSDDRGGHRTASQDAIAT 77

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDIIDRNG++LATDI   SL+ EP ++I  DE +E L   LP+L++  +R++L +   
Sbjct: 78  ARPDIIDRNGQVLATDIKAPSLFGEPRRLIDRDEAVELLTATLPDLETAEVRQRLGTRKG 137

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL+R+++P QQK I   G+PG+GF  E  R YP+    +H++G V+IDN+GI G+EK+
Sbjct: 138 FVWLKREITPAQQKEIHGLGIPGIGFLRENKRVYPSGREVAHLIGLVNIDNQGIAGMEKW 197

Query: 235 LDMQGLTRVFTTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           LD  GL  +         LQ P+ L++DLR+++ +  EL++ ++ Y A++   ++ NV T
Sbjct: 198 LDSNGLADLHRAGFATDRLQKPVELSIDLRVEHALRDELLKAQEHYRAKAASGIVSNVRT 257

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+I+MVS+PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG + +  ++
Sbjct: 258 GEIIAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKYGLNSMW 317

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D R P++ G+  IHD H   R + + E+F YSSNIGAA+IA A G++ HK FL ++G + 
Sbjct: 318 DARAPLRYGRFTIHDDHRMGRFINMKEVFTYSSNIGAARIALAQGVEAHKAFLRKMGQMD 377

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           +L TELPE  +P  P +W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ R
Sbjct: 378 RLRTELPESASPILPRKWGELNTVTIAFGHGMAVAPLQAVMGIDALVNGGWLIPPTFLKR 437

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + +E+  +++ V+K+ T   MR LLR     G+ R+A V G+ VGGKTGT++KVI  RY+
Sbjct: 438 TEQEAMAIAKRVIKQETSDKMRFLLRLNAEVGTARKADVKGYYVGGKTGTSEKVINGRYA 497

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQ-LTAGINVAPMVGNIIRRSASMLG 591
                N+F A+ P  +PQY +L  +D P+ +KE +  +T+G N  P  G +I R A +LG
Sbjct: 498 KKRVLNAFTAILPADNPQYQLLVMLDEPQPLKETHGFITSGWNAVPTGGKVIARIAPILG 557

Query: 592 VKPVF 596
           V+P F
Sbjct: 558 VQPRF 562


>gi|91977866|ref|YP_570525.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB5]
 gi|91684322|gb|ABE40624.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB5]
          Length = 584

 Score =  459 bits (1181), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/537 (41%), Positives = 342/537 (63%), Gaps = 10/537 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIR---IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           A ++ R+G+ ++    +Y ++A +   I  +G+ H      S   D    +RPDI+DRNG
Sbjct: 33  AKARARVGLAMLAFAAVYGVIAFKLSMIALFGDSHGTRRTASQ--DAIATARPDIVDRNG 90

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            ILATD+ + SL+ EP ++I  DE +E L   LP+L+++ +R +L+S+  F WL+R+++P
Sbjct: 91  TILATDVKSPSLFGEPRRIIDQDEAVELLTATLPDLETQEVRERLASKKGFVWLKREITP 150

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
           +QQ  I   G+PG+GF  E  R YP  +  SH++G V+IDN+GI GIEK+LD  GL  + 
Sbjct: 151 RQQADIKKLGIPGIGFLRENKRVYPTGTEVSHLIGLVNIDNQGIAGIEKWLDNNGLADLH 210

Query: 245 TTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                   LQ P+ LA+D+R+++ +  EL++ K KY+A++   ++ NV+TGE+++MVS+P
Sbjct: 211 RAGFASDRLQRPVELAVDIRVEHALRDELLKAKNKYSAKAASGLVSNVNTGEIVAMVSLP 270

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DP+   +       NR++ G++EMGS FK  T+AM +DSG  T+  L+D R  ++ GK
Sbjct: 271 DFDPNNPREANDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKATLNTLYDARGALRYGK 330

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHD HP  R +T+ E+F +SSN+GAA+IA A G++ HK FL ++G L +L TELPE  
Sbjct: 331 FAIHDTHPLGRPITLAEVFTFSSNVGAARIAIAQGVEAHKAFLKKVGQLDRLRTELPESA 390

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
           +P  P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ RS E++ K+++
Sbjct: 391 SPIVPKRWGELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFLKRSEEDALKMAK 450

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRA--FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            V+KK T   +R L+R     G+ R A     G+ +GGKTGT++KVI  RY+     NSF
Sbjct: 451 RVVKKETSDKIRYLMRLNAEIGTARTADQIAKGYYIGGKTGTSEKVINGRYAKKQVLNSF 510

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPVF 596
            AV P  +PQ+ VL  +D PK        +T+G N  P  G +I R A +LG++P F
Sbjct: 511 TAVLPADNPQFQVLVMLDEPKALPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|154245794|ref|YP_001416752.1| peptidoglycan glycosyltransferase [Xanthobacter autotrophicus Py2]
 gi|154159879|gb|ABS67095.1| Peptidoglycan glycosyltransferase [Xanthobacter autotrophicus Py2]
          Length = 614

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 230/559 (41%), Positives = 341/559 (61%), Gaps = 11/559 (1%)

Query: 42  GHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE 101
           GH   + G HM  G  LF   R      ++ RI + +     ++I +A ++     I   
Sbjct: 40  GHLAWRAGRHMVRG--LFGLDRGDADTVARGRIKLIMFAFCAVFIAIATQLSHLAIISDP 97

Query: 102 PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD 161
                 + D    +RPDIIDRNG+I+A D+ + SL+ EP ++I PDE +E L  VLP+LD
Sbjct: 98  GATRGRSTDAVSSARPDIIDRNGDIIAIDVKSPSLFAEPRRLIDPDEALEGLLKVLPDLD 157

Query: 162 SEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            E  R++L+S   F WL+R+++P Q + I   GLPG+GF  E  R YP     SHV+G V
Sbjct: 158 VEESRKRLNSGKGFAWLKREITPAQMRAIHRLGLPGIGFLKENRRIYPDGPILSHVMGGV 217

Query: 222 DIDNRGITGIEKFLDMQGLTRV----FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKK 277
           ++DN+GI+G+EK++D +GL  +    F T+  +   +P+ L++D+R+Q+ V  EL+  K 
Sbjct: 218 NVDNQGISGLEKYIDGRGLAELHLAGFATDLQQ---EPVELSMDMRVQHAVRDELIRAKN 274

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           K++A     V+ +V+TGE+ISMVS+PD+DP+     K + + NR++ G+FEMGS FK  +
Sbjct: 275 KFSALHAMAVVTDVNTGEIISMVSLPDFDPNVPGNPKDDAYLNRLTTGVFEMGSTFKALS 334

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
            AM +DSG   +   FD R  +  G+  I DYH +NR+LT+PEIF  SSN+G A++  ++
Sbjct: 335 FAMALDSGKIGLNSSFDARGAMHFGRFKISDYHAENRVLTVPEIFLASSNVGTAKMVLSL 394

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           G++ HK FL ++G L +L TELPE   P  P +W  ++S TI+FGHGLS  PLQ  +A  
Sbjct: 395 GVEAHKAFLKKMGQLDRLRTELPESSEPIVPKRWGELNSATIAFGHGLSVAPLQAVMAVN 454

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           +++N G LI PTF+ R+ EE++KV+  VLK  T   MR ++R     G+  +A VPG+ V
Sbjct: 455 SMVNGGYLITPTFIKRTPEEAQKVAVRVLKPETSDKMRYIMRLNAEKGTATKAEVPGYLV 514

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINV 575
           GGKTGTA+KV+  RY+      SF A+FP   P+Y+VL  +D PK         T+G N 
Sbjct: 515 GGKTGTAEKVVNGRYAKNKLLTSFTAIFPMDKPRYLVLVMLDEPKATSETYGFATSGWNA 574

Query: 576 APMVGNIIRRSASMLGVKP 594
           AP  G I+ R A +L + P
Sbjct: 575 APTAGKIVERIAPLLNIAP 593


>gi|158426168|ref|YP_001527460.1| putative penicillin-binding protein [Azorhizobium caulinodans ORS
           571]
 gi|158333057|dbj|BAF90542.1| putative penicillin-binding protein [Azorhizobium caulinodans ORS
           571]
          Length = 655

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/528 (40%), Positives = 336/528 (63%), Gaps = 3/528 (0%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           ++ R+ + I     +++ +A+R+   G             +    +RPDI+DRNGEI+A 
Sbjct: 107 TRARLKLIIAAFSFVFLAIALRLAFLGVTSDPNGVRGGGSEAVASARPDIVDRNGEIIAI 166

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           D+ + SL+ EP ++I PDE +E L  VLP+LD   +R +L+S+  F WL+R+++P QQ+ 
Sbjct: 167 DVKSPSLFAEPKRLIDPDETLEGLLKVLPDLDVNEVRNRLNSKKGFAWLKREITPAQQRA 226

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           I   G PG+GF  E  R YP     SHVVG V++DN+GI G+EK++D +GL  +      
Sbjct: 227 IYRLGFPGIGFVRENRRIYPDGPSFSHVVGNVNVDNQGIAGLEKYIDGRGLAELHLAGLA 286

Query: 250 -EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            ++  +P+ L++D+R+Q+ +  EL++ ++K+ A++   ++ NV TGE+++MVS+PD+DP+
Sbjct: 287 TDRQQEPVALSMDVRVQHTLRDELLKAREKFKAKAAMGLVTNVRTGEIVAMVSLPDFDPN 346

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD 368
                + + + NR++ G+FEMGS FK  + AM +DSG  ++ + FD R P+  G+  IHD
Sbjct: 347 LNGDPRSDAYLNRLTTGVFEMGSTFKSLSFAMALDSGKISLSNSFDARAPLSFGRFAIHD 406

Query: 369 YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP 428
           +HP+ R+L++PEIF YSSNIG A++  ++G+  HK FL ++G + +L TELPE   P  P
Sbjct: 407 FHPEGRVLSLPEIFIYSSNIGTAKMVLSLGVDAHKAFLKKMGQMDRLRTELPESAEPIVP 466

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
            +W  ++S TI+FGHG++  PLQ  +A  +++N G LIPPTF+ R+ +++ KV+  VLK 
Sbjct: 467 KRWGELNSATIAFGHGIAVAPLQAVMAVNSMVNGGYLIPPTFLKRTEDDAMKVATRVLKP 526

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
            T   MR LLR  V  GSG++A + G+ VG KTGTA+KV+  RY+      SF AVFP  
Sbjct: 527 ETSDKMRYLLRLNVEKGSGKKADMVGYNVGAKTGTAEKVVGGRYAKNKLLTSFTAVFPMD 586

Query: 549 DPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKP 594
            PQY++L  +D P+         T+G N AP+ G I+ R A ML V P
Sbjct: 587 RPQYLLLVMLDEPQPTPETHGYATSGWNAAPVAGKIVERIAPMLNVAP 634


>gi|39936598|ref|NP_948874.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|192292420|ref|YP_001993025.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           TIE-1]
 gi|39650454|emb|CAE28977.1| putative penicillin-binding protein [Rhodopseudomonas palustris
           CGA009]
 gi|192286169|gb|ACF02550.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           TIE-1]
          Length = 584

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/535 (40%), Positives = 341/535 (63%), Gaps = 10/535 (1%)

Query: 70  SKNRIGMTIVVCLVIYIILAIR---IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           ++ R+G+ ++    +Y I+A +   I  +G+ H      S   D    +RPDI+DRNG++
Sbjct: 35  ARARVGLAMIAFAAVYGIIAFKLSMIAVFGDGHGARRTGSQ--DAVATARPDIVDRNGQV 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP ++I  DE +E L   LP+L+++ +R +L+S+  F WL+R+++P+Q
Sbjct: 93  LATDVKTPSLFGEPRRLIDQDEAVELLTATLPDLETQEVRERLASKKGFVWLKREITPRQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q  I   G+PG+GF  E  R YP A+  SH++G V+IDN+GI GIEK+LD  GL  +   
Sbjct: 153 QAEIKKLGIPGIGFLRENKRVYPNAAEVSHLIGLVNIDNQGIAGIEKWLDNNGLADLHRA 212

Query: 247 NKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 +Q PI LALD+R+ + +  EL++ K+KY+A++   ++ NV TGE+++MVS+PD+
Sbjct: 213 GFASDRMQRPIELALDVRVTHALRDELIKAKEKYSAKAASGLVSNVKTGEIVAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK  T+AM +D+G  T+  ++D R P+  GK  
Sbjct: 273 DPNNPREANDPDRINRLTTGVYEMGSTFKTLTLAMALDAGKATLHSMYDARGPLHYGKFK 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD H   R +++ E+F YSSN+GAA++A +MG++ HK FL ++G L +L TELPE  +P
Sbjct: 333 IHDSHNMGRAISLAEVFTYSSNVGAARVALSMGVEAHKAFLKKVGQLDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ R+ E+++K+ + V
Sbjct: 393 IVPKRWSELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFLKRTEEDAKKLGKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRA--FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
           +K  T   +R L+R     G+ + A     G+ +GGKTGT++KV+  RY+     NSF A
Sbjct: 453 IKTETSDKIRYLMRLNAEVGTAKTADQIAKGYYIGGKTGTSEKVVNGRYAKKQVLNSFTA 512

Query: 544 VFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPVF 596
           + P  +PQY VL  +D PK        +T+G N  P  G +I R A +LG++P F
Sbjct: 513 ILPADNPQYQVLVMLDEPKALPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|27381719|ref|NP_773248.1| penicillin binding protein 2 [Bradyrhizobium japonicum USDA 110]
 gi|27354888|dbj|BAC51873.1| penicillin binding protein 2 [Bradyrhizobium japonicum USDA 110]
          Length = 580

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/535 (40%), Positives = 334/535 (62%), Gaps = 8/535 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYG---NIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           A ++ R+G+ ++    +Y ++  R++ +    + H    A +  +     +RPDI+DRNG
Sbjct: 31  AKARARVGLAMLAFASVYALIGGRLVMFAIGADAHSARRAAAQEV--VATARPDIVDRNG 88

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            ILATD+   SL+ EP ++I  DE IE L   +P+LD   +R +L +   F WL+R+++P
Sbjct: 89  AILATDVKAASLFGEPRRIIDKDEAIELLTATVPDLDEAEVRERLKTRKGFVWLKREITP 148

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
           +QQ+ I   G+PG+GF  E  R YP  +  +H++G V+IDN+GI G+EK+LD QGL  + 
Sbjct: 149 KQQQDIHKLGIPGIGFLRENKRVYPTGNEVAHLIGLVNIDNQGIAGMEKWLDNQGLADLH 208

Query: 245 TTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                   LQ PI L++DLR+++ +  EL++ K+KY+ ++   ++ NV TGE+++MVS+P
Sbjct: 209 RAGFATDRLQKPIELSVDLRVEHALRDELLKAKEKYHTKAASGIVSNVKTGEIVAMVSLP 268

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DP+   +       NR++ G++EMGS FK FT+AM +DSG   +   +D R  +  GK
Sbjct: 269 DFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKINLNSSWDARGNLHYGK 328

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHD HP  R +   E+F +SSNIGAA+IA   G++ HK FL ++G L++L TELPE  
Sbjct: 329 FTIHDSHPLGRFINTKEVFTFSSNIGAARIALGQGVEAHKAFLAKMGQLTRLRTELPESA 388

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
           AP  P +W  ++++T +FG GLS  PLQ  +   AL+N G LIPPTFM RS  E+  +++
Sbjct: 389 APLIPRRWSELNTVTAAFGQGLSVAPLQAVMGINALVNGGYLIPPTFMKRSEAEAAALAK 448

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            V+K++T   MR L+R     G+ + A V G+ VGGKTGT++KVI  RY+     NSF A
Sbjct: 449 RVVKQDTSDKMRFLMRLNAEIGTAKTADVKGYYVGGKTGTSEKVINGRYAKKRVLNSFTA 508

Query: 544 VFPTTDPQYIVLSFMDSPKI--KERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           + P  DP+Y +L  +D P+   + +  +T+G N  P  G +I R A +LGV+P F
Sbjct: 509 IMPCDDPKYQILIMLDEPQAIPETKGFITSGWNAVPTGGRVIERIAPLLGVEPRF 563


>gi|115524114|ref|YP_781025.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|115518061|gb|ABJ06045.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 584

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 214/535 (40%), Positives = 334/535 (62%), Gaps = 6/535 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDE-YGMSRPDIIDRNGEI 126
           A ++ R+G  +V    IY ++  R++    +     A      E    +RPDI+DRNG +
Sbjct: 33  AKARARVGFAMVAFAAIYGVIGFRLVTIAMVGDSHNARRSGAHEAVATARPDILDRNGAV 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP +++  DE IE L   LP+LD+  +R +LSS   F WL+R+++P+Q
Sbjct: 93  LATDVKTPSLFSEPRRIVDKDEAIELLTATLPDLDTPEVRERLSSRKGFAWLKREITPRQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ I   G+PG+GF  E  R YP+    SH++G V+IDN+GI GIEK+LD  GL  +   
Sbjct: 153 QQDIKKLGIPGIGFLRENKRVYPSGPAVSHLIGLVNIDNQGIAGIEKWLDTNGLADLHRA 212

Query: 247 NKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 LQ P+ LA+DLR+++ +  EL++ ++KY A++   ++ NV TGE+++MVS+PD+
Sbjct: 213 GFASDRLQKPVELAIDLRVEHALRDELLKAQEKYKAKAASGLVSNVRTGEIVAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP++  +       NR++ G++EMGS FK  T+AM +DSG   +  L+D R  +  GK  
Sbjct: 273 DPNDPREAHDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKANLNTLYDARGALHYGKFA 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD H   R +T+ E+F +SSN+GAA++A + G++ H+ FL ++G L +L TELPE  +P
Sbjct: 333 IHDTHALGRSITLSEVFTFSSNVGAARVALSQGVEAHRAFLKKVGQLDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TI+FGHG++  PLQ  +   A+IN G LIPPTF+ RS +E+  +++ V
Sbjct: 393 IVPKRWGELNTITIAFGHGMAVAPLQAVMGINAMINGGYLIPPTFLKRSEQEAMLIAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRA--FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
           +KK T   +R ++R     G+ ++A     G+ +GGKTGT++KV+  RYS     NSF A
Sbjct: 453 IKKETSDKVRYMMRLNAEIGTAKQADQLAKGYYIGGKTGTSEKVVNGRYSKKQVLNSFTA 512

Query: 544 VFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPVF 596
           + P  +PQY +L  +D PK        +T+G N  P  G +I R A +LG++P F
Sbjct: 513 IMPADNPQYQLLVMLDEPKALPETHGFITSGWNAVPTGGKVIARIAPLLGLEPRF 567


>gi|90423691|ref|YP_532061.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|90105705|gb|ABD87742.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 582

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/543 (39%), Positives = 334/543 (61%), Gaps = 26/543 (4%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYG-----------MSRPD 118
           ++ R+G  ++    IY ++  R++    +           D +G            +RPD
Sbjct: 33  ARARVGFAMLAFAAIYSVIGFRLVTIAVVG----------DSHGGRRAAAQDAVATARPD 82

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I+DRNGE+LATD+ T SL+ EP ++I  DE +E L   LP+LD+  +R +LSS+  F WL
Sbjct: 83  IVDRNGEVLATDVKTPSLFGEPRRIIDQDEAVELLTATLPDLDTAEVRERLSSKKGFVWL 142

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R+++P QQ+ I   G+PG+GF  E  R YP+    SH++G V+IDN+GI GIEK+LD  
Sbjct: 143 KREITPLQQQEIRKLGIPGIGFLRENKRVYPSGPAVSHLIGLVNIDNQGIAGIEKWLDTN 202

Query: 239 GLTRVFTTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           GL  +         LQ P+ LA+DLR+++ +  EL++ K+KY+A++   ++ NV TGE++
Sbjct: 203 GLADLHRAGFASDRLQKPVELAVDLRVEHALRDELMKAKEKYSAKAASGLVSNVRTGEIV 262

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN 357
           +MVS+PD+DP+   +       NR++ G++EMGS FK  T+AM +DSG   +  L+D R 
Sbjct: 263 AMVSLPDFDPNNPREAHDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKANLNTLYDARG 322

Query: 358 PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLET 417
            +  GK  IHD H   R +T+ E+F YSSNIGAA++A A G++ HK FL ++G + +L T
Sbjct: 323 ALHFGKFAIHDSHSLGRAITLTEVFTYSSNIGAARVALAQGVEAHKAFLKKVGQMDRLRT 382

Query: 418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           ELPE  AP  P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ R+ ++
Sbjct: 383 ELPESAAPILPKRWSELNTITISFGHGIAVAPLQAVMGINAMVNGGYLIPPTFLKRTEQQ 442

Query: 478 SEKVSRIVLKKNTVKTMRSLLREGVTGGSGR--RAFVPGFEVGGKTGTAQKVIKKRYSDT 535
           + ++ + V++K+T   +R L+R     G+ +   A   G+ +GGKTGTA+KV+  RYS  
Sbjct: 443 ALEIGKRVVRKDTSDKIRYLMRLNAEIGTAKSAEAIAKGYYIGGKTGTAEKVVGGRYSKK 502

Query: 536 LNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVK 593
              NSF A+ P  +PQ+ VL  +D PK        +T+G N  P  G +I R A +LG+ 
Sbjct: 503 QVLNSFTAILPADNPQFQVLVMLDEPKALPETHGFITSGWNAVPAGGKVIARIAPLLGIA 562

Query: 594 PVF 596
           P F
Sbjct: 563 PRF 565


>gi|296448269|ref|ZP_06890163.1| Peptidoglycan glycosyltransferase [Methylosinus trichosporium OB3b]
 gi|296254221|gb|EFH01354.1| Peptidoglycan glycosyltransferase [Methylosinus trichosporium OB3b]
          Length = 582

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 223/537 (41%), Positives = 329/537 (61%), Gaps = 10/537 (1%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSR---PDIIDRN 123
           IA +  R+ +     L +Y+ +  R++  G   PEP  P+M            PD++DRN
Sbjct: 21  IAKTGGRMRLVAGGFLCLYLGIGARLVYLG-FKPEP--PTMRRAAADAVAAARPDVLDRN 77

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           GEILATD+ T S++ EP ++I  DE  E L  VLPN+D   +R +L S   F W++R+++
Sbjct: 78  GEILATDVKTMSVFAEPRRLIDKDEATELLTAVLPNVDPRELRERLGSRKGFVWVKREVT 137

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
           P Q+  +   GLPGVG   E  R YPA   A+HV+GYV+IDN GI GIEK++D QGL  +
Sbjct: 138 PHQRDEVFHLGLPGVGLLPENKRVYPAGPIAAHVLGYVNIDNAGIAGIEKYIDGQGLADL 197

Query: 244 --FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
             F  +   ++L+PI L++D+R  + +   L    + + A++    IL+V+TGEVI++ S
Sbjct: 198 HGFGFSVTPEDLRPISLSVDIRATHALRDVLARGVEHFKAKAGAAAILDVNTGEVIALAS 257

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +PDYDP++    + + + NR++ G++EMGS FK  TIAM +DSG   +    D R  +  
Sbjct: 258 LPDYDPNKPPDMRDQTYINRMNVGVYEMGSTFKALTIAMALDSGKINLNSRLDARGALSF 317

Query: 362 GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           G+  IHDYH QNR LT+PE+F YSSNIG A++A   G++ HK FL ++G LS++ TELPE
Sbjct: 318 GRFRIHDYHAQNRALTVPEVFTYSSNIGTARMALGQGVERHKAFLRKMGQLSRMRTELPE 377

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
              P  P  W  ++++TI+FGHGL+  PLQ  +A  AL+N G LI PTF+ RS  E++K 
Sbjct: 378 SAEPIVPRNWGELNTMTIAFGHGLAVAPLQAMMAVGALMNGGYLITPTFLKRSEAEAKKD 437

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
           +  V+K  T + MR L+R     G+ ++  V G+ VGGKTGTA+KV+ K YS    F +F
Sbjct: 438 APQVVKAETSEAMRYLMRLNAEIGTAKKVDVEGYYVGGKTGTAEKVVGKHYSKNRLFTTF 497

Query: 542 LAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           +AV P+  P+Y+ L+ MD P+   +     TA  N   +   II R+  +LG+ P F
Sbjct: 498 MAVAPSDKPKYLFLTIMDEPQGLPETHGYATAAYNSGAVTAQIIERTGPILGLPPRF 554


>gi|86749111|ref|YP_485607.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86572139|gb|ABD06696.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 584

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 221/537 (41%), Positives = 338/537 (62%), Gaps = 10/537 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIR---IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           A ++ R+G+ ++    +Y ++A +   I   G+ H      S   D    +RPDI+DRNG
Sbjct: 33  AKARARVGLAMLAFAAVYGVIAFKLTFIAVVGDSHGTRRTASQ--DAIATARPDIVDRNG 90

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            ILATD+ + SL+ EP ++I  DE +E L   LP+L++  +R +L+S+  F WL+R+++P
Sbjct: 91  TILATDVKSPSLFGEPRRIIDQDEAVELLTATLPDLETPEVRERLASKKGFVWLKREITP 150

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
           +QQ  I   G+PG+GF  E  R YP  +  SH++G V+IDN+GI GIEK+LD  GL  + 
Sbjct: 151 RQQADIKKLGIPGIGFLRENRRIYPTGTEVSHLIGLVNIDNQGIAGIEKWLDHNGLADLH 210

Query: 245 TTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                   LQ P+ LA+D+R+Q+ +  EL++ K KY A++   ++ NV+TGE+++MVS+P
Sbjct: 211 RAGFASDRLQKPVELAVDIRVQHALRDELLKAKDKYKAKAASGLVSNVNTGEIVAMVSLP 270

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DP+   +       NR++ G++EMGS FK  T+AM +DSG  T+  ++D R  ++ GK
Sbjct: 271 DFDPNNPREANDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKATLNSMYDARGALRYGK 330

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHD HP  R +++ E+F +SSN+GAA+IA +MG+  HK FL ++G L +L TELPE  
Sbjct: 331 FAIHDTHPLGRAISLSEVFTFSSNVGAARIALSMGVDAHKAFLKKVGQLDRLRTELPESA 390

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
           +P  P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF  RS +E++K+++
Sbjct: 391 SPIVPKRWGELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFHRRSEDEAQKMAK 450

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRA--FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            V+KK T   +R L+R     G+ R A     G+ +GGKTGT++KVI  RY+     NSF
Sbjct: 451 RVVKKETSDKIRYLMRLNAEIGTARTADQIAKGYYIGGKTGTSEKVINGRYAKKQVLNSF 510

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPVF 596
            AV P   PQ+ VL  +D PK        +T+G N  P  G +I R A +LG++P F
Sbjct: 511 TAVLPADHPQFQVLIMLDEPKPLPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|217979583|ref|YP_002363730.1| Peptidoglycan glycosyltransferase [Methylocella silvestris BL2]
 gi|217504959|gb|ACK52368.1| Peptidoglycan glycosyltransferase [Methylocella silvestris BL2]
          Length = 599

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/534 (39%), Positives = 333/534 (62%), Gaps = 4/534 (0%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           +  S  RI +   V + +Y ++A ++I +G    + I    + D    +RPDI+DRNG++
Sbjct: 38  LGKSPLRIKLVACVFIGLYAVIAGKLIYFGLHQEQSIGSKRSGDIVAAARPDILDRNGDV 97

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATDI   S++ EP ++I  DE +E L  VLP++D+  +R++L S   F W++R ++PQQ
Sbjct: 98  LATDIKVMSVFAEPRRIIDKDEAVELLTAVLPDVDASDLRKRLGSRKGFIWVKRAVTPQQ 157

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ +   GLPGVGF  E  R YP    A+HV+G+ ++D  GI+G+EK++D QGL  +   
Sbjct: 158 QQEVYRLGLPGVGFLPENKRVYPNGPIAAHVLGFANLDGVGISGLEKYIDGQGLADLHGA 217

Query: 247 --NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
             +   ++L PI  +LDL+    V  EL +   K+ A++   VIL+V+TGEV+++ S+PD
Sbjct: 218 GFSLTPESLAPITSSLDLKATYAVRDELAKGVAKFKAKAGAVVILDVNTGEVVALASLPD 277

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKH 364
           YDP+           NR+S G++EMGS FK  ++AM +D G   +    D R+ ++ G+ 
Sbjct: 278 YDPNTPADALDPNHINRVSVGVYEMGSTFKAISVAMALDQGKVNLNSRVDARSSLRYGRF 337

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            IHD+H QNR+LT+PE+F +SSNIGAA++A  +G++GHK FL ++G L++L TELPE   
Sbjct: 338 TIHDFHAQNRVLTVPEVFTFSSNIGAARLALMVGVEGHKAFLRKVGQLTRLHTELPETAD 397

Query: 425 PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRI 484
           P  P  W  ++++TI+FG GL+ +PLQ  +A  AL N G L+ PTF+ R  + +++ +  
Sbjct: 398 PLVPKNWGELNTMTIAFGQGLNVSPLQAMMAVGALANGGLLVNPTFLKRDEQAAKRNAPR 457

Query: 485 VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
           V+K  T +++R L+R     GS ++A +PG+ +GGKTGTA K++  RY+    F +F+A+
Sbjct: 458 VIKPETSESLRYLMRLNAEIGSAKKADIPGYFIGGKTGTADKIVHGRYAKDRVFTTFMAL 517

Query: 545 FPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
            P   P+Y++L+ MD P+   +     TA  N   + G II R   +LG+ P F
Sbjct: 518 MPADKPKYLILTLMDEPQGLPETAGYRTAAWNSGVVTGRIIERVGPLLGLPPRF 571


>gi|323137899|ref|ZP_08072974.1| Peptidoglycan glycosyltransferase [Methylocystis sp. ATCC 49242]
 gi|322396902|gb|EFX99428.1| Peptidoglycan glycosyltransferase [Methylocystis sp. ATCC 49242]
          Length = 600

 Score =  432 bits (1110), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/535 (40%), Positives = 324/535 (60%), Gaps = 6/535 (1%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM-SRPDIIDRNGE 125
           ++ S  R+ +     L +Y ++  +++  G   PEP        E    SRPDI+DRNGE
Sbjct: 39  LSSSAPRMKLAAFGFLALYGVIGAKLVYLG-FRPEPATTRRAAAEAVAASRPDILDRNGE 97

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           +LA+D+   S++ EP ++I  DE  E L  VLP++DS+ +R +L S+  F W++R+++P 
Sbjct: 98  VLASDVKVMSVFAEPRRLIDKDEATELLTAVLPDVDSKELRERLGSKKGFVWVKREVTPH 157

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           Q+  +   GLPGVG   E  R YP     +HV+G+ +IDN+GI G+EK++D QGL  +  
Sbjct: 158 QRDEVFHLGLPGVGLIAENKRVYPNGPIGAHVLGFANIDNQGIAGVEKYIDGQGLADLHN 217

Query: 246 TNKGE--KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
              G    +L+PI L+LD+R  + +  EL +    + A++    IL+V+TGEV++M S+P
Sbjct: 218 MGFGATPDDLKPISLSLDIRATHALRDELEKGVIHFKAKAGAAAILDVNTGEVVAMASLP 277

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           DYDP++          NR+S G++EMGS FK  TIAM +DSG   +    D R  +  G+
Sbjct: 278 DYDPNKPTDALDPLHINRMSVGVYEMGSTFKALTIAMALDSGKVNLNSRLDARGALSFGR 337

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHDYH QNR LT+PE+F YSSN+G A++A   G++ HK FL ++G L+++ TELPE  
Sbjct: 338 FKIHDYHAQNRALTVPEVFTYSSNVGTARMAMGQGVEKHKAFLRKMGQLTRMRTELPESA 397

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
            P  P  W  ++++TI+FGHGL+  PLQ  +A  AL+N G L+ PTF+ R+ EE+ K + 
Sbjct: 398 EPIVPKNWGELNTMTIAFGHGLAVAPLQAMMAVGALMNGGYLMTPTFLKRTPEEAMKTAV 457

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            V+K  T + MR L+R     G+ ++  + G+ VGGKTGTA+KVI   YS    F +F+A
Sbjct: 458 QVVKPETSEAMRYLMRLNAEIGTAKKVNIDGYFVGGKTGTAEKVIGGHYSKNRLFTTFMA 517

Query: 544 VFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           V P+  P+Y+ L+ MD P+   +     TA  N   + G II R   +LG+ P F
Sbjct: 518 VAPSDKPKYLFLTIMDEPQGLPETGGYATAAYNSGHVTGEIIERVGPILGLAPRF 572


>gi|182677679|ref|YP_001831825.1| peptidoglycan glycosyltransferase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633562|gb|ACB94336.1| Peptidoglycan glycosyltransferase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 614

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/533 (38%), Positives = 329/533 (61%), Gaps = 6/533 (1%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-PIAPSMNIDEYGMSRPDIIDRNGE 125
           ++ S  R  +  +  L +Y I+  +++ +G +HPE P     + D+   +RPD++DRNGE
Sbjct: 53  LSKSSGRAKLIALGFLGLYGIIGGKLVYFG-LHPEAPQEAKRSGDQVAAARPDLLDRNGE 111

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           +LATD+   S++ EP ++I  DE +E L  VLP++D+  +R++L S   F W++R ++P+
Sbjct: 112 VLATDVKVMSVFAEPRRIIDKDEAVELLTAVLPDIDARDLRQRLGSRKGFIWVKRAITPK 171

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           Q++ +   GLPGVGF  E  R YP    A+HV+G+ ++D  GI+G+EK++D QGL  +  
Sbjct: 172 QREEVHRLGLPGVGFLAENKRVYPNGPIAAHVLGFANLDGVGISGLEKYIDGQGLADLHG 231

Query: 246 T--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
              +  +++L+PI  +LDL+    V  EL +    + A++    IL+V+TGEVI+M S+P
Sbjct: 232 AGFSLTQQDLKPIVTSLDLKATYAVRDELAKGIAHFKAKAGAACILDVNTGEVIAMASLP 291

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           DYDP+           NR+S G++EMGS FK  +IAM ++     +    D R+ ++ G+
Sbjct: 292 DYDPNTPADALDPNHINRLSVGVYEMGSTFKAISIAMALEGNRVNLNSRIDARDSLRYGR 351

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHD+H Q+R+L++PE+F YSSNIG A++A  +G++GHK FL ++G L++L TELPE  
Sbjct: 352 FTIHDFHAQHRMLSVPEVFTYSSNIGTARMALMVGVEGHKAFLRKMGQLNRLTTELPESA 411

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
            P  P  W  ++++TI+FG GL+  PLQ  +A  AL+N G LI PTF+ RS EE+++   
Sbjct: 412 EPLVPRNWGELNTMTIAFGQGLNVAPLQATMAVGALVNGGLLIKPTFLKRSEEEAKRNVP 471

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            V++  T ++MR L+R     GS R   + G+ +GGKTGTA K++   Y+    F +F+A
Sbjct: 472 RVVRPETSESMRYLMRLNAEIGSARLVDIKGYFIGGKTGTADKIVHGHYAKDKVFTTFMA 531

Query: 544 VFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           + P   P+Y+ L+ MD P+   +     TA  N   +   II R+  +LG+ P
Sbjct: 532 IMPADKPKYLFLTLMDEPQGLPETGGYRTAAWNSGSVTARIIERTGPLLGIPP 584


>gi|220925314|ref|YP_002500616.1| penicillin-binding protein transpeptidase [Methylobacterium
           nodulans ORS 2060]
 gi|219949921|gb|ACL60313.1| penicillin-binding protein transpeptidase [Methylobacterium
           nodulans ORS 2060]
          Length = 595

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 221/541 (40%), Positives = 332/541 (61%), Gaps = 8/541 (1%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS--RPDIID 121
           R  +  S  R+ +  +V   ++ ++A R++    +  EP + +  +     +  RPDIID
Sbjct: 31  RFAVERSAARVNLVGLVFAAVFAVIAGRLVLTAALPEEPSSSAQRVAAAAATAIRPDIID 90

Query: 122 RNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           RNGEILATDI T SL+ EP  +   DE +E L  VLP L++  +R KLS++  F W++R+
Sbjct: 91  RNGEILATDIRTVSLFAEPRNIYDKDEAVELLTAVLPQLNARELREKLSTKKGFVWVKRE 150

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ  I   G+PG+GF  +  R YP    A+HV+G+ ++DN GI G+EK++D  GL 
Sbjct: 151 LTPKQQAEIHRLGIPGIGFLPDHKRVYPNGVAAAHVLGFANLDNVGIAGMEKYIDKTGLK 210

Query: 242 RVFTTNKGEK--NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
            +      EK  +L P++L++DLR Q+ V  EL      Y A++   +IL+V+TGEVI++
Sbjct: 211 DLNNLGFIEKSADLAPVQLSIDLRAQHAVRDELAWGMGHYRAKAAAAMILDVNTGEVIAL 270

Query: 300 VSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPI 359
            S+PD+DP+E          NR++ G++EMGS FK  T+AM ++SG FTV   FDTR  +
Sbjct: 271 ASLPDFDPNEPADALNPDRINRMNVGVYEMGSTFKAMTLAMALESGKFTVNSTFDTRGGV 330

Query: 360 -KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETE 418
              G+  IH+YH  NR++T+PE+F +SSNIG+A++A  +G+ GHK FL ++GLL ++ TE
Sbjct: 331 LHWGRQKIHEYHGTNRVITLPEVFTHSSNIGSAKMALGVGVPGHKAFLRKMGLLDRMRTE 390

Query: 419 LPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           LPE   P  P +W  I+++TI+FGHGL+  P+Q A A  A+ N G LI PTF+ R    +
Sbjct: 391 LPESAEPIIPPRWTEINTITIAFGHGLAVAPIQAAAAVGAITNGGFLITPTFLKRDEAAA 450

Query: 479 EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNF 538
            + +  VL   T + MR ++R   T GS ++A +P + VGGKTGTA+KVI  RY     F
Sbjct: 451 REKATQVLTPQTSEAMRFIMRLNATEGSAKKAAIPYYFVGGKTGTAEKVIGGRYVKNRLF 510

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPKI---KERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            +F+A  P   P+Y+ ++ MD P+    +     TA  N   + G II R A +LG+ P 
Sbjct: 511 TTFMAAAPMDKPKYLFVTIMDEPQAVASESGGYATAAWNSGVVTGRIIARVAPILGLPPQ 570

Query: 596 F 596
           F
Sbjct: 571 F 571


>gi|150377476|ref|YP_001314071.1| peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419]
 gi|150032023|gb|ABR64138.1| Peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419]
          Length = 577

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 220/535 (41%), Positives = 321/535 (60%), Gaps = 8/535 (1%)

Query: 68  AHSKN-RIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           AHS+  RI   +     I+  + +R++Q+G         S+  D     RP I+DRNGE+
Sbjct: 12  AHSRRVRIICIMAAFAAIFTGIFLRLVQFGMEQEASHGISITYDRAPGGRPAIVDRNGEL 71

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATDIP  SL++EP  +   DE +EKL  + P LD+  +  +L S+  F W++R+++P +
Sbjct: 72  LATDIPIASLFIEPRSIPDLDEAVEKLTGIFPELDARELHSRLRSKDAFTWIKRQITPDK 131

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ ++  GL  +GFR E  R YP  S A+H++G VDIDNRGI GIEK++D   L  +   
Sbjct: 132 QQAVIDSGLAAIGFRPENRRLYPNGSLAAHILGAVDIDNRGIAGIEKWIDANWLADLRGA 191

Query: 247 N---KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
               KG + LQ I L++DLR+Q  + QEL +   K+ A +   ++L+V+ GEV+++ S P
Sbjct: 192 GLELKG-RELQRIELSIDLRVQYALEQELGKAITKFGAAAGAGLLLDVTNGEVLALASYP 250

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DP+      K    NR++ G+FEMGS FK  T AM ++SG F ++ + D   P+  G+
Sbjct: 251 DFDPNNPENAFKPDRINRVTAGVFEMGSTFKALTTAMALESGRFNLESVVDASKPLNFGR 310

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHDY  + R LTIPE F +SSNI  A++A A+G +  + FL R G LS L TELPE  
Sbjct: 311 MRIHDYRGKYRPLTIPEAFVHSSNIVMAKMALALGPEASRTFLGRFGALSPLATELPESA 370

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
           AP  PS W  + + T+SFGHG++ TPLQ + A AAL N GRLI PTF+  S      ++ 
Sbjct: 371 APLLPSSWSEVATATVSFGHGIAVTPLQASTAVAALANGGRLIRPTFIKDSPVSERTIAE 430

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            ++  +T + +R LLR     GS  RA VPG+ +GGKTGTA+KV+  RYS  LN  SF+ 
Sbjct: 431 DLVSSDTSEAIRHLLRLNTAVGSATRANVPGYAIGGKTGTAEKVVGGRYSRELNVTSFMG 490

Query: 544 VFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           + P  +P+Y++L+ +D P+   +     T+G N  P  G + +R   ML V P F
Sbjct: 491 IVPADNPRYLLLTLLDEPRGLPETYGNRTSGWNAVPFGGAVFQRILPML-VAPTF 544


>gi|188584362|ref|YP_001927807.1| peptidoglycan glycosyltransferase [Methylobacterium populi BJ001]
 gi|179347860|gb|ACB83272.1| Peptidoglycan glycosyltransferase [Methylobacterium populi BJ001]
          Length = 602

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 221/548 (40%), Positives = 336/548 (61%), Gaps = 21/548 (3%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-------R 116
           R  I  S  R+ +  +    ++  + +R+I           P+ N DE+ ++       R
Sbjct: 37  RLAIERSHARVALVGLAFAAVFATIGVRLIVMA------ATPASNSDEHRVAAAATTTIR 90

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKV---ISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           PDIIDRNGEILATDI T S++ EP ++      DE +E L  VLP L++  +R KLSS+ 
Sbjct: 91  PDIIDRNGEILATDIRTVSVFAEPKRMARTFDTDEAVELLTAVLPELNAAELRAKLSSKK 150

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F W++R+++P+QQ  +   G+PGVGF  +  R YP    A+H++G  ++DN GI GIEK
Sbjct: 151 GFVWIKREITPKQQLEVHRLGIPGVGFLPDHKRVYPNGVAAAHIIGATNLDNIGIAGIEK 210

Query: 234 FLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           ++D +G   +  F     + +L P++L+LDLR Q  V  ELV+  +K+ A++  ++IL+V
Sbjct: 211 YIDNRGNKALNEFGLVAKQTDLSPVQLSLDLRAQFAVRDELVKGVEKFKAKAGASMILDV 270

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
           +TGEV+++ S PD+DP+E      +   NR++ G++EMGS FK  T+AM +DSG + V  
Sbjct: 271 TTGEVVALASYPDFDPNEPKDALSDDRINRMNVGVYEMGSTFKAMTLAMALDSGKYNVNS 330

Query: 352 LFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FDTR  +   G+  IHDYH   R+LT+PE+F +SSNIG+A++A  +G+ GH+ FL ++G
Sbjct: 331 TFDTRGGVLHWGRQKIHDYHATGRVLTMPEVFTHSSNIGSAKMALGVGVPGHRAFLKKMG 390

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           LL ++ TELPE  AP  P +W  I+++TI+FGHG++  P+Q A A AA+IN G L+ PTF
Sbjct: 391 LLDRMRTELPESAAPILPPRWAEINTITIAFGHGIAVAPIQAAAAVAAIINGGDLMTPTF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           +      +   +  VLK    + MR ++R   T GS ++A +P + VGGKTGTA+KVI  
Sbjct: 451 LKSDEATARAKASHVLKPEASEAMRFIMRLNATEGSAKKASIPLYYVGGKTGTAEKVING 510

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSAS 588
           RY+    F +F+A  P   P+Y+ L+ MD P+   +     TA  N   + G II R+A 
Sbjct: 511 RYAKNRLFTTFMAAAPMDKPKYLFLTIMDEPQGLPETGGYATAAYNSGTVTGKIIERAAP 570

Query: 589 MLGVKPVF 596
           +LG+ P F
Sbjct: 571 ILGLAPRF 578


>gi|307313437|ref|ZP_07593059.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C]
 gi|306899263|gb|EFN29899.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C]
          Length = 568

 Score =  415 bits (1066), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 216/528 (40%), Positives = 320/528 (60%), Gaps = 12/528 (2%)

Query: 79  VVCLV-----IYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           +VC++     I+    IR+ Q G          +  D     RP I+DRNG++LATDIP 
Sbjct: 19  IVCIMAAFATIFAGAFIRLAQLGMKEEAGRETRLPYDRAPGGRPAIVDRNGQLLATDIPI 78

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
            SLY+EP  +   DE +EKL  + P LD+  +  +L S+  F W++R++ P +Q+ ++  
Sbjct: 79  ASLYIEPRSIPDLDEAVEKLTAIFPELDAGELHSRLRSKDAFTWIKRQIPPDKQQAVIDS 138

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN---KGE 250
           GL  VGFR E  R YP  S A+H++G VDIDN GI GIEK++D   L  +       KG 
Sbjct: 139 GLAAVGFRPENQRLYPNGSLAAHILGAVDIDNFGIAGIEKWIDANWLADLRGAGLALKG- 197

Query: 251 KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEA 310
           ++LQP+ L++DLR+Q  + QEL +   K+ A +   ++L+V+ GE++++ S P +DP+  
Sbjct: 198 RDLQPVELSIDLRVQYAMEQELGKAVTKFGAAAGAGLLLDVTNGEILALASYPAFDPNNP 257

Query: 311 FKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH 370
               K    NR++ G+FEMGS FK  T AM ++SG F ++ + D   P+  G+  IHDY 
Sbjct: 258 VDAFKPDRINRVTAGVFEMGSTFKALTTAMALESGRFDLESVVDASRPLSFGRQRIHDYR 317

Query: 371 PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ 430
            + R LT+PE F +SSNI  A++A  +G +  + FL R G+LS+L TELPE  AP  PS 
Sbjct: 318 GKYRPLTVPEAFIHSSNIVMAKMAMTLGPEALRTFLGRFGVLSQLATELPESAAPLRPSS 377

Query: 431 WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNT 490
           W  + + T+SFGHG++ TPLQ ++A AAL N GRLI PTF+  S      ++  +L  NT
Sbjct: 378 WSEVTTATVSFGHGIAVTPLQASMAVAALANGGRLIRPTFIKDSPVSERTIAESLLSANT 437

Query: 491 VKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDP 550
            + +R LLR     GS  +A VPG+ +GGKTGTA+KVI+ RYS  LN  SF+ + P  +P
Sbjct: 438 SEAIRHLLRLNAAVGSATKADVPGYVIGGKTGTAEKVIQGRYSKVLNVTSFMGIVPADNP 497

Query: 551 QYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           +Y++L+ +D P+   +     T+G N  P+ G ++ R   ML +KPVF
Sbjct: 498 RYLLLTLLDEPRGLAETYGNRTSGWNAVPLGGALLHRILPML-LKPVF 544


>gi|254564003|ref|YP_003071098.1| peptidoglycan glycosyltransferase [Methylobacterium extorquens DM4]
 gi|254271281|emb|CAX27293.1| Peptidoglycan glycosyltransferase (penicillin-binding protein)
           [Methylobacterium extorquens DM4]
          Length = 625

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/548 (39%), Positives = 338/548 (61%), Gaps = 21/548 (3%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-------R 116
           R  I  S  R+ +  +    +++ +++R+I           P+ N DE+ ++       R
Sbjct: 60  RLAIERSHARVALVGLAFTAVFVTISVRLIVMA------ATPASNSDEHRVAAAATTAIR 113

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVI---SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           PDIIDRNGEILATDI T S++ EP +++     DE +E L  VLP L++  +R KLSS+ 
Sbjct: 114 PDIIDRNGEILATDIRTVSVFAEPKRMVRTFDTDEAVELLTAVLPELNAAELRAKLSSKK 173

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F W++R+++P+QQ  +   G+PGVGF  +  R YP    A+HV+G  ++DN GI GIEK
Sbjct: 174 GFVWIKREITPKQQLEVHRLGIPGVGFLPDHKRVYPNGVAAAHVIGATNLDNIGIAGIEK 233

Query: 234 FLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           ++D +G   +  F     + +L PI+L+LDLR Q  +  ELV+  +K+ A++  ++IL+V
Sbjct: 234 YIDNRGNKALNEFGLVAKQTDLSPIQLSLDLRAQFALRDELVKGVEKFKAKAGASMILDV 293

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
           +TGEV+++ S PD+DP+E      +   NR++ G++EMGS FK  T+AM +DSG + V  
Sbjct: 294 TTGEVVALASYPDFDPNEPKDALSDDRINRMNVGVYEMGSTFKAMTLAMALDSGKYNVNS 353

Query: 352 LFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FDTR  +   G+  IHDYH   R+LT+PE+F +SSNIG+A++A  +G+ GH+ FL ++G
Sbjct: 354 TFDTRGGVLHWGRQKIHDYHATGRVLTMPEVFTHSSNIGSAKMALGVGVPGHRAFLKKMG 413

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           LL ++ TELPE  +P  P +W  I+++TI+FGHG++  P+Q A A AA+IN G L+ PTF
Sbjct: 414 LLDRMRTELPESASPILPPRWAEINTITIAFGHGIAVAPIQAAAAVAAIINGGDLMTPTF 473

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           +      +   +  V+K    + MR ++R     GS ++A +P + VGGKTGTA+KVI  
Sbjct: 474 LKTDEPTARGKASHVMKPEASEAMRFIMRLNAVEGSAKKASIPLYYVGGKTGTAEKVING 533

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSAS 588
           RY+    F +F+A  P   P+Y+ L+ MD P+   +     TA  N   + G II R+A 
Sbjct: 534 RYAKNRLFTTFMAAAPMDKPKYLFLTIMDEPQGLPETGGYATAAYNSGTVTGKIIERAAP 593

Query: 589 MLGVKPVF 596
           +LG+ P F
Sbjct: 594 ILGLAPRF 601


>gi|163761061|ref|ZP_02168138.1| probable penicillin-binding transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162281612|gb|EDQ31906.1| probable penicillin-binding transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 416

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/398 (48%), Positives = 278/398 (69%), Gaps = 6/398 (1%)

Query: 50  CHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNI 109
            H+E     F+  R+     +KNRI + I    V+Y ++  R++ +G   PE ++     
Sbjct: 24  THLE-----FEGVRKAQGDQAKNRIIIAIACFGVLYSVIGGRLVYFGLKAPEIVSSINRS 78

Query: 110 DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL 169
           ++   SRPD++DRNGE+LATDI T SL+ EP+K++  DE +E L  VLP+LD   I RKL
Sbjct: 79  NQLLASRPDLLDRNGEVLATDIRTVSLFAEPNKIVDADEAVELLATVLPDLDLRDIHRKL 138

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
           SS ++FQWLRR+L+P+QQ +IL+ G+PGVGFR E  RFYP    ASHVVG+V+IDN+GI 
Sbjct: 139 SSNSRFQWLRRQLTPKQQSQILALGIPGVGFRPETRRFYPGGPTASHVVGHVNIDNKGIA 198

Query: 230 GIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
           G+EK++D QGL  +        ++L P+RL+LDLR+Q+++  EL     +Y A +   V+
Sbjct: 199 GMEKYVDGQGLGDLAAVGMTFNEDLNPVRLSLDLRVQHVLRDELAAAIDRYKAIAAAGVV 258

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           LN+ TGEV++M S+PDYDP+   +  ++   NR+S G +EMGS FK FT AM +DSG   
Sbjct: 259 LNIHTGEVLAMSSLPDYDPNNPVEALQKDRLNRMSAGTYEMGSTFKAFTTAMALDSGKVK 318

Query: 349 VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
           + D FD R  I++G   I D+H +NR+LT+PEIF YSSNIG A++AD +GI+GHKEFL R
Sbjct: 319 MTDSFDARGSIRIGGFTISDFHGKNRVLTVPEIFIYSSNIGTARMADLVGIEGHKEFLTR 378

Query: 409 LGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLS 446
           LGLL++++TELPE+  P  P++WK+I+S+TISFGHG+S
Sbjct: 379 LGLLTRMQTELPEVAMPHQPAEWKKINSITISFGHGVS 416


>gi|240141489|ref|YP_002965969.1| Peptidoglycan glycosyltransferase (penicillin-binding protein)
           [Methylobacterium extorquens AM1]
 gi|240011466|gb|ACS42692.1| Peptidoglycan glycosyltransferase (penicillin-binding protein)
           [Methylobacterium extorquens AM1]
          Length = 625

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/548 (39%), Positives = 338/548 (61%), Gaps = 21/548 (3%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-------R 116
           R  I  S  R+ +  +    +++ +++R+I           P+ N DE+ ++       R
Sbjct: 60  RLAIERSHARVALVGLAFTAVFVTISVRLIVMA------ATPASNSDEHRVAAAATTAIR 113

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVI---SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           PDIIDRNGEILATDI T S++ EP +++     DE +E L  VLP L++  +R KLSS+ 
Sbjct: 114 PDIIDRNGEILATDIRTVSVFAEPKRMVRTFDTDEAVELLTAVLPELNAAELRAKLSSKK 173

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F W++R+++P+QQ  +   G+PGVGF  +  R YP    A+HV+G  ++DN GI GIEK
Sbjct: 174 GFVWIKREITPKQQLEVHRLGIPGVGFLPDHKRVYPNGVAAAHVIGATNLDNIGIAGIEK 233

Query: 234 FLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           ++D +G   +  F     + +L PI+L+LDLR Q  +  ELV+  +K+ A++  ++IL+V
Sbjct: 234 YIDNRGNKALNEFGLVAKQTDLSPIQLSLDLRAQFALRDELVKGVEKFKAKAGASMILDV 293

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
           +TGEV+++ S PD+DP+E      +   NR++ G++EMGS FK  T+AM +DSG + V  
Sbjct: 294 TTGEVVALASYPDFDPNEPKDALSDDRINRMNVGVYEMGSTFKAMTLAMALDSGKYNVNS 353

Query: 352 LFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FDTR  +   G+  IHDYH   R+LT+PE+F +SSNIG+A++A  +G+ GH+ FL ++G
Sbjct: 354 TFDTRGGVLHWGRQKIHDYHATGRVLTMPEVFTHSSNIGSAKMALGVGVPGHRAFLKKMG 413

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           LL ++ TELPE  +P  P +W  I+++TI+FGHG++  P+Q A A AA+IN G L+ PTF
Sbjct: 414 LLDRMRTELPESASPILPPRWAEINTITIAFGHGIAVAPIQAAAAVAAIINGGDLMTPTF 473

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           +      +   +  V+K    + MR ++R     GS ++A +P + VGGKTGTA+KVI  
Sbjct: 474 LKTDEPTARGKASHVMKPEASEAMRFIMRLNAVEGSAKKASIPLYYVGGKTGTAEKVING 533

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSAS 588
           RY+    F +F+A  P   P+Y+ L+ MD P+   +     TA  N   + G II R+A 
Sbjct: 534 RYAKNRLFTTFMAAAPMDKPKYLFLTIMDEPQGLPETGGYATAAYNSGTVTGKIIERAAP 593

Query: 589 MLGVKPVF 596
           +LG+ P F
Sbjct: 594 ILGLAPRF 601


>gi|163854035|ref|YP_001642078.1| peptidoglycan glycosyltransferase [Methylobacterium extorquens PA1]
 gi|163665640|gb|ABY33007.1| Peptidoglycan glycosyltransferase [Methylobacterium extorquens PA1]
          Length = 625

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/548 (39%), Positives = 338/548 (61%), Gaps = 21/548 (3%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-------R 116
           R  I  S  R+ +  +    +++ +++R+I           P+ N DE+ ++       R
Sbjct: 60  RLAIERSHARVALVGLAFTAVFVTISVRLIVMA------ATPASNSDEHRVAAAATTAIR 113

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVI---SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           PDIIDRNGEILATDI T S++ EP +++     DE +E L  VLP L++  +R KLSS+ 
Sbjct: 114 PDIIDRNGEILATDIRTVSVFAEPKRMVRTFDTDEAVELLTAVLPELNAAELRAKLSSKK 173

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F W++R+++P+QQ  +   G+PGVGF  +  R YP    A+HV+G  ++DN GI GIEK
Sbjct: 174 GFVWIKREITPKQQLEVHRLGIPGVGFLPDHKRVYPNGVAAAHVIGATNLDNIGIAGIEK 233

Query: 234 FLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           ++D +G   +  F     + +L PI+L+LDLR Q  +  ELV+  +K+ A++  ++IL+V
Sbjct: 234 YIDNRGNKALNEFGLVAKQTDLSPIQLSLDLRAQFALRDELVKGVEKFKAKAGASMILDV 293

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
           +TGEV+++ S PD+DP+E      +   NR++ G++EMGS FK  T+AM +DSG + V  
Sbjct: 294 TTGEVVALASYPDFDPNEPKDALSDDRINRMNVGVYEMGSTFKAMTLAMALDSGKYNVNS 353

Query: 352 LFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FDTR  +   G+  IHDYH   R+LT+PE+F +SSNIG+A++A  +G+ GH+ FL ++G
Sbjct: 354 TFDTRGGVLHWGRQKIHDYHATGRVLTMPEVFTHSSNIGSAKMALGVGVPGHRAFLKKMG 413

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           LL ++ TELPE  +P  P +W  I+++TI+FGHG++  P+Q A A AA+IN G L+ PTF
Sbjct: 414 LLDRMRTELPESASPILPPRWAEINTITIAFGHGIAVAPIQAAAAVAAIINGGDLMTPTF 473

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           +      +   +  V+K    + MR ++R     GS ++A +P + VGGKTGTA+KVI  
Sbjct: 474 LKTDEPTARGKASHVMKPEASEAMRFIMRLNAVEGSAKKASIPLYYVGGKTGTAEKVING 533

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSAS 588
           RY+    F +F+A  P   P+Y+ L+ MD P+   +     TA  N   + G II R+A 
Sbjct: 534 RYAKNRLFTTFMAAAPMDKPKYLFLTIMDEPQGLPETGGYATAAYNSGTVTGKIIERAAP 593

Query: 589 MLGVKPVF 596
           +LG+ P F
Sbjct: 594 ILGLAPRF 601


>gi|218532978|ref|YP_002423794.1| peptidoglycan glycosyltransferase [Methylobacterium
           chloromethanicum CM4]
 gi|218525281|gb|ACK85866.1| Peptidoglycan glycosyltransferase [Methylobacterium
           chloromethanicum CM4]
          Length = 625

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/548 (39%), Positives = 338/548 (61%), Gaps = 21/548 (3%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-------R 116
           R  I  S  R+ +  +    +++ +++R+I           P+ N DE+ ++       R
Sbjct: 60  RLAIERSHARVALVGLAFTAVFVTISVRLIVMA------ATPASNSDEHRVAAAATTAIR 113

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVI---SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           PDIIDRNGEILATDI T S++ EP +++     DE +E L  VLP L++  +R KLSS+ 
Sbjct: 114 PDIIDRNGEILATDIRTVSVFAEPKRMVRTFDTDEAVELLTAVLPELNAAELRAKLSSKK 173

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F W++R+++P+QQ  +   G+PGVGF  +  R YP    A+HV+G  ++DN GI GIEK
Sbjct: 174 GFVWIKREITPKQQLEVHRLGIPGVGFLPDHKRVYPNGVAAAHVIGATNLDNIGIAGIEK 233

Query: 234 FLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           ++D +G   +  F     + +L PI+L+LDLR Q  +  ELV+  +K+ A++  ++IL+V
Sbjct: 234 YIDNRGNKALNEFGLVAKQTDLSPIQLSLDLRAQFALRDELVKGVEKFKAKAGASMILDV 293

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
           +TGEV+++ S PD+DP+E      +   NR++ G++EMGS FK  T+AM +DSG + V  
Sbjct: 294 TTGEVVALASYPDFDPNEPKDALSDDRINRMNVGVYEMGSTFKAMTLAMALDSGKYNVNS 353

Query: 352 LFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FDTR  +   G+  IHDYH   R+LT+PE+F +SSNIG+A++A  +G+ GH+ FL ++G
Sbjct: 354 TFDTRGGVLHWGRQKIHDYHATGRVLTMPEVFTHSSNIGSAKMALGVGVPGHRAFLKKMG 413

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           LL ++ TELPE  +P  P +W  I+++TI+FGHG++  P+Q A A AA+IN G L+ PTF
Sbjct: 414 LLDRMRTELPESASPILPPRWAEINTITIAFGHGIAVAPIQAAAAVAAIINGGDLMTPTF 473

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           +      +   +  V+K    + MR ++R     GS ++A +P + VGGKTGTA+KVI  
Sbjct: 474 LKTDEPTARGKASHVMKPEASEAMRFIMRLNAVEGSAKKASIPLYYVGGKTGTAEKVING 533

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSAS 588
           RY+    F +F+A  P   P+Y+ L+ MD P+   +     TA  N   + G II R+A 
Sbjct: 534 RYAKNRLFTTFMAAAPMDKPKYLFLTIMDEPQGLPETGGYATAAYNSGTVTGKIIERAAP 593

Query: 589 MLGVKPVF 596
           +LG+ P F
Sbjct: 594 ILGLAPRF 601


>gi|154252857|ref|YP_001413681.1| peptidoglycan glycosyltransferase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156807|gb|ABS64024.1| Peptidoglycan glycosyltransferase [Parvibaculum lavamentivorans
           DS-1]
          Length = 587

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/529 (38%), Positives = 319/529 (60%), Gaps = 7/529 (1%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           S+ RI + + + +  + ++  R++    +     +  +      + RPD++DRNGE++AT
Sbjct: 40  SQRRIFLALTIFVACFTLVGARLVGLAIVGNSMESTIIAAGPTQIHRPDVVDRNGEVMAT 99

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T SL+ +   VI P E  ++L  VLP+LD+  + RKL+S   F WL+R L+P+QQ  
Sbjct: 100 DIATASLFADGRYVIDPVETAQQLVSVLPDLDAADVARKLASGKAFIWLKRDLTPKQQYA 159

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR-VFTTNK 248
           +   GLPG+ FR EK R YP     S+V+G VD+DNRG  GIE+++D +   R  F   +
Sbjct: 160 VHYLGLPGLDFRNEKRRVYPNGKTGSNVLGMVDLDNRGTAGIERYMDRELARRDEFDLPR 219

Query: 249 GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            ++    + L+LDL +Q+ +  EL +  ++++A     VI++V TGEV++M S+PD+DP+
Sbjct: 220 FDRGTT-VMLSLDLHVQHALRDELEKAMREFSALGAAGVIMDVHTGEVVAMTSLPDFDPN 278

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD 368
           +      E  FNR + G++EMGS+FK  T+A  +DSG   +   FD   P+KV +  IHD
Sbjct: 279 DPMSSPDETRFNRATLGVYEMGSVFKAVTLAAALDSGKVDLNGSFDATKPLKVARFTIHD 338

Query: 369 YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP 428
           +H +NR L++PE+F +SSNIG A+IA  +G + H+ +L R GLL++ + ELPE  AP  P
Sbjct: 339 FHAENRWLSVPEVFIHSSNIGTAKIALQLGGEEHRAYLGRFGLLTRPDIELPEAGAPLLP 398

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
           ++W  + ++T S+GHG++ TPLQ   A + ++N G  + PTF+   R    ++   V+  
Sbjct: 399 ARWGELATITTSYGHGIAVTPLQVVSAVSTIVNGGFKVKPTFL---RHNEPRLGERVVST 455

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
            T   MR LLR  V  G+G++A VPGF V GKTGTA+K    RY+      SF++ FP  
Sbjct: 456 ETSNVMRGLLRMVVAEGTGKKADVPGFPVMGKTGTAEKPENGRYARNKLITSFISAFPAN 515

Query: 549 DPQYIVLSFMDSPKIKERN--QLTAGINVAPMVGNIIRRSASMLGVKPV 595
           DP+Y ++   D PK  +      TAG N AP+   ++ R A +LG++P 
Sbjct: 516 DPRYAMIVMFDEPKATKDTYGYATAGWNAAPVTARVVSRVAPLLGIRPA 564


>gi|170738611|ref|YP_001767266.1| peptidoglycan glycosyltransferase [Methylobacterium sp. 4-46]
 gi|168192885|gb|ACA14832.1| Peptidoglycan glycosyltransferase [Methylobacterium sp. 4-46]
          Length = 600

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 218/544 (40%), Positives = 333/544 (61%), Gaps = 11/544 (2%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS--RPDIID 121
           R  +  S  R+ +  VV   ++ ++  R++    I  EP + +  +     +  RPDI+D
Sbjct: 33  RFAVERSGARVNLVGVVFGGVFAVIIGRLVLTAAIPEEPSSQAQRVAAAAATAIRPDIVD 92

Query: 122 RNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK---FQWL 178
           RNGEILATDI T S + EP  ++  DE +E L  VLP+L++  +R KL+ + K   F W+
Sbjct: 93  RNGEILATDIRTVSAFAEPGNIVDKDEAVELLTAVLPDLNAAELRAKLTPKRKGAGFVWI 152

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R+L+P+QQ  +   G+PG+GF  +  R YP    A+HV+G+ ++DN GI G+EK++D  
Sbjct: 153 KRELTPKQQAEVHRLGIPGIGFLPDHKRVYPNGVAAAHVLGFANLDNVGIAGMEKYIDKT 212

Query: 239 GLTRVFTTNKGEK--NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           GL  +      EK  +L P++L++DLR Q+ V  EL    + Y A++   +IL+V+TGEV
Sbjct: 213 GLKDLNNLGFIEKSADLAPVQLSIDLRAQHAVRDELAWGMEHYRAKAAAAMILDVNTGEV 272

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           +++ S+PD+DP+E          NR++ G++EMGS FK  T+AM ++SG FTV   FDTR
Sbjct: 273 LALASLPDFDPNEPADALNPDRINRMNVGVYEMGSTFKAMTLAMALESGKFTVNSTFDTR 332

Query: 357 NPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
             +   G+  IH+YH  NR++T+PE+F +SSNIG+A++A  +G+ GHK FL ++GLL ++
Sbjct: 333 GGVLSWGRQKIHEYHGTNRVITMPEVFTHSSNIGSAKMALGVGVPGHKAFLKKMGLLDRM 392

Query: 416 ETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSR 475
            TELPE   P  P +W  I+++TI+FGHGL+  PLQ A A AA+ N G LI PTF+ R  
Sbjct: 393 RTELPESAEPIVPPRWTEINTITIAFGHGLAVAPLQAAAAVAAITNGGFLITPTFLRRDE 452

Query: 476 EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDT 535
             + + +  VL   T + MR ++R   T GS ++A  P + VGGKTGTA+KVI+  Y   
Sbjct: 453 AAAREKAVQVLTPQTSEAMRFIMRLNATEGSAKKADNPYYFVGGKTGTAEKVIRGHYVKN 512

Query: 536 LNFNSFLAVFPTTDPQYIVLSFMDSPK---IKERNQLTAGINVAPMVGNIIRRSASMLGV 592
             F +F+A  P   P+Y+ ++ MD P+    +     TA  N   + G I+ R A +LG+
Sbjct: 513 RLFTTFMAAAPMDKPKYLFVTVMDEPQAVAAESGGYATAAWNSGVVTGRILSRVAPILGL 572

Query: 593 KPVF 596
            P F
Sbjct: 573 PPKF 576


>gi|144897241|emb|CAM74105.1| Cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 586

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 218/545 (40%), Positives = 321/545 (58%), Gaps = 21/545 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP----SMNIDEYGMSRPD 118
           R + I  S+ R+ +T +V L I+ I+  R+I    +   P  P            M R D
Sbjct: 32  RSRAIETSRTRLLVTALVFLAIFGIIGGRMIDVAVLDANPAKPRALPQARTQGLEMGRAD 91

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISP----DEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           I DR+G +LAT +PT SLY  P  +I       E  +KL   LP++D++ +R ++     
Sbjct: 92  ITDRDGAVLATSLPTVSLYARPQDMIEARVDVAEAAKKLAAALPDMDADDVRARIQGAKT 151

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +LRR L+P+QQ  + + G+PG+ F   + R YP  +  +HVVG  DIDN+GI GIE+F
Sbjct: 152 FVYLRRNLTPRQQYDVNALGIPGLHFEKGERRVYPHGNLVAHVVGMTDIDNKGIAGIERF 211

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
            D           +  ++  P+ L+LD+ +QN+V  EL ++ +++NA     ++ +V TG
Sbjct: 212 FD----------GRLTEDSAPLALSLDVGVQNVVRTELQKSVQQFNALGATGMVADVQTG 261

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           E+++MVS+PD+DP++   G  E  FNR + G +EMGS FK+F  AM ++SG   +   FD
Sbjct: 262 EMLAMVSLPDFDPNDPPAGTNEAMFNRATKGAYEMGSTFKLFNTAMALESGRVNINSSFD 321

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
              P+K G H IHD H QNR +++PEI  +SSNIG+A++A   G    + F+ RLG+L  
Sbjct: 322 ATKPLKFGSHTIHDDHAQNRWMSVPEILIHSSNIGSARMALEAGSDFQRRFMGRLGMLDS 381

Query: 415 LETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              ELPE+ AP  PS W+ I+++TISFGHGLS TP Q      AL+N G   P T + R+
Sbjct: 382 PSLELPEVGAPQVPSPWREINTITISFGHGLSVTPAQLMAGTVALVNGGVFHPLTLIHRA 441

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSD 534
            + +     IVLK+ T   MR+L+R  VT G+G++A VPG+EVGGKTGTA+K     Y  
Sbjct: 442 -DGAPVPGEIVLKQKTSAHMRNLMRMVVTEGTGKKADVPGYEVGGKTGTAEKAAHGGYRK 500

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKER-NQLTAGINVAPMVGNIIRRSASMLGV 592
               +SF+A FP  +P+Y+V++ +D P+  KE    +TAG   AP  G II + A MLG+
Sbjct: 501 KAVLSSFVAAFPMDNPRYVVIAMIDEPQGTKETYGYITAGWTAAPAAGRIIAQIAPMLGI 560

Query: 593 KPVFL 597
            P  L
Sbjct: 561 APKAL 565


>gi|170748781|ref|YP_001755041.1| peptidoglycan glycosyltransferase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655303|gb|ACB24358.1| Peptidoglycan glycosyltransferase [Methylobacterium radiotolerans
           JCM 2831]
          Length = 630

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 217/556 (39%), Positives = 336/556 (60%), Gaps = 13/556 (2%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEY 112
           E  + L +   R  I  S  R+ M  +V + ++  ++ +++    I  EP +    +   
Sbjct: 52  ERAKALLRSMFRLAIERSHMRVAMVGLVFVGVFGTISAKLLMMA-IFGEPPSQEHRVAAA 110

Query: 113 GMS--RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS 170
             +  RPDIIDRNGEILATDI T S++ EP  +   DE +E L  VLP L++  +R KL+
Sbjct: 111 SSTAFRPDIIDRNGEILATDIRTVSVFAEPGNIYDKDEAVELLTAVLPELNASELRAKLT 170

Query: 171 SE-----TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDN 225
                    F W++R+L+P+QQ  +   G+PG+GF  +  R YP    A+H++G  ++D 
Sbjct: 171 QRKDKKGAGFVWVKRELTPKQQAEVHRLGIPGIGFLPDHKRVYPNGVAAAHILGATNLDG 230

Query: 226 RGITGIEKFLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
            GI G+EK++D  GL  +  F     + +L+P++L++DLR Q  V  EL      + A++
Sbjct: 231 VGIAGMEKYIDSTGLQALNSFGLINKQADLKPVQLSIDLRAQFAVRDELAWGIDHFKAKA 290

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
             ++IL+V TGEVI++VS+PD+DP++          NR++ G++EMGS FK  T+AM +D
Sbjct: 291 GASMILDVKTGEVIALVSMPDFDPNDPKDALSPDRINRMNVGVYEMGSTFKAMTLAMALD 350

Query: 344 SGLFTVKDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGH 402
           SG + V   FDTR  +   G+  IH+YH  NR++T+PE+F +SSNIG+A++A  +G+ GH
Sbjct: 351 SGKYNVNSTFDTRGGVLNWGRQKIHEYHGTNRVITMPEVFTHSSNIGSAKMALGVGVPGH 410

Query: 403 KEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
           K FL ++GLL +L TELPE  AP  PS+W  I+++TI+FGHG++  P+Q A A AA+ N 
Sbjct: 411 KAFLKKMGLLDRLRTELPESAAPIVPSRWTEINTITIAFGHGIAVAPIQAAAAVAAIANG 470

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTG 522
           G L+ PTF+  + E ++  +  VL   T + MR ++R   + GS ++A +P + VGGKTG
Sbjct: 471 GDLMTPTFLKTTPEAAKARAAHVLSGQTSEAMRYIMRLNASEGSAKKAAIPYYFVGGKTG 530

Query: 523 TAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVG 580
           TA+KVI  RY     F +F+A  P  DP+Y+ ++ MD P+   +     TA  N   + G
Sbjct: 531 TAEKVIGGRYIHNRLFTTFMAAAPMNDPKYLFVTIMDEPQGLPESGGYATAAWNSGVVTG 590

Query: 581 NIIRRSASMLGVKPVF 596
            +I R A +LG+ P F
Sbjct: 591 KVIERVAPILGLPPQF 606


>gi|163794521|ref|ZP_02188492.1| Cell division protein FtsI/penicillin-binding protein 2 [alpha
           proteobacterium BAL199]
 gi|159180245|gb|EDP64768.1| Cell division protein FtsI/penicillin-binding protein 2 [alpha
           proteobacterium BAL199]
          Length = 565

 Score =  395 bits (1016), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 205/538 (38%), Positives = 329/538 (61%), Gaps = 19/538 (3%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI--HPEPIAPSMNIDE-YGMSRPDII 120
           ++ I   +NR+ +   +  + ++ ++ R+++   +  H EP   + ++D    + R DI+
Sbjct: 15  KQAIETGRNRLILAGCLIGLAFVAVSARVVELSALRNHSEPALSASSVDTTLTVGRADIV 74

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNG ++AT + T SLY +P +V+  ++   +L   LP+++      KL+S+ +F WL+R
Sbjct: 75  DRNGLLVATSLRTPSLYADPKEVLDAEDAAFRLATALPDINPAETAAKLASDRRFVWLKR 134

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
            L+P++Q++I S G+PG+ F  E  R YP  S  +HVVG+ DID+RGI+G+E+  D    
Sbjct: 135 NLTPREQQQINSLGIPGLHFFDEWKRVYPQGSLTAHVVGFTDIDDRGISGVERSFD---- 190

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
                  +G +  +P+RLALDLR+Q+IV QEL +    + A     VI++V+TGE I+MV
Sbjct: 191 ----DVLRGGR--EPLRLALDLRVQHIVRQELAQQIATFEAIGGAGVIVDVNTGETIAMV 244

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           S+PD+D + A +   +  FNR + G++EMGS FK+F  AM +++G  T++  +D  NPIK
Sbjct: 245 SLPDFDSNVAGQMDPDALFNRATLGVYEMGSTFKIFNTAMALEAGTATMRSGYDATNPIK 304

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           + +  I DYH + R L++PEIF+YSSNIG+ ++A  +G +G + F+ +LG+L +   ELP
Sbjct: 305 ISRFTISDYHAKRRWLSVPEIFKYSSNIGSVKMAIDVGTEGQRAFMAKLGMLRETALELP 364

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           E+  P  P+ W+ I+++TI+FGHGLS +P+  A   AA++N G   P T +     ++  
Sbjct: 365 ELGRPMVPNPWRPINTMTIAFGHGLSVSPMHLAAGVAAMVNGGIRRPLTIL---ETDTPS 421

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFN 539
               ++ + T   MR L+R  V  G+GR+A   G+ VGGKTGTA+KV  +  Y      +
Sbjct: 422 PGERIISERTSHDMRRLMRLVVDDGTGRKADAEGYIVGGKTGTAEKVGGRGGYRRKALMS 481

Query: 540 SFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKPV 595
           SF+A FP   P+Y+VL  +D PK  + +    T G   AP +  II RSA +LGV PV
Sbjct: 482 SFVAAFPMQKPRYVVLVMVDEPKGTKESHGYATGGWVAAPAISRIIARSAPLLGVAPV 539


>gi|218507392|ref|ZP_03505270.1| cell division penicillin-binding protein [Rhizobium etli Brasil 5]
          Length = 374

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/355 (50%), Positives = 254/355 (71%), Gaps = 2/355 (0%)

Query: 214 ASHVVGYVDIDNRGITGIEKFLDMQGL--TRVFTTNKGEKNLQPIRLALDLRIQNIVHQE 271
           A+H++GYV+IDNRG+ G+EKF+D Q    +R+   ++         L++DLR+QNIV   
Sbjct: 2   AAHILGYVNIDNRGVAGMEKFIDDQRARRSRLGRHDQRSAARAGCGLSIDLRVQNIVRDA 61

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           +V     + ++  G  +++V TGEV++M S PD+DP++  +G KEGW NR++ G FEMGS
Sbjct: 62  VVNAVNNFQSKGAGAAVIDVHTGEVLAMASAPDFDPNDPQEGAKEGWLNRMTNGTFEMGS 121

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
            FK F++AM +D+G   + D FD   PI +G   IHD+H Q R LT+PEIF+YSSNIG A
Sbjct: 122 TFKTFSLAMALDTGKVKMSDTFDASKPIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTA 181

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQ 451
           ++ D +GI   K++L +LGLL+K++TELPE++ P+ P  WK+I+S+TISFGHG+STT LQ
Sbjct: 182 RVIDIVGIDAQKDYLNKLGLLTKMQTELPEVKMPTQPRVWKKINSITISFGHGVSTTALQ 241

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
           T VAAAAL+N G+LI PTF+ R+REE++++++ V+KK+T   +R LL      GSGR A 
Sbjct: 242 TGVAAAALVNGGKLIEPTFLPRTREEADQIAKQVIKKSTSDEIRYLLDFNGFKGSGRVAR 301

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           VPGF VG KTGTA KV+  RYS TLNFNSF+A FP  DP+Y V++F D PK  E+
Sbjct: 302 VPGFAVGSKTGTADKVVNGRYSATLNFNSFIAAFPINDPKYAVITFCDEPKTGEK 356


>gi|300021772|ref|YP_003754383.1| peptidoglycan glycosyltransferase [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299523593|gb|ADJ22062.1| Peptidoglycan glycosyltransferase [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 558

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/501 (39%), Positives = 302/501 (60%), Gaps = 16/501 (3%)

Query: 101 EPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
           EP+A S        SRPDI+DRNG +LATD+   S+Y +P  V+  DE++EKL  VLP++
Sbjct: 62  EPVATSF-------SRPDIVDRNGRLLATDLEAPSIYADPGVVLDRDELVEKLATVLPDI 114

Query: 161 DSEMIRRKLSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVG 219
           D + + R LS  ++ F W+RR +SP+  +R+   GLPG+ FR E  R YPA   A HV+G
Sbjct: 115 DQKELLRALSDRSRRFVWVRRGVSPKIAQRVHDLGLPGLSFRYELKRAYPAGLLAGHVLG 174

Query: 220 YVDIDNRGITGIEKFLDMQ-GLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKK 278
            V++DNRG+TGIEK++D   G   V   +   +   P+RL+LD+ +Q+ +  EL + ++K
Sbjct: 175 TVNVDNRGLTGIEKYIDDSVGTDPVHAASLSTR--MPVRLSLDIGVQHALEDELDDAEQK 232

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           Y A     ++LNV TGEV++  S P  +P    +   + + ++++ G +E+GS+FK  TI
Sbjct: 233 YRAAGSAGIVLNVKTGEVLASASTPRINPAWPSQAHDDKYLDKMTAGTYELGSVFKTLTI 292

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           AM +D GL     + D R P++VG+  + D+HP NR L++ E+F +SSNIGA  +A   G
Sbjct: 293 AMALDEGLAKPDTIIDVRKPLEVGRFTVTDFHPANRPLSVTEVFTHSSNIGAGMLALQAG 352

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
               + FL + G+LS L+TE   + AP  P +W +  ++TIS+GHGL+  PLQ A A A+
Sbjct: 353 PDKFEAFLRKFGMLSPLKTEEGPVAAPQLPPKWGKASTITISYGHGLAVAPLQFAAATAS 412

Query: 459 LINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFE 516
           ++N+G+ + PTF+ R   + +   + ++ + T + M  L+R  VT   G+G+ A VPG+ 
Sbjct: 413 VLNDGKPVHPTFLKRYGGD-QAAEKSLVTRTTSRDMARLMRLNVTAPDGTGKEADVPGYR 471

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGIN 574
           VGGKTGTA    +  YS     +SFL  FP  DPQY+    +  PK   + + Q TAG  
Sbjct: 472 VGGKTGTADMPGRGGYSSKSVISSFLGAFPMDDPQYVTFVILFDPKGTAETKGQHTAGYT 531

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP+   +I R A  LGV P 
Sbjct: 532 AAPVTSRLISRIAGQLGVAPT 552


>gi|83312941|ref|YP_423205.1| cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum magneticum AMB-1]
 gi|82947782|dbj|BAE52646.1| Cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum magneticum AMB-1]
          Length = 588

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 212/545 (38%), Positives = 315/545 (57%), Gaps = 21/545 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP----IAPSMNIDEYGMSRPD 118
           R + I   ++R+ +T +V L+ +  +  R++    +   P      P    DE  M R D
Sbjct: 31  RMQAIETGRSRLVVTAMVFLLAFAAIGARMVDVAVVDRNPPKAHAQPQARSDELQMERGD 90

Query: 119 IIDRNGEILATDIPTFSLYVEPHKV----ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           I DR G +LA+ +PT SL+  P  +    +  +    +L  VLP LD E    +LSS  +
Sbjct: 91  ISDRTGVLLASSLPTVSLFARPEDLKIAKVDVENAAIRLVTVLPELDLEETIERLSSGRQ 150

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +L+R L+P+QQ  + S G+PG+ F   + R YP    ASH VG  D+DN+G+ GIEK 
Sbjct: 151 FVYLKRNLTPRQQYDVNSLGIPGLLFEKGERRIYPHGPLASHAVGVTDVDNKGVAGIEKR 210

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
            +          N  +++ +P+ L+LD+R+Q IV  EL  + ++++A     ++++V TG
Sbjct: 211 FE----------NALKESREPLALSLDIRVQTIVRNELARSIEEFSAVGGTGMVMDVRTG 260

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           E+I+MVS+PD+DP++         FNR + G +EMGS FK+F  AM +D+G   +   FD
Sbjct: 261 ELIAMVSMPDFDPNDPPAPTDPSMFNRATKGAYEMGSTFKLFNTAMVLDNGRANLNSSFD 320

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
              P+    H IHD H  NR LTIPEI  +SSNIG+A++A   G +  + F+ R+G+L  
Sbjct: 321 ASKPLVFAGHTIHDDHALNRWLTIPEILIHSSNIGSARMALDAGTEVQRAFMARIGMLQA 380

Query: 415 LETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              ELPE+ AP  PS W+ I+++TISFGHGLS TPLQ     AAL+N G    PT + R+
Sbjct: 381 PPLELPEVGAPLVPSPWREINTVTISFGHGLSVTPLQLLAGTAALVNGGEYHAPTLLARA 440

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSD 534
             ++    R V+K  T + MR L+R  VT G+G++A VPG+EVGGKTGTA+KV    Y  
Sbjct: 441 PGDAVPAIR-VIKPKTSEAMRQLMRMVVTDGTGKKADVPGYEVGGKTGTAEKVGNGGYRK 499

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGV 592
               +SF+A FP   P+Y VL  +D P+  ++    +TAG   AP  G +I + A +LG+
Sbjct: 500 KAVLSSFIAAFPMDAPRYAVLMMIDEPQGTKQTYGFITAGWTAAPAAGRVIAQIAPLLGL 559

Query: 593 KPVFL 597
            P  L
Sbjct: 560 MPKTL 564


>gi|288958917|ref|YP_003449258.1| cell division protein [Azospirillum sp. B510]
 gi|288911225|dbj|BAI72714.1| cell division protein [Azospirillum sp. B510]
          Length = 624

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 202/533 (37%), Positives = 308/533 (57%), Gaps = 16/533 (3%)

Query: 66  VIAHSKNRIGMTIVVCLVIY----IILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIID 121
            +  S+ R+ +T  V   ++    + LA+  +  G         ++ +D    +R DI+D
Sbjct: 50  ALEQSRYRLMVTAAVVTTVFTAISVKLAMATLLAGGGGEARQHVALELDNTPTNRADILD 109

Query: 122 RNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           RNG +LAT + T SLY +P  V  P+E  +KL   LP+LD + +  KLS + +F WL+R 
Sbjct: 110 RNGNLLATSLVTQSLYADPKLVSRPEEAAQKLVSALPDLDYKDVLGKLSGDRRFVWLKRN 169

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ  +   G+PGV F  E+ RFYPA    +H+VG+  IDN G+ G+E     QG  
Sbjct: 170 LTPKQQAAVHRLGIPGVSFEREERRFYPAGPLTAHIVGFTGIDNNGLAGME-----QGFN 224

Query: 242 RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
           +  T   G     P++L++DLR+Q+++ +EL    ++++A     ++ +V  GEV++MVS
Sbjct: 225 KRLTEEPG----TPVQLSIDLRLQHVLKKELTATVQEFSAIGAAGIVFDVRNGEVLAMVS 280

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +PD+DP +      E  FNR + G++EMGS FK+F  A+  DSG   V D+FD  +P+K+
Sbjct: 281 LPDFDPQDPTGLNPETLFNRATLGVYEMGSTFKIFNSALAFDSGKIRVSDMFDAAHPVKI 340

Query: 362 GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           G+  I+DYH  +R LT+ E+F++SSN+G+ ++   +G+   K F+ ++G       ELPE
Sbjct: 341 GRFTINDYHNLHRALTVAEVFQHSSNLGSVRMIQLIGVAAQKAFMTKMGFTRPTGLELPE 400

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
              P  P+ W+ ++S TISFGHG+S +P+ T  AAA++IN G    PT + R   E E  
Sbjct: 401 SGWPLVPNPWREVNSYTISFGHGISVSPMHTVAAAASVINGGFFHKPTLLKRKAGE-EIP 459

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
           +  V+ + T   MR + R  VT G+G+ A V G+ VGGKTGTA K   K Y      +SF
Sbjct: 460 TEQVVSRQTSDMMRRMFRFVVTDGTGKTAAVKGYVVGGKTGTADKQKGKHYEKNSRMSSF 519

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGV 592
           L  FP  DP+YIV   +D PK   R     T G   AP VG I+++   +L V
Sbjct: 520 LGAFPMNDPRYIVYVLVDEPKGIARTGGFATGGTVGAPTVGRIVKQIGPLLNV 572


>gi|23014462|ref|ZP_00054277.1| COG0768: Cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum magnetotacticum MS-1]
          Length = 588

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 210/545 (38%), Positives = 315/545 (57%), Gaps = 21/545 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIH---PEPIA-PSMNIDEYGMSRPD 118
           R + I   ++R+ +T ++ L+ +  +  R++    I    P+P A P    DE  M R D
Sbjct: 31  RMQAIETGRSRLLITAMIFLLAFFAIGARMVDVAVIDRNPPKPNAQPQARTDELQMERAD 90

Query: 119 IIDRNGEILATDIPTFSLYVEPHKV----ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           I DR G +LA+ +PT SL+  P  +    +  +    +L  VLP LD E    +LSS  +
Sbjct: 91  ISDRTGVLLASSLPTVSLFARPEDLKLAKVDVENAAIRLVTVLPELDLEETIERLSSGRQ 150

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +L+R L+P+QQ  + S G+PG+ F   + R YP    ASH VG  D+DN+G+ GIEK 
Sbjct: 151 FVYLKRNLTPRQQYDVNSLGIPGLLFEKGERRIYPHGPLASHAVGVTDVDNKGVAGIEKR 210

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
            +          N   ++ +P+ L++D+R+Q IV  EL  + ++++A     ++++V TG
Sbjct: 211 FE----------NALRESSEPLALSIDIRVQTIVRNELARSVEEFSAVGGTGMVMDVRTG 260

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           E+I+MVS+PD+DP++         FNR + G +EMGS FK+F  AM +D+G   +   FD
Sbjct: 261 ELIAMVSLPDFDPNDPPAPTDSSMFNRATKGAYEMGSTFKLFNTAMVLDNGRANLNSTFD 320

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
              P+    H IHD H  NR LTIPEI  +SSNIG+A++A   G +  + F+ R+G+L  
Sbjct: 321 ATRPLVFAGHTIHDDHALNRWLTIPEILIHSSNIGSARMALDAGTETQRAFMARIGMLQA 380

Query: 415 LETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              ELPE+  P  P+ W+ I+++TI+FGHGLS TPLQ     AAL+N G    PT + RS
Sbjct: 381 PPLELPEVGGPLVPNPWREINTVTIAFGHGLSVTPLQLLAGTAALVNGGEYHTPTLLARS 440

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSD 534
             ++    R V+K  T + MR L+R  VT G+G++A VPG+EVGGKTGTA+K     Y  
Sbjct: 441 PGDAVPGIR-VIKPKTSENMRQLMRMVVTEGTGKKADVPGYEVGGKTGTAEKAGAGGYRK 499

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN--QLTAGINVAPMVGNIIRRSASMLGV 592
               +SF+A FP   P+Y VL  +D P+  ++    +TAG   AP  G +I + A +LG+
Sbjct: 500 KAVLSSFIAAFPMDAPRYAVLMMIDEPQATKQTFGFITAGWTAAPAAGRVIAQIAPLLGL 559

Query: 593 KPVFL 597
            P  L
Sbjct: 560 MPKTL 564


>gi|42521068|ref|NP_966983.1| penicillin-binding protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410809|gb|AAS14917.1| penicillin-binding protein [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 515

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 197/481 (40%), Positives = 294/481 (61%), Gaps = 21/481 (4%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           +PDI+DRNG ++AT++PT SLY++  KV +P+ I  +L   L +L+ + + R L+SE KF
Sbjct: 52  QPDILDRNGVVIATNVPTTSLYIDATKVKNPESIAAQLCSTLHDLEYKNLYRVLTSEKKF 111

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L+P++   I + G+PGV F  +  R YP ++  SHV+GY DID  GI G+E ++
Sbjct: 112 AWIKRHLTPKELLAIKNAGVPGVNFDDDIKRIYPHSNLFSHVLGYTDIDGNGIAGVEAYI 171

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
                      +K  +  +PI L+LD R+Q+IVH+EL +  ++Y A     ++LNV   E
Sbjct: 172 -----------SKNNEQEKPIILSLDTRVQSIVHEELTKAVRRYQALGGVGIVLNVRNSE 220

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           VISMVS+PD++P+   K +    FNR S G++EMGS+ K FTIA  +D+      DL+D 
Sbjct: 221 VISMVSLPDFNPNLQNKAEDVQKFNRASLGVYEMGSVLKYFTIAAALDANATKTSDLYDV 280

Query: 356 RNPIKVGKHVIHDYHPQNRI--LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PI +GK+ I D+H +++I  +T+ +IF  SSNIGAA+IA  +GI+   E+   + L S
Sbjct: 281 STPITIGKYKIQDFH-KSKIPKITVQDIFVKSSNIGAAKIAVKLGIEKQVEYFKAMKLFS 339

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
            L+ E+PE   P  P +W     +T S+G+G++ TP+  A  AAALIN G     T M+ 
Sbjct: 340 PLKIEIPEKSTPIIPDKWSETTLITASYGYGIAVTPIHLAQTAAALINNGIFHNATLMLN 399

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
            R   E+    ++ + T + MR LLR  VT G+GR+A +  + +GGKTG+A+KV+  +YS
Sbjct: 400 KRSIGEQ----IISRRTSREMRKLLRAAVTDGTGRKAKIKAYSIGGKTGSAEKVVDGKYS 455

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              N  SF+ V    DP+YIVL  +D P+       T GI  AP+V NII R A +L V 
Sbjct: 456 KDANIASFIGVLTMLDPRYIVLIAIDEPQGMHH---TGGIIAAPIVKNIINRIAPILNVT 512

Query: 594 P 594
           P
Sbjct: 513 P 513


>gi|225630926|ref|YP_002727717.1| penicillin-binding protein [Wolbachia sp. wRi]
 gi|225592907|gb|ACN95926.1| penicillin-binding protein [Wolbachia sp. wRi]
          Length = 515

 Score =  372 bits (955), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/481 (40%), Positives = 293/481 (60%), Gaps = 21/481 (4%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           +PDI+DRNG ++AT++PT SLY++  KV +P+ I  +L   L +L+ + + R L+SE KF
Sbjct: 52  QPDILDRNGVVIATNVPTTSLYIDATKVKNPESIAAQLCSTLHDLEYKNLYRVLTSEKKF 111

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L+P++   I + G+PGV F  +  R YP ++  SHV+GY DID  GI G+E ++
Sbjct: 112 AWIKRHLTPKELLAIKNAGVPGVNFYDDIKRIYPHSNLFSHVLGYTDIDGNGIAGVEAYI 171

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
                      +K  +  +PI L+LD R+Q+IVH+EL +   +Y A     ++LNV   E
Sbjct: 172 -----------SKNNEQEKPIILSLDTRVQSIVHEELTKAVSRYQALGGVGIVLNVRNSE 220

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           VISMVS+PD++P+   K +    FNR S G++EMGS+ K FTIA  +D+      DL+D 
Sbjct: 221 VISMVSLPDFNPNLQNKAEDVQKFNRASLGVYEMGSVLKYFTIAAALDANATKTSDLYDV 280

Query: 356 RNPIKVGKHVIHDYHPQNRI--LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PI +GK+ I D+H +++I  +T+ +IF  SSNIGAA+IA  +GI+   E+   + L S
Sbjct: 281 STPITIGKYKIQDFH-KSKIPKITVQDIFVKSSNIGAAKIAVKLGIEKQVEYFKAMKLFS 339

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
            L+ E+PE   P  P +W     +T S+G+G++ TP+  A  AAALIN G     T M+ 
Sbjct: 340 PLKIEIPEKSTPIIPDKWSENTLITASYGYGIAVTPIHLAQTAAALINNGIFHNATLMLN 399

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
            R   E+    ++ + T + MR LLR  VT G+GR+A +  + +GGKTG+A+KV+  +YS
Sbjct: 400 KRSIGEQ----IISRRTSREMRKLLRAAVTDGTGRKAKIKAYSIGGKTGSAEKVVDGKYS 455

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              N  SF+ V    DP+YIVL  +D P+       T G+  AP+V NII R A +L V 
Sbjct: 456 KDANIASFIGVLTMLDPRYIVLIAIDEPQGMHH---TGGVIAAPIVRNIINRVAPILNVT 512

Query: 594 P 594
           P
Sbjct: 513 P 513


>gi|58698180|ref|ZP_00373102.1| penicillin-binding protein [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58535330|gb|EAL59407.1| penicillin-binding protein [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 507

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/481 (40%), Positives = 293/481 (60%), Gaps = 21/481 (4%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           +PDI+DRNG ++AT++PT SLY++  KV +P+ I  +L   L +L+ + + R L+SE KF
Sbjct: 44  QPDILDRNGVVIATNVPTTSLYIDATKVKNPESIAAQLCSTLHDLEYKNLYRVLTSEKKF 103

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L+P++   I + G+PGV F  +  R YP ++  SHV+GY DID  GI G+E ++
Sbjct: 104 AWIKRHLTPKELLAIKNAGVPGVNFYDDIKRIYPHSNLFSHVLGYTDIDGNGIAGVEAYI 163

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
                      +K  +  +PI L+LD R+Q+IVH+EL +   +Y A     ++LNV   E
Sbjct: 164 -----------SKNNEQEKPIILSLDTRVQSIVHEELTKAVSRYQALGGVGIVLNVRNSE 212

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           VISMVS+PD++P+   K +    FNR S G++EMGS+ K FTIA  +D+      DL+D 
Sbjct: 213 VISMVSLPDFNPNLQNKAEDVQKFNRASLGVYEMGSVLKYFTIAAALDANATKTSDLYDV 272

Query: 356 RNPIKVGKHVIHDYHPQNRI--LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PI +GK+ I D+H +++I  +T+ +IF  SSNIGAA+IA  +GI+   E+   + L S
Sbjct: 273 STPITIGKYKIQDFH-KSKIPKITVQDIFVKSSNIGAAKIAVKLGIEKQVEYFKAMKLFS 331

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
            L+ E+PE   P  P +W     +T S+G+G++ TP+  A  AAALIN G     T M+ 
Sbjct: 332 PLKIEIPEKSTPIIPDKWSENTLITASYGYGIAVTPIHLAQTAAALINNGIFHNATLMLN 391

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
            R   E+    ++ + T + MR LLR  VT G+GR+A +  + +GGKTG+A+KV+  +YS
Sbjct: 392 KRSIGEQ----IISRRTSREMRKLLRAAVTDGTGRKAKIKAYSIGGKTGSAEKVVDGKYS 447

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              N  SF+ V    DP+YIVL  +D P+       T G+  AP+V NII R A +L V 
Sbjct: 448 KDANIASFIGVLTMLDPRYIVLIAIDEPQGMHH---TGGVIAAPIVRNIINRVAPILNVT 504

Query: 594 P 594
           P
Sbjct: 505 P 505


>gi|99034496|ref|ZP_01314483.1| hypothetical protein Wendoof_01000711 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 515

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 198/481 (41%), Positives = 293/481 (60%), Gaps = 21/481 (4%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           +PDI+DRNG ++AT++PT SLY++  KV +P+ I  +L   L +L+ + + R L+SE KF
Sbjct: 52  QPDILDRNGVVIATNVPTTSLYIDATKVKNPESIAAQLCSTLHDLEYKNLYRVLTSEKKF 111

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L+P++   I + G+PGV F  +  R YP ++  SHV+GY DID  GI G+E ++
Sbjct: 112 AWIKRHLTPKELLAIKNAGVPGVNFDDDIKRIYPHSNLFSHVLGYTDIDGNGIAGVEAYI 171

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
                      N+ EK+   I L+LD R+Q+IVH+EL +   +Y A     ++LNV   E
Sbjct: 172 S--------KNNEQEKH---IILSLDTRVQSIVHEELTKAVSRYQALGGVGIVLNVRNSE 220

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           VISMVS+PD++P+   K +    FNR S G++EMGS+ K FTIA  +D+      DL+D 
Sbjct: 221 VISMVSLPDFNPNLQNKAEDVQKFNRASLGVYEMGSVLKYFTIAAALDANATKTSDLYDV 280

Query: 356 RNPIKVGKHVIHDYHPQNRI--LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PI +GK+ I D+H +++I  +T+ +IF  SSNIGAA+IA  +GI+   E+   + L S
Sbjct: 281 STPITIGKYKIQDFH-KSKIPKITVQDIFVKSSNIGAAKIAVKLGIEKQVEYFKAMKLFS 339

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
            L+ E+PE   P  P +W     +T S+G+G++ TP+  A  AAALIN G     T M+ 
Sbjct: 340 PLKIEIPEKSTPIIPDKWSETTLITASYGYGIAVTPIHLAQTAAALINNGIFHNATLMLN 399

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
            R   E+    ++ + T + MR LLR  VT G+GR+A +  + +GGKTG+A+KV+  +YS
Sbjct: 400 KRSIGEQ----IISRRTSREMRKLLRAAVTDGTGRKAKIKAYSIGGKTGSAEKVVDGKYS 455

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              N  SF+ V    DP+YIVL  +D P+       T GI  AP+V NII R A +L V 
Sbjct: 456 KDANIASFIGVLTMLDPRYIVLIAIDEPQGMHH---TGGIIAAPIVKNIINRIAPILNVT 512

Query: 594 P 594
           P
Sbjct: 513 P 513


>gi|83592292|ref|YP_426044.1| peptidoglycan glycosyltransferase [Rhodospirillum rubrum ATCC
           11170]
 gi|83575206|gb|ABC21757.1| Peptidoglycan glycosyltransferase [Rhodospirillum rubrum ATCC
           11170]
          Length = 599

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 205/536 (38%), Positives = 319/536 (59%), Gaps = 24/536 (4%)

Query: 72  NRIGMTIVVCL--VIYIILAIRIIQYGNIHP--EPIAPSMNID---EYGMSRPDIIDRNG 124
            R+ + +  CL  + + ++  R++Q   +    EP+A     D   E  M+R DI+DRNG
Sbjct: 45  GRMRLMVAACLFGLAFSVIGGRLVQLMVVRGPGEPVAVVSAEDTPIETRMARADIVDRNG 104

Query: 125 EILATDIPTFSLYVEPHKVISPDEI--IEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
            +LAT++PT +LY +   +   D +  I  L  + P L    +  K+     F +LRR L
Sbjct: 105 LVLATNLPTVNLYADTRAIPERDRLRAIAVLPTLFPELTVADLTNKMVPGRAFIYLRRNL 164

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +P +Q+ +   G+PG+ F   + R YPA    +HVVG  D+DN GI G+EK         
Sbjct: 165 TPSEQQSVNDLGIPGLHFERSERRVYPAGRLVAHVVGATDVDNNGIAGLEK--------- 215

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
            F +     +L P+RL+LD+R+Q+ +H+ L ++   + A     ++++V T EV++MVS+
Sbjct: 216 AFESKLTSSDL-PLRLSLDIRVQHAIHRALQDSIDHFQAIGGAALVMDVETAEVVAMVSL 274

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PDY+P +     ++  FNR + G+FEMGS FK+F  A+ +D+GL  + + FD RNPI++ 
Sbjct: 275 PDYEPEKIGAASEDARFNRATLGVFEMGSTFKLFNTALALDAGL-KLSESFDARNPIRIS 333

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
           +  I D+HP+ R L+IPEI  YSSN+G+A++A A+G    +EFL R+GLL  +  E+PE+
Sbjct: 334 RFTITDFHPEGRWLSIPEILMYSSNLGSARMAVAVGTDRQREFLGRMGLLDAIPFEIPEV 393

Query: 423 QAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
             P  P+ W+ + ++TISFGHGLS TPL      +AL+N G L PPT ++RS E +    
Sbjct: 394 GRPLVPNPWREVSTMTISFGHGLSVTPLHLVTGVSALVNGGLLRPPTLLLRSPETTPAGK 453

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFNSF 541
           +++  +N+   MR+L+R  V  GSG+ A V G+ +GGKTG+A+K      YS +    SF
Sbjct: 454 QVLTTQNST-AMRALMRLVVEAGSGKNADVKGYYIGGKTGSAEKEGASGGYSKSAVRTSF 512

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKE--RNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           + VFP T P+Y+V++ +D PK  +      TAG N  P VG +I   A +LGV+PV
Sbjct: 513 VGVFPMTKPRYVVMAMLDDPKAVKGTYGYRTAGWNATPTVGRMIAEIAPLLGVQPV 568


>gi|222475019|ref|YP_002563434.1| penicillin-binding protein (pbpA2) [Anaplasma marginale str.
           Florida]
 gi|255002998|ref|ZP_05277962.1| penicillin-binding protein (pbpA2) [Anaplasma marginale str. Puerto
           Rico]
 gi|222419155|gb|ACM49178.1| penicillin-binding protein (pbpA2) [Anaplasma marginale str.
           Florida]
          Length = 529

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 199/534 (37%), Positives = 321/534 (60%), Gaps = 21/534 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R + +  SK R+    +  +V +II+  R+I    +  E I P+++ +     R  I+DR
Sbjct: 14  RNETLNKSKKRLLCATIPFVVFFIIITFRLITLTAVPHEEIKPAVSKNAQPKGRFTILDR 73

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NGEILATDI T SL  +   + +P+ +IEK+  +L + DSE IRR LS + KF W++R +
Sbjct: 74  NGEILATDIATVSLSADTTVMSNPELVIEKVSAILHD-DSERIRRLLSPKKKFIWIKRDI 132

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +  +   I    L G+    E  R YP  +  SH++GYVD D RGI+GIE++ D+ G+  
Sbjct: 133 TSTEAAEIKEARLKGLHLTQEVKRVYPHNNLLSHILGYVDPDGRGISGIERYADIFGV-- 190

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                +G+     ++L++D+R+QN+V +E++   +KYNA +   ++++V  GE+++ VS+
Sbjct: 191 -----QGD-----VKLSVDVRVQNVVREEILRQMEKYNAAAGIGIVMDVRNGEILAAVSL 240

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+D +   K +    FNR++ G++EMGS+FK+FT+A  IDSG  +V+D +D   P  +G
Sbjct: 241 PDFDLNNRSKAENYQKFNRVTLGVYEMGSVFKLFTVASAIDSGKVSVEDTYDVSQPFIIG 300

Query: 363 KHVIHD-YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           ++ ++D Y  ++ +L++ EIF  SSN+G A+IA  +G     E+  R+ LLS L  E+PE
Sbjct: 301 RYKVNDMYKSRSPVLSVREIFAQSSNVGMAKIAMDLGKDIQLEYFERMDLLSDLGLEIPE 360

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
           +  P +P +W      T S+G+G++ TP+    AAA L+N+G +   T +     E    
Sbjct: 361 VGFPIFPREWSNSTVATASYGYGVAVTPVHVVQAAAGLVNDGIMHDATLIFGKGTE---- 416

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            R V+   T + ++ LLR  V  G+G+RA V G+ VGGKTG+A+KVI  RY    N  SF
Sbjct: 417 GRRVVSSETSRKVKQLLRFAVERGTGKRANVKGYLVGGKTGSAEKVIDGRYRKDANLASF 476

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           L +FP ++P+Y ++  +D PK    +++T G   AP+VG II R A +L + PV
Sbjct: 477 LGIFPISEPKYAIMVMIDEPK---GSKVTGGAVSAPVVGRIISRMAPILSIAPV 527


>gi|254994866|ref|ZP_05277056.1| penicillin-binding protein (pbpA2) [Anaplasma marginale str.
           Mississippi]
          Length = 529

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 199/534 (37%), Positives = 321/534 (60%), Gaps = 21/534 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R + +  SK R+    +  +V +II+  R+I    +  E I P+++ +     R  I+DR
Sbjct: 14  RNETLNKSKKRLLCATIPFVVFFIIITFRLITLTAVPHEEIKPAVSKNAQPKGRFTILDR 73

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NGEILATDI T SL  +   + +P+ +IEK+  +L + DSE IRR LS + KF W++R +
Sbjct: 74  NGEILATDIATVSLSADTTVMSNPELVIEKVSAILHD-DSERIRRLLSPKKKFIWIKRDI 132

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +  +   I    L G+    E  R YP  +  SH++GYVD D RGI+GIE++ D+ G+  
Sbjct: 133 TSTEAAEIKEARLKGLHLTQEVKRVYPHNNLLSHILGYVDPDGRGISGIERYADIFGV-- 190

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                +G+     ++L++D+R+QN+V +E++   +KYNA +   ++++V  GE+++ VS+
Sbjct: 191 -----QGD-----VKLSVDVRVQNVVREEILRQMEKYNAAAGIGIVMDVRNGEILAAVSL 240

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+D +   K +    FNR++ G++EMGS+FK+FT+A  IDSG  +V+D +D   P  +G
Sbjct: 241 PDFDLNNRSKAENYQKFNRVTLGVYEMGSVFKLFTVASAIDSGKVSVEDTYDVSQPFIIG 300

Query: 363 KHVIHD-YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           ++ ++D Y  ++ +L++ EIF  SSN+G A+IA  +G     E+  R+ LLS L  E+PE
Sbjct: 301 RYKVNDMYKSRSPVLSVREIFAQSSNVGMAKIAMDLGKDIQLEYFERMDLLSDLGLEIPE 360

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
           +  P +P +W      T S+G+G++ TP+    AAA L+N+G +   T +     E    
Sbjct: 361 VGFPIFPREWGNSTVATASYGYGVAVTPVHVVQAAAGLVNDGIMHDATLIFGKGTE---- 416

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            R V+   T + ++ LLR  V  G+G+RA V G+ VGGKTG+A+KVI  RY    N  SF
Sbjct: 417 GRRVVSSETSRKVKQLLRFAVERGTGKRANVKGYLVGGKTGSAEKVIDGRYRKDANLASF 476

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           L +FP ++P+Y ++  +D PK    +++T G   AP+VG II R A +L + PV
Sbjct: 477 LGIFPISEPKYAIMVMIDEPK---GSKVTGGAVSAPVVGRIISRMAPILSIAPV 527


>gi|56416655|ref|YP_153729.1| penicillin-binding protein [Anaplasma marginale str. St. Maries]
 gi|56387887|gb|AAV86474.1| penicillin-binding protein [Anaplasma marginale str. St. Maries]
          Length = 529

 Score =  367 bits (942), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 198/534 (37%), Positives = 321/534 (60%), Gaps = 21/534 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R + +  SK R+    +  +V +II+  R+I    +  E I P+++ +     R  I+DR
Sbjct: 14  RNETLNKSKKRLLCATIPFVVFFIIITFRLITLTAVPHEEIKPAVSKNAQPKGRFTILDR 73

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NGEILATDI T SL  +   + +P+ +IEK+  +L + DSE IRR LS + KF W++R +
Sbjct: 74  NGEILATDIATVSLSADTTVMSNPELVIEKVSAILHD-DSERIRRLLSPKKKFIWIKRDI 132

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +  +   I    L G+    E  R YP  +  SH++GYVD D RGI+GIE++ D+ G+  
Sbjct: 133 TSTEAAEIKEARLKGLHLTQEVKRVYPHNNLLSHILGYVDPDGRGISGIERYADIFGV-- 190

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                +G+     ++L++D+R+QN+V +E++   +KYNA +   ++++V  GE+++ VS+
Sbjct: 191 -----QGD-----VKLSVDVRVQNVVREEILRQMEKYNAAAGIGIVMDVRNGEILAAVSL 240

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+D +   K +    FNR++ G++EMGS+FK+FT+A  IDSG  +V+D +D   P  +G
Sbjct: 241 PDFDLNNRSKAENYQKFNRVTLGVYEMGSVFKLFTVASAIDSGKVSVEDTYDVSQPFIIG 300

Query: 363 KHVIHD-YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           ++ ++D Y  ++ +L++ EIF  SSN+G A+IA  +G     E+  R+ LLS L  E+PE
Sbjct: 301 RYKVNDMYKSRSPVLSVREIFAQSSNVGMAKIAMDLGKDIQLEYFERMDLLSDLGLEIPE 360

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
           +  P +P +W      T S+G+G++ TP+    AAA L+N+G +   T +     E    
Sbjct: 361 VGFPIFPREWSNSTVATASYGYGVAVTPVHVVQAAAGLVNDGIMHDATLIFGKGTE---- 416

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            R V+   T + ++ LLR  V  G+G+RA V G+ VGGKTG+A+KV+  RY    N  SF
Sbjct: 417 GRRVVSSETSRKVKQLLRFAVERGTGKRANVKGYLVGGKTGSAEKVMDGRYRKDANLASF 476

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           L +FP ++P+Y ++  +D PK    +++T G   AP+VG II R A +L + PV
Sbjct: 477 LGIFPISEPKYAIMVMIDEPK---GSKVTGGAVSAPVVGRIISRMAPILSIAPV 527


>gi|269958929|ref|YP_003328718.1| penicillin-binding protein [Anaplasma centrale str. Israel]
 gi|269848760|gb|ACZ49404.1| penicillin-binding protein [Anaplasma centrale str. Israel]
          Length = 529

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 198/534 (37%), Positives = 321/534 (60%), Gaps = 21/534 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R + +  SK R+    +  +V +II+  R+I    +  E I P+++ +     R  I+DR
Sbjct: 14  RNETLNKSKKRLLCATIPFVVFFIIITFRLITLTAVPHEEIKPAVSKNAQPKGRFTILDR 73

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NGEILATDI T SL  +   + +P+ +IEK+  +L + DSE IRR LS + KF W++R +
Sbjct: 74  NGEILATDIATVSLSADTTVMSNPELVIEKVSAILHD-DSERIRRLLSPKKKFIWIKRDI 132

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           +  +   I    L G+    E  R YP  +  SH++GYVD D RGI+GIE++ D+ G+  
Sbjct: 133 TSTEAAEIKEARLKGLHLTQEVKRVYPHNNLLSHILGYVDPDGRGISGIERYADIFGV-- 190

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                +G+     ++L++D+R+QN+V +E++   +KYNA +   ++++V  GE+++ VS+
Sbjct: 191 -----QGD-----VKLSVDVRVQNVVREEILRQMEKYNAAAGIGIVMDVRNGEILAAVSL 240

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+D +   K +    FNR++ G++EMGS+FK+FT+A  IDSG  +V+D +D   P  +G
Sbjct: 241 PDFDLNNRSKAENYQKFNRVTLGVYEMGSVFKLFTVASAIDSGKVSVEDTYDVSQPFIIG 300

Query: 363 KHVIHD-YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           ++ ++D Y  ++ +L++ EIF  SSN+G A+IA  +G     E+  R+ LLS L  E+PE
Sbjct: 301 RYKVNDMYKSRSPVLSVREIFAQSSNVGMAKIAMDLGKDIQLEYFERMDLLSDLGLEIPE 360

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
           +  P +P +W      T S+G+G++ TP+    AAA L+N+G +   T +     E    
Sbjct: 361 VGFPIFPREWGNSTVATASYGYGVAVTPVHVVQAAAGLVNDGIMHDATLIFGKGTE---- 416

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            R V+   T + ++ LLR  V  G+G+RA V G+ VGGKTG+A+KV+  RY    N  SF
Sbjct: 417 GRRVVSSETSRKVKQLLRFAVERGTGKRANVKGYLVGGKTGSAEKVMDGRYRKDANLASF 476

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           L +FP ++P+Y ++  +D PK    +++T G   AP+VG II R A +L + PV
Sbjct: 477 LGIFPISEPKYAIMVMIDEPK---GSKVTGGAVSAPVVGRIISRMAPILSIAPV 527


>gi|209963952|ref|YP_002296867.1| peptidoglycan synthetase FtsI [Rhodospirillum centenum SW]
 gi|209957418|gb|ACI98054.1| peptidoglycan synthetase FtsI [Rhodospirillum centenum SW]
          Length = 597

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 184/486 (37%), Positives = 300/486 (61%), Gaps = 18/486 (3%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SR DI+DRNG +LA+ + T SL+ +P  VI P E   +L  VL ++  + +  +L S+ +
Sbjct: 88  SRADIVDRNGVLLASSLTTESLFADPKLVIDPKEAARRLTEVL-DIKEQDVLAELQSDKR 146

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W++R L+P+Q   +   G+PG+ F+ E+ R YP  S A+HVVG+  +DN G+ GIE+ 
Sbjct: 147 FVWIKRNLTPRQVYEVNRLGIPGLAFQREERRIYPQGSLAAHVVGFSGVDNVGLMGIEQA 206

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
            D           + ++N +P+RL++D+R+Q+I+ +E+      + A     ++++V TG
Sbjct: 207 FD----------RRLKENQEPLRLSIDVRLQHILRREVQTAIDDFQAIGGAGMVMDVKTG 256

Query: 295 EVISMVSIPDYDPHEAFKGKK----EGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
           E+++MVS+PD+DPH     ++    +  FNR + G++EMGS FK+F  A+ ++SG   ++
Sbjct: 257 ELLAMVSLPDFDPHNPPPPQEQQDLDPRFNRNTLGVYEMGSTFKIFNTALALESGRVKLR 316

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
           D+FD   PI++G+  I D+H +NR + + ++F++SSNIG+ ++A+ +G    KEF+ +LG
Sbjct: 317 DMFDATRPIRIGRFTISDFHAENRWMDVVDVFKHSSNIGSVRMAEQVGPVAQKEFMTKLG 376

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
                  ELPE+  P  P+ W+ ++ +TISFGHG+S +P+    AAA ++N G + P T 
Sbjct: 377 FARPASLELPEMGWPIIPNPWRDVNMMTISFGHGMSVSPVHLVTAAAGVVNGGIMHPATL 436

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           + R R+     +RIV  + T  T+R L+R  VT G+ R A  PG+ VGGKTGTA+KV   
Sbjct: 437 LKRDRDAEIPGTRIV-SEQTSDTLRKLMRIVVTEGTARMADAPGYLVGGKTGTAEKVKNG 495

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN--QLTAGINVAPMVGNIIRRSAS 588
            Y+     +SFL VFP  DP+Y+V   +D PK  +++    T G   AP  G I+ ++  
Sbjct: 496 GYARKALISSFLGVFPMNDPKYVVYVMVDEPKGNKKSFGYATGGWVGAPTGGRIVAQAGP 555

Query: 589 MLGVKP 594
           +LGV+P
Sbjct: 556 LLGVRP 561


>gi|255004125|ref|ZP_05278926.1| penicillin-binding protein [Anaplasma marginale str. Virginia]
          Length = 497

 Score =  359 bits (922), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 193/515 (37%), Positives = 313/515 (60%), Gaps = 21/515 (4%)

Query: 82  LVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPH 141
           +V +II+  R+I    +  E I P+++ +     R  I+DRNGEILATDI T SL  +  
Sbjct: 1   MVFFIIITFRLITLTAVPHEEIKPAVSKNAQPKGRFTILDRNGEILATDIATVSLSADTT 60

Query: 142 KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFR 201
            + +P+ +IEK+  +L + DSE IRR LS + KF W++R ++  +   I    L G+   
Sbjct: 61  VMSNPELVIEKVSAILHD-DSERIRRLLSPKKKFIWIKRDITSTEAAEIKEARLKGLHLT 119

Query: 202 LEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALD 261
            E  R YP  +  SH++GYVD D RGI+GIE++ D+ G+       +G+     ++L++D
Sbjct: 120 QEVKRVYPHNNLLSHILGYVDPDGRGISGIERYADIFGV-------QGD-----VKLSVD 167

Query: 262 LRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR 321
           +R+QN+V +E++   +KY+A +   ++++V  GE+++ VS+PD+D +   K +    FNR
Sbjct: 168 VRVQNVVREEILRQMEKYSAAAGIGIVMDVRNGEILAAVSLPDFDLNNRSKAENYQKFNR 227

Query: 322 ISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD-YHPQNRILTIPE 380
           ++ G++EMGS+FK+FT+A  IDSG  +V+D +D   P  +G++ ++D Y  ++ +L++ E
Sbjct: 228 VTLGVYEMGSVFKLFTVASAIDSGKVSVEDTYDVSQPFIIGRYKVNDMYKSRSPVLSVRE 287

Query: 381 IFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTIS 440
           IF  SSN+G A+IA  +G     E+  R+ LLS L  E+PE+  P +P +W      T S
Sbjct: 288 IFAQSSNVGMAKIAMDLGKDIQLEYFERMDLLSDLGLEIPEVGFPIFPREWGNSTVATAS 347

Query: 441 FGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE 500
           +G+G++ TP+    AAA L+N+G +   T +     E     R V+   T + ++ LLR 
Sbjct: 348 YGYGVAVTPVHVVQAAAGLVNDGIMHDATLIFGKGTE----GRRVVSSETSRKVKQLLRF 403

Query: 501 GVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDS 560
            V  G+G+RA V G+ VGGKTG+A+KV+  RY    N  SFL +FP ++P+Y ++  +D 
Sbjct: 404 AVERGTGKRANVKGYLVGGKTGSAEKVMDGRYRKDANLASFLGIFPISEPKYAIMVMIDE 463

Query: 561 PKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           PK    +++T G   AP+VG II R A +L + PV
Sbjct: 464 PK---GSKVTGGAVSAPVVGRIISRMAPILSIAPV 495


>gi|312114850|ref|YP_004012446.1| peptidoglycan glycosyltransferase [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219979|gb|ADP71347.1| Peptidoglycan glycosyltransferase [Rhodomicrobium vannielii ATCC
           17100]
          Length = 627

 Score =  354 bits (908), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 192/535 (35%), Positives = 311/535 (58%), Gaps = 17/535 (3%)

Query: 68  AHSKNRIGMTIVVCLVI-YIILAIRIIQYGNIHPEPIAPSMNIDE----YGMSRPDIIDR 122
           A S  R+   +  C    ++ L++ I +YG    E   PS++          SRPDI+DR
Sbjct: 24  ARSAQRL---LAACFAFGFLALSVEITRYGMTPVE--MPSLSSQSAPVALAKSRPDIVDR 78

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD-SEMIRRKLSSETKFQWLRRK 181
           NG +LATDI  + L   P ++++PDE  EK+  + P+LD   + RR    +++F++++R 
Sbjct: 79  NGRLLATDIRVYWLVANPSQILNPDEAAEKIVALFPDLDQGSLARRFRDKDSRFEYVKRG 138

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+Q +   + G+P +       R YPA S A+H++G  ++DN G +G+E ++D +   
Sbjct: 139 LTPKQAEAAHALGIPALTLLPTVQRVYPAGSVAAHILGITNVDNEGRSGVEWYIDQKLAG 198

Query: 242 RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
           +   T+  E+ +  ++L+LDL +Q+ +  EL    ++Y A++   ++L+V  GEV++  S
Sbjct: 199 QFSPTSLSERPI--VKLSLDLGVQHALTDELSRAMERYTAQAAMGIVLDVKNGEVVASAS 256

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +PD+DP+   +   +   NR+   ++E+GS+FK  TIAM +D G+ T  ++FD   P K+
Sbjct: 257 LPDFDPNRREQAAGQNRQNRVVTDVYELGSVFKSLTIAMALDQGIATRYEMFDA-TPFKL 315

Query: 362 GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           G+  + D H   R+ ++ +IF +SSN G+A+IA A G +  + FL  LGL  KLETE   
Sbjct: 316 GRFTMRDPHASRRMYSVEDIFIHSSNTGSARIALAAGGEKQQAFLRSLGLFEKLETEAGS 375

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
              P +P  W+ ++  T+++GHG++  PL  A A A L+N G  + PTF+I  +  +++ 
Sbjct: 376 SPTPVFPKTWRSVNVATVAYGHGIAVPPLLFASAMATLVNGGERLKPTFLIAEKNANDEP 435

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            R V+   T  TMR L+R  V  G+GR+A V G  VGGKTGTA KV + RYS  +  NSF
Sbjct: 436 QR-VISPETSATMRDLMRAVVERGTGRKAAVQGLGVGGKTGTALKVKEGRYSSDV-INSF 493

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQLT-AGINVAPMVGNIIRRSASMLGVKPV 595
           +A  P   P+Y+V+  +D P  +   +   A  N AP VG II+R A ML + P 
Sbjct: 494 VAAVPIDAPRYLVMVTIDEPHAEAGTKSNEASQNAAPTVGAIIKRIAPMLDILPT 548


>gi|114570634|ref|YP_757314.1| peptidoglycan glycosyltransferase [Maricaulis maris MCS10]
 gi|114341096|gb|ABI66376.1| Peptidoglycan glycosyltransferase [Maricaulis maris MCS10]
          Length = 584

 Score =  353 bits (905), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 194/534 (36%), Positives = 299/534 (55%), Gaps = 19/534 (3%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           + +  S+ R+ +  +   + + +LA R ++     P   AP+  + E   +R D+ DR G
Sbjct: 42  RAMDASRGRLRVMGLSLALGFAVLAGRAVELAITGPADAAPARQVAE-AHNRGDLFDRTG 100

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
           ++LAT + T SLY +P  V    E  E L  VLP++D E +   L S  +F W+RR L+P
Sbjct: 101 QVLATTLETHSLYADPALVWDAAETAEMLATVLPDVDVEGLTEDLGSRRRFVWVRRNLTP 160

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---MQGLT 241
           +Q++ + + GLPG+ FR E  R YP    ASHVVGY + D  G+ G E+  D   M G  
Sbjct: 161 RQRQAVFALGLPGLEFRTEPRRVYPRGRLASHVVGYTNRDMDGLAGAERAFDGALMAGDG 220

Query: 242 RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
           R            P+ L++D+ +Q  V + L     +Y A +   +++NV TGE++ MVS
Sbjct: 221 R------------PVALSIDMAVQFHVDEVLRATMTEYRALAATGIVMNVRTGEILGMVS 268

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +PD+DP+           NR +  ++EMGS FK FT+A+ ++    T++  +D R P+ V
Sbjct: 269 LPDFDPNRPSDASPGERLNRAAQSVYEMGSTFKAFTVAVALEEQTATLESRYDARAPLDV 328

Query: 362 GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           G + I DYH + R LT+PEIF +SSNIG+  +A  +G +  + F+  L LL +   EL E
Sbjct: 329 GGYRISDYHGEERWLTVPEIFTHSSNIGSGHMALEVGAEAQRGFMGDLRLLERAPIELAE 388

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
              P  P  W    ++TIS+GHG++ +P+ T  A AA+ N+G  +PPT +  + +E+   
Sbjct: 389 SADPLLPRNWGPTETVTISYGHGIAVSPIATIAAFAAIANDGVYVPPTLLPVAADETILG 448

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
            R V++ +  + + +L+RE V GG+G  A   G+ V GKTGTA K  +  Y  +   +SF
Sbjct: 449 ER-VMRSDVARDVLALMRENVVGGTGGNAEAVGYLVAGKTGTADKPSRGGYDTSALISSF 507

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVK 593
            AVFP  DPQY +L  +D P++ E   L  T G   AP VG I+ R A +LGV+
Sbjct: 508 SAVFPANDPQYAILVLLDEPQMPEPTYLRPTGGRVAAPAVGEIVARIAPILGVE 561


>gi|58697265|ref|ZP_00372646.1| penicillin-binding protein [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58536388|gb|EAL59836.1| penicillin-binding protein [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 472

 Score =  344 bits (882), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 177/437 (40%), Positives = 268/437 (61%), Gaps = 18/437 (4%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           +PDI+DRNG ++AT++PT SLY++  KV +P+ I  +L   L +L+ + + R L+SE KF
Sbjct: 52  QPDILDRNGVVIATNVPTTSLYIDATKVKNPESIAAQLCSTLHDLEYKNLYRVLTSEKKF 111

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L+P++   I + G+PGV F  +  R YP ++  SHV+GY DID  GI G+E ++
Sbjct: 112 AWIKRHLTPKELLAIKNAGVPGVNFYDDIKRIYPHSNLFSHVLGYTDIDGNGIAGVEAYI 171

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
                      +K  +  +PI L+LD R+Q+IVH+EL +   +Y A     ++LNV   E
Sbjct: 172 -----------SKNNEQEKPIILSLDTRVQSIVHEELTKAVSRYQALGGVGIVLNVRNSE 220

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           VISMVS+PD++P+   K +    FNR S G++EMGS+ K FTIA  +D+      DL+D 
Sbjct: 221 VISMVSLPDFNPNLQNKAEDVQKFNRASLGVYEMGSVLKYFTIAAALDANATKTSDLYDV 280

Query: 356 RNPIKVGKHVIHDYHPQNRI--LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PI +GK+ I D+H +++I  +T+ +IF  SSNIGAA+IA  +GI+   E+   + L S
Sbjct: 281 STPITIGKYKIQDFH-KSKIPKITVQDIFVKSSNIGAAKIAVKLGIEKQVEYFKAMKLFS 339

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
            L+ E+PE   P  P +W     +T S+G+G++ TP+  A  AAALIN G     T M+ 
Sbjct: 340 PLKIEIPEKSTPIIPDKWSENTLITASYGYGIAVTPIHLAQTAAALINNGIFHNATLMLN 399

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
            R   E+    ++ + T + MR LLR  VT G+GR+A +  + +GGKTG+A+KV+  +YS
Sbjct: 400 KRSIGEQ----IISRRTSREMRKLLRAAVTDGTGRKAKIKAYSIGGKTGSAEKVVDGKYS 455

Query: 534 DTLNFNSFLAVFPTTDP 550
              N  SF+ V    DP
Sbjct: 456 KDANIASFIGVLTMLDP 472


>gi|296532825|ref|ZP_06895498.1| cell division protein FtsI/penicillin-binding protein [Roseomonas
           cervicalis ATCC 49957]
 gi|296266848|gb|EFH12800.1| cell division protein FtsI/penicillin-binding protein [Roseomonas
           cervicalis ATCC 49957]
          Length = 560

 Score =  342 bits (877), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 191/489 (39%), Positives = 278/489 (56%), Gaps = 16/489 (3%)

Query: 112 YGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS 171
           +  SR  I DRNGEILA  +P  +L   P  + +P E  +KL+ VLP LD E +  +LS 
Sbjct: 59  HAASRAPITDRNGEILAISLPVTALVANPRVIHNPAEAADKLRTVLPQLDRERLIERLSG 118

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
           +  F ++ R L+P++Q+ +++ G+ G+ F   + R+YP    A HV+G VD+D  GI+GI
Sbjct: 119 DRGFVYIARALTPREQQGVINLGIAGLDFEEAERRYYPQGRAAVHVLGNVDVDGNGISGI 178

Query: 232 EKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           E+  D Q       T++G     P+RL++D+R+Q  +   + +    +N      V+L++
Sbjct: 179 ERRFDEQ-----LRTDRG----TPLRLSIDVRVQLAMRDAVNQAIHDFNGIGGAGVVLDI 229

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV-K 350
           +TGEV++MVS+PDYD  +      +  FNR++ G++E GS FK+FT A  ++ G   V  
Sbjct: 230 NTGEVVAMVSLPDYDAGDIGGATPDQRFNRVTVGVYEPGSTFKLFTAAAALEYGTANVYS 289

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
             FD   PI+ G+  I DY  +NR +T PE+  YSSN+GAA +A   G Q  +EFL R G
Sbjct: 290 STFDASRPIRYGRFTISDYKGKNRWITFPEMLAYSSNLGAAHMAATFGPQRQREFLSRAG 349

Query: 411 LLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +LS+ + ELPE   P  P  + W+ I+  TISFGHG+S TPL     AAA+ N G L  P
Sbjct: 350 MLSRQQIELPEAALPLVPPANAWRDINMYTISFGHGISVTPLHVVTGAAAIANGGILRQP 409

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV- 527
           T +        + +RIV ++ T + MR L+R  VT GS R A VPG+ VGGKTGTAQK  
Sbjct: 410 TLLALPPGAQREGTRIVSER-TSEIMRRLMRLVVTDGSARSAEVPGYFVGGKTGTAQKTG 468

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRR 585
               Y       +F+  FP   P+Y +   +D P    R+    TAG   AP    +I R
Sbjct: 469 PHGGYLMNKRIAAFVGAFPMQAPRYALYVMVDEPTPNARSHGYATAGWVAAPAANTVISR 528

Query: 586 SASMLGVKP 594
            A +LG+ P
Sbjct: 529 IAPILGLVP 537


>gi|16263689|ref|NP_436482.1| penicillin-binding protein [Sinorhizobium meliloti 1021]
 gi|14524404|gb|AAK65894.1| Penicillin-binding protein [Sinorhizobium meliloti 1021]
          Length = 443

 Score =  341 bits (875), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 176/416 (42%), Positives = 260/416 (62%), Gaps = 7/416 (1%)

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           +Q+ ++  GL  VGFR E  R YP  S A+H++G VDIDN GI GIEK++D   L  +  
Sbjct: 6   KQQAVIDSGLAAVGFRPENQRIYPNGSLAAHILGAVDIDNFGIAGIEKWIDANWLADLRG 65

Query: 246 TN---KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                KG ++LQP+ L++DLR+Q  + QEL +  KK+ A +   ++L+V+ GE++++ S 
Sbjct: 66  AGLALKG-RDLQPVELSIDLRVQYAMEQELGKAVKKFGAAAGAGLLLDVTNGEILALASY 124

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           P +DP+      K    NR++ G+FEMGS FK  T AM ++SG F ++ + D   P+  G
Sbjct: 125 PAFDPNNPVDAFKPDRINRVTAGVFEMGSTFKALTTAMALESGRFDLESVVDASRPLSFG 184

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
           +  IHDY  + R LT+PE F +SSNI  A++A  +G +  + FL R G+LS+L TELPE 
Sbjct: 185 RQRIHDYRGKYRPLTVPEAFIHSSNIVMAKMAMTLGPEALRTFLGRFGVLSQLATELPES 244

Query: 423 QAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
            AP  PS W  + + T+SFGHG++ TPLQ ++A AAL N GRLI PTF+  S      ++
Sbjct: 245 AAPLRPSSWSEVTTATVSFGHGIAVTPLQASMAVAALANGGRLIRPTFIKDSPVSERTIA 304

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFL 542
             +L  NT + +R LLR     GS  +A VPG+ +GGKTGTA+KV++ RYS  LN  SF+
Sbjct: 305 ESLLSANTSEAIRHLLRLNAAVGSATKADVPGYVIGGKTGTAEKVVQGRYSKVLNVTSFM 364

Query: 543 AVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
            + P  +P+Y++L+ +D P+   +     T+G N  P+ G ++ R   ML +KPVF
Sbjct: 365 GIVPADNPRYLLLTLLDEPRGLAETYGNRTSGWNAVPLGGALLHRILPML-LKPVF 419


>gi|91205357|ref|YP_537712.1| penicillin-binding protein [Rickettsia bellii RML369-C]
 gi|157826958|ref|YP_001496022.1| penicillin-binding protein [Rickettsia bellii OSU 85-389]
 gi|91068901|gb|ABE04623.1| Penicillin-binding protein [Rickettsia bellii RML369-C]
 gi|157802262|gb|ABV78985.1| Penicillin-binding protein [Rickettsia bellii OSU 85-389]
          Length = 561

 Score =  340 bits (871), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 191/536 (35%), Positives = 311/536 (58%), Gaps = 15/536 (2%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           ++K R+ + I    V++  L+ R II   N++ + +       ++   R +I+DRN  +L
Sbjct: 24  NTKIRLLIVIGAFSVLFCTLSYRLIIVATNVYDKNLHALKKSSQF---RKEIVDRNDNLL 80

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A ++P+ SL+  P  VI P+  ++K+  +LP+++   +   L S   F W++R L P QQ
Sbjct: 81  AVNLPSASLFANPQIVIDPENSVKKIAEILPDINKAKLLADLKSNKSFIWVKRDLLPSQQ 140

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN 247
           +RI+S GL G  F  E+ R Y  ++ +SH+VGYV  D  G++G+E   D          N
Sbjct: 141 ERIMSLGLLGFDFEEEQKRIYTFSNLSSHIVGYVGRDMAGLSGLELAYDKYLTNSDLDLN 200

Query: 248 KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDP 307
           K  K  +P++L++D+R+Q+I+ +E+ +  K+++A     +I N + GE++++VS PD+DP
Sbjct: 201 KPGKQKEPLKLSIDIRLQSILSEEIDKTLKQFSAIGAVGIIANPNNGEILALVSKPDFDP 260

Query: 308 HEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIH 367
           H     K +  FN  S GI+E+GS+FK  T+A+G D+G   + D +D  + +KVG   I 
Sbjct: 261 HYPSAAKPQQLFNMASLGIYEIGSVFKSLTMAVGFDTGAINMNDAYDI-SYMKVGGFQIK 319

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY 427
           DY P+    ++P+IF +SSNIG +QI   +G    +++L +LGLL +++ ELPE   P +
Sbjct: 320 DYTPRQGWHSVPDIFLHSSNIGVSQIMLEVGKNNFRKYLKKLGLLDQVQIELPERGTPLF 379

Query: 428 PSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
           PS+  W  + S T+S+G+G+S +PL    A   ++N G L   T + R  E+ E     V
Sbjct: 380 PSEKRWNELTSATMSYGYGISISPLHFVRAMLPVVNGGILYDLTLLKRDDEKVEGTR--V 437

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI----KKRYSDTLNFNSF 541
             +NT K MR L R  V  G+G+RA V G+ +GGKTGTA+K+     KK+Y       SF
Sbjct: 438 FSENTSKQMRQLFRTVVKDGTGKRAEVKGYLIGGKTGTAEKLSSNAGKKKYLKNSRTTSF 497

Query: 542 LAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPV 595
           L + P + P+Y++   +D PK  KE     TAG   AP  G ++ R  S+ G++P+
Sbjct: 498 LGLLPASKPEYVIYIMIDEPKPTKETFGFATAGWTAAPTAGRVLERMISLYGLEPI 553


>gi|218671985|ref|ZP_03521654.1| putative penicillin binding protein [Rhizobium etli GR56]
          Length = 322

 Score =  339 bits (870), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 156/319 (48%), Positives = 221/319 (69%), Gaps = 2/319 (0%)

Query: 84  IYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKV 143
           +Y+I+  R+++Y     E ++  +  D    SRPDI+DRNGE+LATDI T SL+ EP+K+
Sbjct: 3   VYVIIGGRLVEYAMKDQEVVSSILPPDRLMASRPDILDRNGEVLATDIRTVSLFAEPNKI 62

Query: 144 ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRL 202
           + PDE +EKL  VLP LD     +KLS +T  F WLRR+L+P+QQ +IL+ G+PG+GFR 
Sbjct: 63  VDPDEAVEKLATVLPELDVRDTYKKLSVKTSHFAWLRRQLTPKQQSQILALGIPGIGFRP 122

Query: 203 EKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALD 261
           EK RFYP    A+H++GYV+IDNRG+ G+EKF+D QGL  + +     ++ L+P+RL++D
Sbjct: 123 EKRRFYPGGPTAAHILGYVNIDNRGVAGMEKFIDDQGLADLASVGMTSDQPLEPVRLSID 182

Query: 262 LRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR 321
           LR+QNIV   +V     + A+  G  +++V TGEV+ M S PD+DP++  +G KEGW NR
Sbjct: 183 LRVQNIVRDAVVNAVNNFQAKGAGAAVIDVHTGEVLGMASAPDFDPNDPQEGAKEGWLNR 242

Query: 322 ISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEI 381
           ++ G FEMGS FK F++AM +DSG   + D FD    I +G   IHD+H Q R LT+PEI
Sbjct: 243 MTNGTFEMGSTFKTFSLAMALDSGKVKMTDSFDASKSIYIGGFTIHDFHGQRRWLTVPEI 302

Query: 382 FRYSSNIGAAQIADAMGIQ 400
           F+YSSNIG A++ D +GI 
Sbjct: 303 FQYSSNIGTARVIDIVGID 321


>gi|15604421|ref|NP_220939.1| penicillin binding protein (pbpA2) [Rickettsia prowazekii str.
           Madrid E]
 gi|3861115|emb|CAA15015.1| PENICILLIN BINDING PROTEIN (pbpA2) [Rickettsia prowazekii]
 gi|292572188|gb|ADE30103.1| Penicillin-binding protein [Rickettsia prowazekii Rp22]
          Length = 561

 Score =  336 bits (861), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 186/541 (34%), Positives = 309/541 (57%), Gaps = 18/541 (3%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIR---IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRN 123
           I     +I + +V+C   ++   +    II   N++ + I       ++   R +I+DRN
Sbjct: 20  ICSKNTKIRLLMVICGFSFLFATVSYKLIIVATNVYDQNINSFKKKHQF---RKEIVDRN 76

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G +LA ++P+ SL+  P  V+ P+  + KL  +LP+++   + ++L S   F W++R L 
Sbjct: 77  GNLLAMNLPSASLFANPQIVLDPETSVNKLAEILPDINKAKLIKELKSNKSFIWVKRDLL 136

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
           P QQ++I+S GL G  F  E+ R Y  ++  SH++GYV  D+ G++G+E   D       
Sbjct: 137 PSQQEKIMSLGLLGFEFEEEQKRIYIFSNLLSHIIGYVGRDSVGLSGLELAYDKYLTNTD 196

Query: 244 FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
           +  N  +    P++L++D+R+Q+I+++E+ +  KK+ A     +I + + GE++++V+ P
Sbjct: 197 YELNDPKDQKAPLQLSIDIRLQSILNEEIDKTLKKFKAIGAVGIIADPNNGEILALVNKP 256

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G+  + D +D  + +KVG 
Sbjct: 257 DFDPHYPSLAKPEELFNTASLGIYEMGSVFKALTMAVGFDTGVIKMNDAYDI-SYMKVGG 315

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE  
Sbjct: 316 FQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKNDFKQYLKKLGLLDQLQIELPERG 375

Query: 424 APSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
            P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R+  + +
Sbjct: 376 TPLFPSEKRWNELTSVTMSYGYGISISPLHFVKAILPVVNGGTLYDLTLL--KRKTKKVI 433

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDTL 536
              V  +NT   M  L R  V  G+G+RA + G+ +GGKTGTA+K+      KK+Y    
Sbjct: 434 GTKVFSENTSTQMNKLFRSVVKEGNGKRAEIKGYLIGGKTGTAEKLSQGIGGKKKYLKNS 493

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKP 594
             +SFL + P++ PQY++    D PK IKE     TA     P  G +  R  S+ G++P
Sbjct: 494 RASSFLGILPSSKPQYVLFIRFDEPKPIKESFGFATASWTAVPTAGRVFERMISLYGLEP 553

Query: 595 V 595
           +
Sbjct: 554 I 554


>gi|86137689|ref|ZP_01056266.1| penicillin-binding protein [Roseobacter sp. MED193]
 gi|85826024|gb|EAQ46222.1| penicillin-binding protein [Roseobacter sp. MED193]
          Length = 594

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 191/557 (34%), Positives = 308/557 (55%), Gaps = 31/557 (5%)

Query: 57  DLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMS 115
           D  Q + R+    ++ R+ +  V  L  Y  +A R+       P EP+A S+      M 
Sbjct: 35  DDMQVKSRQ---RAEGRLLVLGVFFLCAYAAVAARMGVMATSEPREPVA-SVAGSAIAMQ 90

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI+DR G ILAT+  T SLYV+P ++I P   +++L  + P+LD   +  K +   KF
Sbjct: 91  RADIVDRQGRILATNFETHSLYVQPQQLIDPQNAVDRLVEIFPDLDHADLLAKFTGGRKF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W+++K+SP+Q++ +   G PG+ F   + R YP  S A+HV+G       G++  E  +
Sbjct: 151 LWIKKKISPEQKQAVHDIGDPGLLFGPREMRLYPNGSVAAHVLGGASFGKEGVSAAE-VI 209

Query: 236 DMQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
            + G+ + F           +P+ L+LDL +Q    + L    K  +A+   +++++V T
Sbjct: 210 GVAGVEKQFDDYLRNPANGSEPLALSLDLTVQAAAERVLDGGMKLMSAKGATSILMDVHT 269

Query: 294 GEVISMVSIPDYDPHE-------AFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           GEVIS+VS+PD+DP+E        F       FNR   G++E+GS FK+FT A  +D GL
Sbjct: 270 GEVISVVSLPDFDPNERPAPPTSGFDPSVSPLFNRAVQGVYELGSTFKIFTAAQAVDLGL 329

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
              + + DTR P++ GK  I D+      L++ +I   SSNIG A++A  +G +  ++FL
Sbjct: 330 VNPQTVIDTRGPLRWGKFSIKDFRNYGNELSVTDIIVKSSNIGTARLAQQIGAERQQDFL 389

Query: 407 YRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
             LG+L     E+ E Q   P  P  W  + ++TIS+GHG+STTP+  A   AA+ N GR
Sbjct: 390 TGLGMLEATPFEIVEAQGGKPLLPKNWSELSAMTISYGHGISTTPMHLAAGYAAVANGGR 449

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
            + PT +   +++  ++ R ++ + +    R++LR+ VT G+   A VPG++VGGKTGTA
Sbjct: 450 YVSPTVL---KQDGPQLGRRIMSEESASAARTMLRQVVTEGTASFARVPGYQVGGKTGTA 506

Query: 525 QKVIKKR---YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI----KERNQLTAGINVAP 577
            K  K R   Y D +   +F ++FP  DP+Y+++  +D P +    +ER   TAG    P
Sbjct: 507 DKP-KPRGGYYEDKV-IATFASIFPAHDPKYVLVVTLDEPSVIAHGEERR--TAGWTAVP 562

Query: 578 MVGNIIRRSASMLGVKP 594
           +   +I R A +LG++P
Sbjct: 563 VAAEMIGRLAPLLGLRP 579


>gi|157825939|ref|YP_001493659.1| penicillin-binding protein [Rickettsia akari str. Hartford]
 gi|157799897|gb|ABV75151.1| Penicillin-binding protein [Rickettsia akari str. Hartford]
          Length = 561

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 196/544 (36%), Positives = 317/544 (58%), Gaps = 29/544 (5%)

Query: 70  SKN-RIGMTIVVC--LVIYIILAIRIIQYGNIHPEPIAPSM---NIDEYGMS---RPDII 120
           SKN +I + +V+C    ++  L+ R+I         +A S+   NI+ +  +   R +I+
Sbjct: 22  SKNTKIRLLMVICGFSFLFCTLSYRLII--------VATSVYDKNINSFKKNHQFRKEIV 73

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNG +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R
Sbjct: 74  DRNGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLSELKSNKSFIWVKR 133

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
            L P QQ++I S GLPG  F  E+ R Y  ++  SHVVGYV  D  G++G+E   D    
Sbjct: 134 DLLPSQQEKITSLGLPGFEFEEEQKRIYTFSNLLSHVVGYVGRDLVGLSGLELAYDKYLT 193

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
              +  N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V
Sbjct: 194 NSDYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALV 253

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           + PD+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +K
Sbjct: 254 NKPDFDPHHPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMK 312

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           VG   + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELP
Sbjct: 313 VGGFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELP 372

Query: 421 EIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           E   P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R+++
Sbjct: 373 ERGTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDITLL--KRKDA 430

Query: 479 EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYS 533
           + +   V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      KK+Y 
Sbjct: 431 KVIGTKVFSENTSTQMKKLFRSVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGSGGKKKYL 490

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLG 591
                +SFL V P ++PQYI+    D PK  KE     TA    AP  G +  R  S+ G
Sbjct: 491 KNSRASSFLGVLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYG 550

Query: 592 VKPV 595
           ++P+
Sbjct: 551 LEPI 554


>gi|294085907|ref|YP_003552667.1| cell division protein FtsI/penicillin-binding protein 2 [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292665482|gb|ADE40583.1| Cell division protein FtsI/penicillin-binding protein 2 [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 573

 Score =  323 bits (829), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 177/487 (36%), Positives = 279/487 (57%), Gaps = 17/487 (3%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           + R  IIDR G +LAT++P   L+ +P +++   +   KL  ++   D   ++  LS +T
Sbjct: 72  VERGQIIDRKGRLLATNLPITVLHADPREIMDVTDAATKLAPLIGRHDVASLKTLLSKKT 131

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           ++  L RKL+P +   IL  G+PGV F     R YP A  A+H++G VD ++ GI GIEK
Sbjct: 132 RYVELDRKLTPARHAEILQLGIPGVYFAESTLRVYPRAETAAHILGQVDPEHNGIAGIEK 191

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
             D           K       I L+LD+ +Q I+  E+ +   ++ A     V+L+  T
Sbjct: 192 SQDAH-----LAAGKD------IHLSLDVGLQAIIRAEISKQINEFEAIGGAGVLLDTRT 240

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+++M S+PDY+P+   K   +  FNR + G++EMGS FKV   A+ +++G  T +  F
Sbjct: 241 GEILAMTSLPDYNPNHFAKASDDARFNRATKGLYEMGSTFKVLNTAIALETGAATPRTEF 300

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           +   P++V +  I+DYHP  + L + EI  +SSNIG+A +A+  G    KE++ RLGLL 
Sbjct: 301 EVMKPLRVSRFTINDYHPSKKPLNVAEIMVHSSNIGSALMAEEFGASIQKEYMKRLGLLD 360

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           +L  ELPEI  P  P  WKR  +LT+S+GHG+S +P+  A A +   + G  I PT + R
Sbjct: 361 RLPLELPEIAKPLSPKHWKRAATLTVSYGHGISISPVHLASAVSTASSNGLRIAPTLLKR 420

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKV-IKK 530
            +   E +   V  ++T   +RS++R  V+   G+G++A   G+ VGGKTGTA+KV    
Sbjct: 421 -KTGDEIIKTRVFSEHTAHAVRSIMRLVVSHKEGTGKKARATGYMVGGKTGTAEKVQANG 479

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSAS 588
            Y+   N  +F+A FP  DP+Y+++  +D PK ++++    T G   AP V  I+ + + 
Sbjct: 480 GYNAKANLATFVATFPVHDPRYVIVIMVDEPKGQKQSHGFATGGWVAAPAVRRIVEQISP 539

Query: 589 MLGVKPV 595
           +LGV PV
Sbjct: 540 ILGVHPV 546


>gi|157964704|ref|YP_001499528.1| penicillin-binding protein [Rickettsia massiliae MTU5]
 gi|157844480|gb|ABV84981.1| Penicillin-binding protein [Rickettsia massiliae MTU5]
          Length = 561

 Score =  323 bits (828), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 195/542 (35%), Positives = 316/542 (58%), Gaps = 25/542 (4%)

Query: 70  SKN-RIGMTIVVC--LVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMS---RPDIIDR 122
           SKN +I + +V+C    ++  L+ R II   N++ +      NI+ +  +   R +I+DR
Sbjct: 22  SKNIKIRLLMVICGFFFLFCTLSYRLIIVATNVYDK------NINSFKKNHQFRKEIVDR 75

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NG +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R L
Sbjct: 76  NGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDL 135

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
            P QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   D      
Sbjct: 136 LPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAYDKYLTNS 195

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
            +  N+ +   +P++L++D+R+Q+I+ +EL +  K++ A     +I + + GE++++V+ 
Sbjct: 196 DYALNEPKNRKEPLQLSIDIRLQSILSEELDKTLKQFKAIGAVGIIADPNNGEILALVNK 255

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +KVG
Sbjct: 256 PDFDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVG 314

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
              + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE 
Sbjct: 315 GFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPER 374

Query: 423 QAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
             P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + 
Sbjct: 375 GTPLFPSEKRWNDLTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKV 432

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDT 535
           +   V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      KK+Y   
Sbjct: 433 IGTKVFSENTSTQMKKLFRSVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGGKKKYLKN 492

Query: 536 LNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVK 593
              +SFL + P ++PQYI+    D PK  KE     TA    AP  G +  R  S+ G++
Sbjct: 493 SRASSFLGMLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLE 552

Query: 594 PV 595
           P+
Sbjct: 553 PI 554


>gi|259416744|ref|ZP_05740664.1| peptidoglycan glycosyltransferase [Silicibacter sp. TrichCH4B]
 gi|259348183|gb|EEW59960.1| peptidoglycan glycosyltransferase [Silicibacter sp. TrichCH4B]
          Length = 593

 Score =  322 bits (826), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 189/572 (33%), Positives = 303/572 (52%), Gaps = 41/572 (7%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-E 101
            N+ Q+   ME         R +  A  +  +     VC   Y+ +  R+       P E
Sbjct: 28  ENIAQRHSDME--------ARARTRAEGRLLVLAAFFVC--AYVAIGGRMAVMATSEPAE 77

Query: 102 PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD 161
           P+  S+        R DI+DR G ILAT+  TFSLY +P +++ P +  +KL  + P+LD
Sbjct: 78  PV--SVRGSAIANQRADIVDREGRILATNFETFSLYAQPPQMVDPLDAADKLVSIFPDLD 135

Query: 162 SEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            E + +  +   KF W+++K+SP+Q + +   G PG+ F   + R YP    ASHV+G  
Sbjct: 136 RERLVKDFTGSRKFLWIKKKISPEQMQAVHDIGDPGLMFGPREMRLYPNGKLASHVLGGA 195

Query: 222 DIDNRGITGIEKFLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
                G+   E  + + G+ + F        N G    +P+ L+LDL IQ+   + L   
Sbjct: 196 SFGKEGVNAAE-VIGVAGVEKQFDDYLRDPANGG----KPLALSLDLSIQDATEEVLYGG 250

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHE-------AFKGKKEGWFNRISYGIFE 328
            K  NA+   +++++V TGEVIS+ S+PD+DP+E        F   +   FNR   G++E
Sbjct: 251 MKLMNAKGATSILMDVYTGEVISVASLPDFDPNERPRPPTSGFDPSESPLFNRAVQGVYE 310

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNI 388
           +GS FK+FT A  ++ GL     + D R P++ GK  I D+    + L++  I   SSNI
Sbjct: 311 LGSTFKIFTAAQAMELGLVNPDTIIDIRGPLRWGKFSIRDFSNYGKELSVTRIIEKSSNI 370

Query: 389 GAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLS 446
           G A++A  +G +  + FL RLG+L     E+ E     P  P  W  + ++TIS+GHG+S
Sbjct: 371 GTARLAQQIGTERQRAFLDRLGMLKATPFEIVEASGGQPLLPKNWSELSTMTISYGHGIS 430

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTP+  A   AAL N GRL+ PT +   ++   ++   ++ +   +    +LR  V+ G+
Sbjct: 431 TTPMHLAAGYAALANGGRLVQPTIL---KQNGPQMGERIVSEEVARASLDMLRGVVSSGT 487

Query: 507 GRRAFVPGFEVGGKTGTAQ--KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI- 563
              A V G+ VGGKTG+A   K +   Y D +   +F AVFPT +P+Y+++  +D P+I 
Sbjct: 488 ASMADVSGYSVGGKTGSADKPKPMGGYYKDKV-IATFAAVFPTDEPKYVLIVTLDEPEII 546

Query: 564 -KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
             ++++ TAG   AP+ G +I R A +LG++P
Sbjct: 547 ALDKDRRTAGWTAAPVAGEMIARLAPLLGLRP 578


>gi|34581506|ref|ZP_00142986.1| penicillin-binding protein [Rickettsia sibirica 246]
 gi|28262891|gb|EAA26395.1| penicillin-binding protein [Rickettsia sibirica 246]
          Length = 560

 Score =  322 bits (826), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 192/539 (35%), Positives = 314/539 (58%), Gaps = 21/539 (3%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMS---RPDIIDRNG 124
           ++K R+ M I V   ++  L+ R II   N++ +      NI+ +  +   R +I+DRNG
Sbjct: 24  NTKIRLLMVICVFSFLFCTLSYRLIIVATNVYDK------NINSFKKNHQFRKEIVDRNG 77

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R + P
Sbjct: 78  NLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDVLP 137

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
            QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   D       +
Sbjct: 138 SQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAYDKYLTNSDY 197

Query: 245 TTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
             N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V+ PD
Sbjct: 198 ELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALVNKPD 257

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKH 364
           +DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +KVG  
Sbjct: 258 FDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVGGF 316

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE   
Sbjct: 317 QLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGT 376

Query: 425 PSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
           P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + + 
Sbjct: 377 PLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDKKVIG 434

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI----KKRYSDTLNF 538
             V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+     KK+Y      
Sbjct: 435 TKVFSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGKKKYLKNSRA 494

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPV 595
           +SFL + P ++PQYI+    D PK  KE     TA    AP  G +  R  S+ G++P+
Sbjct: 495 SSFLGILPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPI 553


>gi|238650668|ref|YP_002916521.1| cell division protein [Rickettsia peacockii str. Rustic]
 gi|238624766|gb|ACR47472.1| cell division protein [Rickettsia peacockii str. Rustic]
          Length = 561

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 192/540 (35%), Positives = 314/540 (58%), Gaps = 22/540 (4%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMS---RPDIIDRNG 124
           ++K R+ M I V   ++  L+ R II   N++ +      NI+ +  +   R +I+DRNG
Sbjct: 24  NTKIRLLMVICVFSFLFCTLSYRLIIVATNVYDK------NINSFKKNHQFRKEIVDRNG 77

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R + P
Sbjct: 78  NLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDVLP 137

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
            QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   D       +
Sbjct: 138 SQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAYDKYLTNSDY 197

Query: 245 TTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
             N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V+ PD
Sbjct: 198 ELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALVNKPD 257

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKH 364
           +DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +KVG  
Sbjct: 258 FDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVGGF 316

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE   
Sbjct: 317 QLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGT 376

Query: 425 PSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
           P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + + 
Sbjct: 377 PLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKVIG 434

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDTLN 537
             V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      KK+Y     
Sbjct: 435 TKVFSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGGKKKYLKNSR 494

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPV 595
            +SFL + P ++PQYI+    D PK  KE     TA    AP  G +  R  S+ G++P+
Sbjct: 495 ASSFLGMLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPI 554


>gi|229586899|ref|YP_002845400.1| Penicillin-binding protein [Rickettsia africae ESF-5]
 gi|228021949|gb|ACP53657.1| Penicillin-binding protein [Rickettsia africae ESF-5]
          Length = 560

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 191/539 (35%), Positives = 314/539 (58%), Gaps = 21/539 (3%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMS---RPDIIDRNG 124
           ++K R+ M I V   ++  L+ R II   N++ +      NI+ +  +   R +I+DRNG
Sbjct: 24  NTKIRLLMVICVFSFLFCTLSYRLIIVATNVYDK------NINSFKKNHQFRKEIVDRNG 77

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R + P
Sbjct: 78  NLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDVLP 137

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
            QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   D       +
Sbjct: 138 SQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAYDKYLTNSDY 197

Query: 245 TTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
             N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V+ PD
Sbjct: 198 ELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALVNKPD 257

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKH 364
           +DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +KVG  
Sbjct: 258 FDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVGGF 316

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE   
Sbjct: 317 QLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGT 376

Query: 425 PSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
           P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + + 
Sbjct: 377 PLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKVIG 434

Query: 483 RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI----KKRYSDTLNF 538
             V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+     KK+Y      
Sbjct: 435 TKVFSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGKKKYLKNSRA 494

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPV 595
           +SFL + P ++PQY++    D PK  KE     TA    AP  G +  R  S+ G++P+
Sbjct: 495 SSFLGMLPASNPQYVIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPI 553


>gi|157828715|ref|YP_001494957.1| penicillin-binding protein [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933440|ref|YP_001650229.1| cell division protein [Rickettsia rickettsii str. Iowa]
 gi|157801196|gb|ABV76449.1| penicillin-binding protein [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908527|gb|ABY72823.1| division specific D,D-transpeptidase [Rickettsia rickettsii str.
           Iowa]
          Length = 561

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 190/537 (35%), Positives = 312/537 (58%), Gaps = 16/537 (2%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           ++K R+ M I V   ++  L+ R II   N++ + I       ++   R +I+DRNG +L
Sbjct: 24  NTKIRLLMVICVFSFLFCTLSYRLIIVATNVYDKNINSFKKKHQF---RKEIVDRNGNLL 80

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R + P QQ
Sbjct: 81  AVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDVLPSQQ 140

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN 247
           ++I S GL G  F  E+ R Y  ++  SHV+GYV  D+ G++G+E   D       +  N
Sbjct: 141 EKITSLGLLGFEFEEEQKRIYTFSNLLSHVIGYVGRDSVGLSGLELAYDKYLTNSDYELN 200

Query: 248 KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDP 307
           + +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V+ PD+DP
Sbjct: 201 EPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALVNKPDFDP 260

Query: 308 HEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIH 367
           H     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +KVG   + 
Sbjct: 261 HYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVGGFQLK 319

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY 427
           DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE   P +
Sbjct: 320 DYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGTPLF 379

Query: 428 PSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
           PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + +   V
Sbjct: 380 PSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKVIGTKV 437

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDTLNFNS 540
             +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      KK+Y      +S
Sbjct: 438 FSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGGKKKYLKNSRASS 497

Query: 541 FLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPV 595
           FL + P ++PQYI+    D PK  KE     TA    AP  G +  R  S+ G++P+
Sbjct: 498 FLGMLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPI 554


>gi|15892778|ref|NP_360492.1| penicillin-binding protein [Rickettsia conorii str. Malish 7]
 gi|15619958|gb|AAL03393.1| penicillin-binding protein [Rickettsia conorii str. Malish 7]
          Length = 561

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 192/542 (35%), Positives = 315/542 (58%), Gaps = 26/542 (4%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM---NIDEYGMS---RPDIIDR 122
           ++K R+ M I V   ++  L+ R+I         +A S+   NI+ +  +   R +I+DR
Sbjct: 24  NTKIRLLMVICVFSFLFCTLSYRLII--------VATSVYDKNINSFKKNHQFRKEIVDR 75

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NG +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R +
Sbjct: 76  NGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDV 135

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
            P QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   D      
Sbjct: 136 LPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAYDKYLTNS 195

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
            +  N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V+ 
Sbjct: 196 DYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALVNK 255

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G+  + D +D  + +KVG
Sbjct: 256 PDFDPHYPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGVINMNDAYDI-SYMKVG 314

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
              + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE 
Sbjct: 315 GFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPER 374

Query: 423 QAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
             P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + 
Sbjct: 375 GTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKV 432

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDT 535
           +   V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      KK+Y   
Sbjct: 433 IGTKVFSENTSTQMKKLFRAVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGGKKKYLKN 492

Query: 536 LNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVK 593
              +SFL + P ++PQYI+    D PK  KE     TA    AP  G +  R  S+ G++
Sbjct: 493 SRASSFLGMLPASNPQYIIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLE 552

Query: 594 PV 595
           P+
Sbjct: 553 PI 554


>gi|99081857|ref|YP_614011.1| peptidoglycan glycosyltransferase [Ruegeria sp. TM1040]
 gi|99038137|gb|ABF64749.1| Peptidoglycan glycosyltransferase [Ruegeria sp. TM1040]
          Length = 593

 Score =  321 bits (822), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 194/573 (33%), Positives = 299/573 (52%), Gaps = 43/573 (7%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-E 101
            NL Q+   ME         R +  A  +  +     VC   Y+ +  R+       P E
Sbjct: 28  ENLAQRHSEMEA--------RARTRAEGRLLVLAAFFVC--AYVAIGGRMAMMATSEPAE 77

Query: 102 PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD 161
           P+  S++       R DI+DR G ILAT+  TFSLY +P +++ P    EKL  + P+LD
Sbjct: 78  PV--SVSGSAIANQRADIVDREGRILATNFETFSLYAQPPQMVEPLVAAEKLVSIFPDLD 135

Query: 162 SEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            E + +  +   KF W+++K+SP+Q + +   G PG+ F   + R YP    A+HV+G  
Sbjct: 136 HERLVKDFTGSRKFLWIKKKISPEQMQAVHDIGDPGLMFGPREMRLYPNGKLAAHVLGGA 195

Query: 222 DIDNRGITGIEKFLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
                G+   E  + + G+ + F        N G    +P+ L+LDL +Q+   + L   
Sbjct: 196 SFGKEGVNAAE-VIGVAGVEKQFDDYLRDPANGG----KPLELSLDLSVQHATEEVLYGG 250

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHE-------AFKGKKEGWFNRISYGIFE 328
            K  NA+   +++++V TGEVIS+ S+PD+DP+E        F   +   FNR   G++E
Sbjct: 251 MKLMNAKGATSILMDVHTGEVISVASLPDFDPNERPRPPTSGFDPSESPLFNRAVQGVYE 310

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNI 388
           +GS FK+F  A  I+ GL   + + DTR P++ GK  I D+      +T+  I   SSNI
Sbjct: 311 LGSTFKIFAAAQAIELGLVNPETVIDTRGPLRWGKFSIRDFRNYGNEMTVSRIIEKSSNI 370

Query: 389 GAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLS 446
           G A++A  +G +  + FL  LG+L     E+ E     P  P  W  + ++TIS+GHG+S
Sbjct: 371 GTARLAQQIGAERQRAFLGELGMLEPTPFEIVEASGGQPLLPRNWSELSTMTISYGHGIS 430

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
           TTP+  A   AA+ N GRL+ PT +   ++   ++   VL K   +    +LR  V+ GS
Sbjct: 431 TTPMHLAAGYAAIANGGRLVKPTIL---KQTGPRLGERVLSKEVAEASLEMLRRVVSSGS 487

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKR---YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
              A V G+ VGGKTGTA K  K R   Y D +   +F AVFPT  P+Y+++  +D P+I
Sbjct: 488 ASMAEVEGYSVGGKTGTADKP-KPRGGYYEDKV-IATFAAVFPTDAPKYVLIVTLDEPEI 545

Query: 564 KE--RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
                ++ TAG   AP+   +I R A +LG++P
Sbjct: 546 IAYGEDRRTAGWTAAPVAAEMIARLAPLLGLRP 578


>gi|254475151|ref|ZP_05088537.1| penicillin-binding protein [Ruegeria sp. R11]
 gi|214029394|gb|EEB70229.1| penicillin-binding protein [Ruegeria sp. R11]
          Length = 596

 Score =  321 bits (822), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 187/563 (33%), Positives = 314/563 (55%), Gaps = 38/563 (6%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVC----LVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYG 113
            ++R  ++ A S+ R    ++V     LV +  +A+R+         EP+A +       
Sbjct: 30  LRQRHAEMQAASRQRAEGRLLVLGVFFLVAFTAIAVRMGALATSEAVEPVASTAGGSGIA 89

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           M R DI+DR G ILAT+  T SLY +P +++ P+  +E+L  + P+LD + +    + + 
Sbjct: 90  MQRADIVDRKGRILATNFETHSLYAQPPQMVDPEGAVERLVEIFPDLDRDRLLEDFTGKR 149

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           KF W+++K+SP+Q++ +   G PG+ F   + R YP  S A+HV+G       G+T  E 
Sbjct: 150 KFVWIKKKISPEQKQAVHDIGDPGLLFGPREMRLYPNGSLAAHVMGGAGFGKEGVTAAE- 208

Query: 234 FLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
            + + G+ + F        N G    +P++L+LDL +Q    Q L+   K  NA+   +V
Sbjct: 209 VIGVAGVEKQFDDYLRDPANGG----RPLQLSLDLTVQAASEQVLLGGMKLMNAKGATSV 264

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIFEMGSIFKVFTIAM 340
           +++V TGEVIS+VS+PD+DP++  +    G+       FNR   G++E+GS FK+FT A 
Sbjct: 265 LMDVYTGEVISVVSLPDFDPNDRPRPPTSGFDPSVSPLFNRAVQGVYELGSTFKIFTAAQ 324

Query: 341 GIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGI 399
            +D GL   + + DT  P+++G+  I +++ +N   L++ +I   SSN G  ++A  +G 
Sbjct: 325 AVDLGLVNSETIIDTSGPMRIGRFPIGEFNNKNYGKLSVADIIVNSSNRGTGRLALQIGA 384

Query: 400 QGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +  ++FL  LG+      E+ E     P  P +W  + ++TIS+GHGLST+P+  A   A
Sbjct: 385 ERQQQFLRALGMFDPTPIEIVEASGGQPLKPKKWGELSTVTISYGHGLSTSPMHLAAGYA 444

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           A+ N GR + PT +   R+   ++   V+ ++     R++LR+ VT G+     VPG++V
Sbjct: 445 AIANGGRYVSPTIL---RQTGPQLGDRVMSEDAAAQARAMLRKVVTSGTASFGEVPGYQV 501

Query: 518 GGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI----KERNQLTA 571
           GGKTGTA K  K R  Y ++    +F A+FP  DP+Y+++  +D P +    +ER   TA
Sbjct: 502 GGKTGTADKP-KPRGGYYESKVIATFAAMFPAHDPKYVLIVTLDEPSVIAHGEERR--TA 558

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G    P+ G +I R A +LG++P
Sbjct: 559 GWTAVPVAGEMIGRIAPLLGLRP 581


>gi|67459294|ref|YP_246918.1| penicillin-binding protein [Rickettsia felis URRWXCal2]
 gi|67004827|gb|AAY61753.1| Penicillin-binding protein [Rickettsia felis URRWXCal2]
          Length = 561

 Score =  320 bits (820), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 193/542 (35%), Positives = 315/542 (58%), Gaps = 25/542 (4%)

Query: 70  SKN-RIGMTIVVC--LVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMS---RPDIIDR 122
           SKN +I + +V+C    ++  L+ R II   N++ +      NI+ +  +   R +I+DR
Sbjct: 22  SKNTKIRLLMVICGFSFLFCTLSYRLIIVATNVYDK------NINSFKKNHQFRKEIVDR 75

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NG +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R L
Sbjct: 76  NGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLTELKSNKSFIWVKRDL 135

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
            P QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   D      
Sbjct: 136 LPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAYDKYLTNS 195

Query: 243 VFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
            +  N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE++++V+ 
Sbjct: 196 DYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGEILALVNK 255

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           PD+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D  + +KVG
Sbjct: 256 PDFDPHHPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVG 314

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
              + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE 
Sbjct: 315 GFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPER 374

Query: 423 QAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
             P +P +  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + 
Sbjct: 375 GTPLFPPEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKV 432

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDT 535
           +   V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      KK+Y   
Sbjct: 433 IGTKVFSENTSTQMKKLFRSVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGGKKKYLKN 492

Query: 536 LNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVK 593
              +SFL V P ++PQY++    D PK  KE     TA    AP  G +  R  S+ G++
Sbjct: 493 SRASSFLGVLPASNPQYVIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLE 552

Query: 594 PV 595
           P+
Sbjct: 553 PI 554


>gi|157803596|ref|YP_001492145.1| penicillin-binding protein [Rickettsia canadensis str. McKiel]
 gi|157784859|gb|ABV73360.1| Penicillin-binding protein [Rickettsia canadensis str. McKiel]
          Length = 561

 Score =  319 bits (818), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 192/539 (35%), Positives = 314/539 (58%), Gaps = 19/539 (3%)

Query: 70  SKN-RIGMTIVVC--LVIYIILAIR-IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           SKN +I + IV+C    ++  L+ R II   N++ + +      +++   R +I+DRNG 
Sbjct: 22  SKNIKIRLLIVICGFSFLFCTLSYRLIIVATNVYDKNLNAVKKNNQF---RKEIVDRNGN 78

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F W++R L P 
Sbjct: 79  LLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSFIWVKRDLLPS 138

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           QQ++I S GL G  F  E+ R Y  ++  SHV+GYV  D  G++G+E   D         
Sbjct: 139 QQEKITSLGLLGFDFEEEQKRIYIFSNLLSHVIGYVGRDLVGLSGLELAYDKYLTNSDHA 198

Query: 246 TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
            N+     +P++L++D+R+Q+I+ +E+ +  K++NA     +I + + GE++++V+ PD+
Sbjct: 199 LNEPGNWKEPLKLSIDIRLQSILSEEIDKTLKQFNAIGAVGIIADPNNGEILALVNKPDF 258

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DPH     + E  FN  S G++EMGS+FK  T+A+G D+G   + D +D  + +KVG   
Sbjct: 259 DPHHPNLARPEELFNIASLGLYEMGSVFKALTMAVGFDTGAINMNDAYDI-SYMKVGGFQ 317

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE   P
Sbjct: 318 LKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQLQIELPERGTP 377

Query: 426 SYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
            +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R++ + + R
Sbjct: 378 LFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGTLYDLTLL--KRKDEKVIGR 435

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDTLNF 538
            V  ++T   M+ L R  V  G+G+RA V G+ VGGKTGTA+K+      KK+Y      
Sbjct: 436 RVFSEHTSTQMKKLFRSVVKEGNGKRAEVKGYLVGGKTGTAEKLSQGAGGKKKYLKNSRA 495

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPV 595
           +SFL V P ++PQY++    D PK  KE     TA    AP  G +  R  S+ G++P+
Sbjct: 496 SSFLGVLPVSNPQYVIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERMISLYGLEPI 554


>gi|51473748|ref|YP_067505.1| cell division protein FtsI/ penicillin-binding protein [Rickettsia
           typhi str. Wilmington]
 gi|51460060|gb|AAU04023.1| cell division protein FtsI/ penicillin-binding protein [Rickettsia
           typhi str. Wilmington]
          Length = 561

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 187/541 (34%), Positives = 309/541 (57%), Gaps = 18/541 (3%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIR---IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRN 123
           I     +I + +V+C   ++   +    II   N++ + I       ++   R +I+DRN
Sbjct: 20  ICSKNTKIRLLMVICGFSFLFSTVSYRLIIVATNVYDKNINSFKKKHQF---RKEIVDRN 76

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   + ++L S   F W++R L 
Sbjct: 77  GNLLAMNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLIKELKSNKSFIWVKRDLL 136

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
           P QQ++I+S GL G  F  E+ R Y  ++  SHV+GYV  D  G++G+E   D       
Sbjct: 137 PSQQEKIISLGLLGFEFEEEQKRIYIFSNLLSHVIGYVGRDAVGLSGLELAYDKYLTNTD 196

Query: 244 FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
           +  N  +    P++L++D+R+Q+I+ +E+ +  KK+NA     +I + + GE++++V+ P
Sbjct: 197 YELNDLKDQKAPLQLSIDIRLQSILSEEIDKTLKKFNAIGAVGIIADPNNGEILALVNKP 256

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           D+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G+  + D +D  + +KVG 
Sbjct: 257 DFDPHYPSLAKPEELFNTASLGIYEMGSVFKSLTMAVGFDTGVINMNDAYDI-SYMKVGG 315

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L+ ELPE  
Sbjct: 316 FQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKNDFKKYLKKLGLLDQLQIELPERG 375

Query: 424 APSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
            P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +   R+  + +
Sbjct: 376 TPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAILPVVNGGTLYDLTLL--KRKTQKVI 433

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-----KKRYSDTL 536
              V  +NT   M+ L R  V  G+G+RA + G+ +GGKTGTA+K+      KK+Y    
Sbjct: 434 GTKVFSENTSTQMKKLFRSVVKEGNGKRAEIKGYLIGGKTGTAEKLSQGVGGKKKYLKNS 493

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRSASMLGVKP 594
             +SFL + P ++PQY++    D PK  KE     TA     P  G +  R  S+ G++P
Sbjct: 494 RASSFLGILPASNPQYVIFIRFDEPKPTKESFGFATASWTAVPTAGRVFERMISLYGLEP 553

Query: 595 V 595
           +
Sbjct: 554 I 554


>gi|126741289|ref|ZP_01756967.1| penicillin-binding protein [Roseobacter sp. SK209-2-6]
 gi|126717607|gb|EBA14331.1| penicillin-binding protein [Roseobacter sp. SK209-2-6]
          Length = 594

 Score =  319 bits (817), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 187/555 (33%), Positives = 304/555 (54%), Gaps = 30/555 (5%)

Query: 62  RRRKVIAHSKNRIGMTIVVC----LVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSR 116
           R  ++ A S++R    ++V     L  Y  +A R+       P EP+A +       M R
Sbjct: 33  RHEEMQAKSRHRAEGRLLVLGIFFLCAYAAVAGRMGVLATSEPREPVAAAPG-SVIAMQR 91

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
            DI+DR G ILAT+  T SLY +P ++I P   +++L  + P+LD E +    + + KF 
Sbjct: 92  ADIVDRQGRILATNFETHSLYAQPPQMIDPIGAVDRLVEIFPDLDRERLLADFTGKRKFL 151

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W+++K+SP+Q++ +   G PG+ F   + R YP  S A+HV+G       G++  E  + 
Sbjct: 152 WIKKKISPEQKQAVHDIGDPGLLFGPREMRLYPNGSVAAHVLGGAGFGKEGVSAAE-VIG 210

Query: 237 MQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
           + G+ R F +         +P++LALDL +Q    + L    +  NA+   +++++V TG
Sbjct: 211 VAGVERQFDSYLRDPANGSKPLQLALDLTVQAAAERVLDGGMRLMNAKGATSILMDVHTG 270

Query: 295 EVISMVSIPDYDPHEAFKGKKEG-------WFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           EVIS+VS+PD+DP++  +    G        FNR   G++E+GS FK+F  A  +D  L 
Sbjct: 271 EVISVVSLPDFDPNDRPRPPTSGDDPSVSPLFNRAVQGVYELGSTFKIFAAAQAVDLELV 330

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
             + + DTR P++ GK +I D+      L++ +I   SSNIG A++A  +G +  + F+ 
Sbjct: 331 NSETIIDTRGPLRWGKFLIKDFRNYGNALSVSKIIVKSSNIGTARLAQQIGAERQQSFMD 390

Query: 408 RLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
            LG+L     E+ E Q   P  P  W  + ++TIS+GHG+STTP+  A   AA+ N GR 
Sbjct: 391 ALGMLEATPFEITEAQGGKPLLPKNWSELSAMTISYGHGISTTPMHLAAGYAAIANGGRY 450

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
           + PT +   ++   ++   V+ +   +  R +LR+ VT G+   A VPG++VGGKTGTA 
Sbjct: 451 VSPTVL---KQNGPQLGSRVMSEEAAEAARIMLRKVVTEGTASFARVPGYQVGGKTGTAD 507

Query: 526 KVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI----KERNQLTAGINVAPMV 579
           K  K R  Y D     +F ++FP  DP+Y+++  +D P I    +ER   TAG    P+ 
Sbjct: 508 KP-KPRGGYYDEKVIATFASIFPAHDPKYVLVVTLDEPSIIAHGEERR--TAGWTAVPVA 564

Query: 580 GNIIRRSASMLGVKP 594
             ++ R A +LG++P
Sbjct: 565 AEMVGRLAPLLGLRP 579


>gi|239947590|ref|ZP_04699343.1| penicillin-binding protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921866|gb|EER21890.1| penicillin-binding protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 542

 Score =  318 bits (816), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 181/489 (37%), Positives = 290/489 (59%), Gaps = 12/489 (2%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R +I+DRNG +LA ++P+ SL+  P  V+ P+  ++KL  +LP+++   +  +L S   F
Sbjct: 50  RKEIVDRNGNLLAVNLPSASLFANPQIVLDPETSVKKLAEILPDINKAKLLAELKSNKSF 109

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L P QQ++I S GL G  F  E+ R Y  ++  SHVVGYV  D+ G++G+E   
Sbjct: 110 IWVKRDLLPSQQEKITSLGLLGFEFEEEQKRIYTFSNLLSHVVGYVGRDSVGLSGLELAY 169

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
           D       +  N+ +   +P++L++D+R+Q+I+ +E+ +  K++ A     +I + + GE
Sbjct: 170 DKYLTNSDYELNEPKNRKEPLQLSIDIRLQSILSEEIDKTLKQFKAIGAVGIIADPNNGE 229

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           ++++V+ PD+DPH     K E  FN  S GI+EMGS+FK  T+A+G D+G   + D +D 
Sbjct: 230 ILALVNKPDFDPHHPSLAKPEELFNIASLGIYEMGSVFKALTMAVGFDTGAINMNDAYDI 289

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
            + +KVG   + DY P+    ++PEIF YSSNIG +QI   +G    K++L +LGLL +L
Sbjct: 290 -SYMKVGGFQLKDYTPRQGWHSVPEIFLYSSNIGTSQIMLEIGKSNFKKYLKKLGLLDQL 348

Query: 416 ETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           + ELPE   P +PS+  W  + S+T+S+G+G+S +PL    A   ++N G L   T +  
Sbjct: 349 QIELPERGTPLFPSEKRWNELTSVTMSYGYGISISPLHFVRAMLPVVNGGILYDLTLL-- 406

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI----- 528
            R++ + +   V  +NT   M+ L R  V  G+G+RA V G+ +GGKTGTA+K+      
Sbjct: 407 KRKDEKVIGTKVFSENTSTQMKKLFRSVVKEGNGKRAEVKGYLIGGKTGTAEKLSQGAGG 466

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIRRS 586
           KK+Y      +SFL V P ++PQY++    D PK  KE     TA    AP  G +  R 
Sbjct: 467 KKKYLKNSRASSFLGVLPASNPQYVIFIRFDEPKPTKESFGFATASWTAAPTAGRVFERM 526

Query: 587 ASMLGVKPV 595
            S+ G++P+
Sbjct: 527 ISLYGLEPI 535


>gi|254292763|ref|YP_003058786.1| peptidoglycan glycosyltransferase [Hirschia baltica ATCC 49814]
 gi|254041294|gb|ACT58089.1| Peptidoglycan glycosyltransferase [Hirschia baltica ATCC 49814]
          Length = 559

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 179/529 (33%), Positives = 284/529 (53%), Gaps = 21/529 (3%)

Query: 77  TIVVCLVIYIILAI-----RIIQYGNIHPEPIAP-SMNIDEYGMSRPDIIDRNGEILATD 130
            I+V  VI ++  +      ++  G  H   +A  S+++      R DI+DRNGE+LAT 
Sbjct: 25  AIMVAGVIALMFGVVTWRASVVAMGGTHEASVAEKSVHV---AAQRSDIVDRNGELLATS 81

Query: 131 IPTFSLYVEPHKVISPDEIIEKLQIVLPNLD-SEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           +   SL   P ++    E+ E L  V  +LD  ++I R      KF W+RRK+SP+Q++ 
Sbjct: 82  LTIDSLAAAPQEIWDAREVAEGLATVFEDLDVDQLIARLEDPNRKFVWIRRKVSPRQRQA 141

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           +   GL G+ F  E  R Y   + A H++G+ ++D++GI G+E    +    R+    K 
Sbjct: 142 VYDLGLEGLRFEKEVQRIYTGGALAGHLIGFTNVDSQGIAGLE----LAHQDRLAAGGK- 196

Query: 250 EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHE 309
                P++L +D  +Q  +  EL    + ++ +    V++   TG V ++ S P  DP+ 
Sbjct: 197 -----PLKLTIDTGVQFALEDELKFAAEAFHVKGAAGVVIEAKTGAVRAIASWPAIDPNR 251

Query: 310 AFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDY 369
                 +   NR    +FE+GS+FK  T+A  +D+G+    + F+    I++G   + D 
Sbjct: 252 PGDMTGDQRLNRAMGAVFELGSVFKPLTVAAALDAGVLRPSETFNVAQNIQIGAVTVRDR 311

Query: 370 HPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS 429
           HP + I ++ +I  +SSN+G  +I   +G++ HKEFL R+GLLS+ +   P   AP  P 
Sbjct: 312 HPISSIASVTDIIVHSSNVGTVKIEQLLGLRQHKEFLDRVGLLSRPQVVYPGAAAPILPV 371

Query: 430 QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKN 489
           +W  +   TIS+GHGL+ +PL  A A  A  N+G ++ P F +    E E     V+   
Sbjct: 372 EWDELTGATISYGHGLAVSPLALAAAYTAFANDGEMVRPRF-VEPEPEDEIARTRVVSAP 430

Query: 490 TVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD 549
           T + +  ++R  VT G+G RA V G+EVGGKTGTA+K     Y    N  SF+++FPT+ 
Sbjct: 431 TARLITDMMRRTVTDGTGTRADVYGYEVGGKTGTAEKPGPDGYDPHRNICSFVSLFPTSR 490

Query: 550 PQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           P+Y+VL  +D P+  E    TA +N AP+ G +I R A ML V PV  K
Sbjct: 491 PEYVVLIVLDEPEALEGEGKTAALNAAPLTGRLIARIAPMLDVAPVLEK 539


>gi|254465124|ref|ZP_05078535.1| peptidoglycan glycosyltransferase [Rhodobacterales bacterium Y4I]
 gi|206686032|gb|EDZ46514.1| peptidoglycan glycosyltransferase [Rhodobacterales bacterium Y4I]
          Length = 594

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 181/516 (35%), Positives = 288/516 (55%), Gaps = 35/516 (6%)

Query: 101 EPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
           EP+A S+      M R DI+DR G +LAT+  T SLY +P ++I P    EKL  + P+L
Sbjct: 77  EPVA-SVPGSAIAMQRADIVDREGRLLATNFETHSLYAQPPQMIDPIGAAEKLVEIFPDL 135

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           D E + +  + + KF W+++K+SP+Q + +   G PG+ F   + R YP  S A+HV+G 
Sbjct: 136 DRERLIKDFTGKRKFLWVKKKISPEQLQAVHDIGDPGLMFGPREMRLYPNGSLAAHVLGG 195

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVE 274
                 G+   E  + + G+ R F        N G    +P++L+LDL +Q    Q L  
Sbjct: 196 AGFGKEGVNAAE-VIGVAGVERQFDDYLRDPANAG----KPLQLSLDLTVQAAAEQVLYG 250

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIF 327
             K  NA+   +++++  TGEVIS+VS PD+DP++  +    G+       FNR   G++
Sbjct: 251 GMKLMNAKGATSILMDAHTGEVISVVSFPDFDPNDRPRPPTSGFDPSDSPLFNRAVQGVY 310

Query: 328 EMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSN 387
           E+GS FK+FT A  +D GL     + DTR P++ G+  I D+      +++ +I   SSN
Sbjct: 311 ELGSTFKIFTAAQAMDLGLVGADTVIDTRGPLRWGRFAIRDFRNYGNEMSVTKIIVKSSN 370

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGL 445
           IG A++A  +G++  K FL  +G+L     E+ E     P  P+ W  + ++TIS+GHG+
Sbjct: 371 IGTARLAQQIGVERQKSFLQTMGMLDPTPFEISEAAGGKPLLPANWSELSAMTISYGHGI 430

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGG 505
           STTP+  A   AA+ N GR + PT + R+     ++ + V+ + +    R +LR+ V+ G
Sbjct: 431 STTPMHLAAGYAAVANGGRYVAPTILKRN---GPQLGQRVMSEASAAAARKMLRKVVSEG 487

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKR---YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
           +   A V G++VGGKTGTA K  K R   Y D +   +F ++FP  DP+Y+++  +D P 
Sbjct: 488 TASFAEVEGYQVGGKTGTADKP-KPRGGYYEDKV-IATFASIFPAHDPKYVLIVTLDEPS 545

Query: 563 I----KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           I    +ER   TAG   AP+   +I R A ++G++P
Sbjct: 546 IIAHGEERR--TAGWTAAPVAAEMIGRIAPLVGLRP 579


>gi|315498855|ref|YP_004087659.1| peptidoglycan glycosyltransferase [Asticcacaulis excentricus CB 48]
 gi|315416867|gb|ADU13508.1| Peptidoglycan glycosyltransferase [Asticcacaulis excentricus CB 48]
          Length = 599

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 192/540 (35%), Positives = 294/540 (54%), Gaps = 35/540 (6%)

Query: 67  IAHSKNRIGMTIVVCLVIYIIL---AIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRN 123
           +A ++ RI   +V   VIY++L   A++    G  H + +  S+  D    +R DI+DRN
Sbjct: 42  LASARMRIFFILVAMGVIYLVLSGFAVKAALSGG-H-DGVDYSLPAD----ARADIVDRN 95

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIV--LPNLDSEMIRRKLSSETKFQ---WL 178
           G +LATD+  + L+++P  V++ D  + K  ++  LP++  + +   LS + +     WL
Sbjct: 96  GALLATDVFNYDLFLDPADVMAADRPLVKRALIQLLPDVPRDQLDSALSGDKRLMVMPWL 155

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
               S   + RILS+GLPGVGF   + R YP  +  +  +G  +   +G+ G E      
Sbjct: 156 ----SAADKARILSYGLPGVGFEPRRLRGYPLGTAGAFYIGMTEKAGKGLAGAE------ 205

Query: 239 GLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVIS 298
              R F       N  P  LA+DLR+Q  +  E+       +A+    ++ NV TGEVI+
Sbjct: 206 ---RAFQDQIARSN-TPFPLAMDLRVQGALENEVRNVAIAQSAKGAIGLVTNVRTGEVIA 261

Query: 299 MVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNP 358
           M S P++DP++A +       NR++  +FE+GS+FKV ++A+G++SG  ++   +D R P
Sbjct: 262 MSSWPEFDPNQAGRFPDNNKLNRVTNSVFEVGSVFKVLSVAIGLESGTASLNTTYDARTP 321

Query: 359 IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETE 418
            ++GK  I DYH +NRI+T+ ++F  SSNIG   +A+++GI    +F   LGL    + E
Sbjct: 322 YQLGKRKISDYHAENRIMTLEDVFLVSSNIGTTLMAESVGIDTMTKFYNALGLFRAADIE 381

Query: 419 LPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           L E  +P  P +W +    + SFGHG+S +PL  A AAAA +N G L P T       + 
Sbjct: 382 LAETASPLLPKKWSKDSLASSSFGHGMSISPLSYAQAAAATMNGGYLRPLTLRKYDPSQP 441

Query: 479 EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNF 538
            K  R V   NT + M  L+R  V  G+G +A VPG  VGGKTG+A+KVI  RY  T   
Sbjct: 442 LKGER-VFSANTSRQMLDLMRVNVLKGTGGKANVPGLRVGGKTGSAEKVIGGRYDRTKLL 500

Query: 539 NSFLAVFPTT----DPQYIVLSFMDSPKIKER--NQLTAGINVAPMVGNIIRRSASMLGV 592
           +SF+AVFPT     D +Y+V+  +D P   +      T G   AP+ G +I R A  L V
Sbjct: 501 SSFVAVFPTDGNVEDDRYMVMIMVDEPTGNKDTFGLRTGGWVAAPVAGRVIDRIAPFLNV 560


>gi|89055258|ref|YP_510709.1| peptidoglycan glycosyltransferase [Jannaschia sp. CCS1]
 gi|88864807|gb|ABD55684.1| Peptidoglycan glycosyltransferase [Jannaschia sp. CCS1]
          Length = 593

 Score =  312 bits (800), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 172/492 (34%), Positives = 277/492 (56%), Gaps = 16/492 (3%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R DI DR+G ILAT+  T +LY  PH +I P    + L  + P +D++ + R+ +S ++
Sbjct: 91  TRADITDRHGRILATNFATNALYAHPHDLIYPRAAADGLAEIFPEMDADDLHRRFTSGSR 150

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WLRR +SP+Q++ +   G PG+ F   + R YP  S A+H++G        +   E  
Sbjct: 151 FLWLRRYISPEQEQMVHDLGEPGLLFGPREMRLYPNGSIAAHILGGASFGEEAVNAAE-V 209

Query: 235 LDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           + + G+   F    +    L P+ L+LDL +Q  V + L       NA     V+++V T
Sbjct: 210 IGVAGVEARFDNELRDPSRLDPLMLSLDLTVQAAVEEVLAGGMSLMNARGAAAVLMDVHT 269

Query: 294 GEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           GEVISM S+PD+DP+   +   EG       FNR   G++E+GS+FK FTIA  ++  LF
Sbjct: 270 GEVISMASLPDFDPNARPRPLLEGDQADSPLFNRAVQGVYELGSVFKTFTIAQALELNLF 329

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
              D+ DT  P+++    I D+       ++ ++  +SSNIG A++A  +G Q  ++FL 
Sbjct: 330 NTYDMIDTTGPLRMAGFAIRDFSNYGPEQSVADVLIHSSNIGTARMARVIGGQRQRDFLD 389

Query: 408 RLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
           +LGLL+  + E+ E  +  P  P +W  + ++T+S+GHG+ST+PL  A A + ++N G L
Sbjct: 390 QLGLLAPTQVEMVEAASGRPLLPRRWGELATMTVSYGHGVSTSPLHLASAYSTIVNGGTL 449

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
           I PT +   R E  +    V+ + T   + +LLR+ VT G+     V G+ VGGKTGTA 
Sbjct: 450 IEPTLV---RREGPQNGPRVISEATSGMVNALLRQVVTEGTASFGEVDGYFVGGKTGTAD 506

Query: 526 -KVIKKRYSDTLNFNSFLAVFPTTDPQYI-VLSFMDSPKIK-ERNQLTAGINVAPMVGNI 582
               +  Y +  N N+F + FP TDPQY+ +++  ++ ++     + TAG    P+   I
Sbjct: 507 MPRPQGGYYEDRNLNTFASAFPMTDPQYVLIVTLQEAAELSGPEPRRTAGWTAVPVAAEI 566

Query: 583 IRRSASMLGVKP 594
           IRR+A +LG++P
Sbjct: 567 IRRTAPLLGLRP 578


>gi|89067946|ref|ZP_01155390.1| Cell division protein FtsI/penicillin-binding protein 2 [Oceanicola
           granulosus HTCC2516]
 gi|89046544|gb|EAR52600.1| Cell division protein FtsI/penicillin-binding protein 2 [Oceanicola
           granulosus HTCC2516]
          Length = 595

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 183/554 (33%), Positives = 301/554 (54%), Gaps = 27/554 (4%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRI-IQYGNIHPEPIAPSMNIDEYGMSRPD 118
           +  R K  A ++ R+ +   +  + ++ +  R+    G+   EP A S+  +    +R D
Sbjct: 35  EDMRDKARARAEGRLVVLGAMFFLAFVTIGGRMGALAGSESSEPEA-SVAGNPIIGTRAD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I+DRNG ILAT++ T +LYV P  +I P+     L  + P L  + +    +SE +F W+
Sbjct: 94  IVDRNGRILATNLDTHALYVHPQDIIDPEAAARGLVEIFPELKYDELYELFTSERRFDWI 153

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           RR++SP+Q + +   G PG+ F   + R YP  S A+H++G       G++  E  + + 
Sbjct: 154 RREISPEQMQAVFEIGDPGLLFGPREMRLYPNGSLAAHILGGASYGTEGVSAAE-VIGVA 212

Query: 239 GLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           G  + F        N+G     P+ L++DL +Q    + L       NA+   +V++++ 
Sbjct: 213 GAEKYFDNYLRDPANEG----APLELSIDLSVQAAAERVLQGGMTLMNAKGASSVLMDIH 268

Query: 293 TGEVISMVSIPDYDPHE----AFKGKKEG--WFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           TGE++SMVS+PD+DP+     A +G +     FNR   G++E+GS+FK+FTIA G++ GL
Sbjct: 269 TGEILSMVSLPDFDPNNRPPVATQGDQSDSPLFNRAVQGVYELGSVFKIFTIAQGMELGL 328

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
              + + +T+ P+  G+  I D+H     L+  ++   SSNIG A++A  +G +  +EFL
Sbjct: 329 INAETMIETKGPLTWGRFRIRDFHDYGPELSATDVIVESSNIGTARVAMHIGGERQREFL 388

Query: 407 YRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
            RLGLL     EL E     P  P+ W  I ++TIS+GHGLS++PL  A A A+L+N G 
Sbjct: 389 GRLGLLEPTSVELVEAPTGRPLLPANWSEISTMTISYGHGLSSSPLHLAQAYASLLNGGE 448

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
            + PT + R+          V+        R +LR+ V  G+     VPG++V GKTGTA
Sbjct: 449 RVTPTLLRRT--APPPAGERVVSDVVSAAARYMLRQVVVRGTASFGEVPGYDVAGKTGTA 506

Query: 525 QKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVG 580
            K  +    Y D     +F ++FP  DPQY+++  +D P   + ++ + TAG    P+  
Sbjct: 507 DKPRENGGGYYDDKVIATFASIFPADDPQYVLILSLDEPVETMGDQPRRTAGWTAVPVAA 566

Query: 581 NIIRRSASMLGVKP 594
            +IRR+A +LG++P
Sbjct: 567 EMIRRTAPLLGLRP 580


>gi|84516396|ref|ZP_01003755.1| Cell division protein FtsI/penicillin-binding protein 2 [Loktanella
           vestfoldensis SKA53]
 gi|84509432|gb|EAQ05890.1| Cell division protein FtsI/penicillin-binding protein 2 [Loktanella
           vestfoldensis SKA53]
          Length = 593

 Score =  312 bits (799), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 176/548 (32%), Positives = 293/548 (53%), Gaps = 26/548 (4%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           K  + ++ R+ +  ++    ++++  R+    +  PE    +   +     R DI+DRNG
Sbjct: 39  KARSRAEGRLLLLGLMFFCAFVVIGGRMGTLASSVPEEPRAAAEGNPIIGQRADIVDRNG 98

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
            +LAT++ TFSLY  P +++ P     +L  + P +D++ +    + E +F WLRR++SP
Sbjct: 99  RLLATNLDTFSLYAHPRQMVDPARTAAQLAAIFPEMDADRLLTDFTGERRFLWLRRQMSP 158

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
           +Q + +   G PG+ F   + R YP  S A+H++G       G++  E  + + G+ R F
Sbjct: 159 EQMQAVHDIGSPGLLFGPREMRLYPNGSLAAHILGGTRYGREGVSSAE-VIGVAGVERQF 217

Query: 245 T------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVIS 298
                   N+G     P++L++DL IQ    + L       NA+    V++N+ +GE+I+
Sbjct: 218 DPFLRDPANEG----APLQLSIDLSIQAATERVLAGGMALMNAKGATAVLMNIHSGEIIA 273

Query: 299 MVSIPDYDPHE----AFKGKKEG--WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           M S+PD+DP+     A  G +     FNR   G++E+GS+FK+F +A  ++ GL     +
Sbjct: 274 MASLPDFDPNSRPQVAITGDQSDSPLFNRAVQGVYELGSVFKIFAVAQAMELGLVDADTM 333

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            DT +P+  G+  I D+       ++ ++   SSN+G A+IA  +G +  ++FL +LGLL
Sbjct: 334 VDTTSPLTWGRFRIRDFRNYGAQNSVTKVIVKSSNVGTARIAMQIGAERQRDFLGQLGLL 393

Query: 413 SKLETELPE--IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
                EL E    AP  PS W  I ++TIS+GHGLS++PL  A A AA++N G  + PT 
Sbjct: 394 QATPVELIEAPTGAPLLPSNWSEISTMTISYGHGLSSSPLHLAAAYAAMVNGGTKVAPTL 453

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQK--VI 528
           +   R    +    V+     +++  +LR  VT G+     V G+ VGGKTGTA K    
Sbjct: 454 L---RNPDPQPGPRVISAAVSQSVVDMLRATVTEGTASMGDVAGYAVGGKTGTADKPRAA 510

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGNIIRRS 586
              Y D     +F +VFP +DPQY++++ +D P        + TAG    P+   IIRR+
Sbjct: 511 GGGYYDDKVIATFASVFPASDPQYVLITTLDEPVETSGTEPRRTAGWTAVPVAAEIIRRT 570

Query: 587 ASMLGVKP 594
           A +LG++P
Sbjct: 571 APLLGLRP 578


>gi|197105791|ref|YP_002131168.1| penicillin-binding protein B [Phenylobacterium zucineum HLK1]
 gi|196479211|gb|ACG78739.1| penicillin-binding protein B [Phenylobacterium zucineum HLK1]
          Length = 581

 Score =  311 bits (798), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 178/496 (35%), Positives = 271/496 (54%), Gaps = 23/496 (4%)

Query: 109 IDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRK 168
           I   G+SR D++DRNG +LA D+  + LY++P ++   +E   +L   LP LD   + R 
Sbjct: 78  IAPAGVSRADLVDRNGMLLAADLLHYGLYIDPREIWETEETRRQLLAALPGLDRARLERA 137

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
           L  + +  ++   L+P ++ R+ + GLPGV F  E+ R YP  + A+HV+G+ D    G+
Sbjct: 138 LRGQRRL-FVMGALTPAERNRVHALGLPGVSFEPEQRRVYPLGASAAHVIGFSDTGGEGL 196

Query: 229 TGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
           +G E  L+ +    +     G+     + L++DLR+Q  +  EL +   ++  +    ++
Sbjct: 197 SGAEAALNEE----IRAAAGGQ-----VPLSIDLRVQGALEDELWKAVHEFTPKGAVGLV 247

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
            +V TGE++ M S P +DP++  +       NR +  +FEMGS FK FT+A+G+D+G+ T
Sbjct: 248 TDVHTGEILGMASWPTFDPNKPGQATDYVRTNRAAASVFEMGSTFKAFTVAIGLDAGVAT 307

Query: 349 VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
               FD R P K+G   IHDYH   ++LT+ E+F++SSNIG A++A  +G +    +   
Sbjct: 308 PNTTFDAREPFKLGYRTIHDYHAARKVLTLVEVFQHSSNIGTAKLAVGIGPERMGRYFDG 367

Query: 409 LGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           LGL      EL E   P  P +W      + SFGHG++ +PL  A A  A++N GRL+P 
Sbjct: 368 LGLTKPAPVELIESARPLTPRKWDEDAVASTSFGHGINVSPLALARAMGAILNGGRLVPL 427

Query: 469 TFMIRSREESEKVSRI-VLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFEVGGKTGTAQ 525
           T  IR  E    V    V+ + T   M S++R  V G  GSGR A +PG  VGGKTGT +
Sbjct: 428 T--IRKLEPGAAVDGPRVMSERTSLQMLSIMRANVAGEAGSGRSANIPGLSVGGKTGTGE 485

Query: 526 KVIK--KRYSDTLNFNSFLAVFPTTDP----QYIVLSFMDSPKIKERNQ--LTAGINVAP 577
           K     + Y+     +SF AVFPT+ P    +Y VL  +D P    R+    T G   AP
Sbjct: 486 KYDPAIRAYNHERQVSSFAAVFPTSGPAEAKRYFVLILLDEPHGTARSAGYATGGWVAAP 545

Query: 578 MVGNIIRRSASMLGVK 593
             G +I R A  LGV+
Sbjct: 546 AAGRVIERIAPFLGVE 561


>gi|162148955|ref|YP_001603416.1| peptidoglycan synthetase ftsI [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545292|ref|YP_002277521.1| peptidoglycan glycosyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787532|emb|CAP57128.1| putative peptidoglycan synthetase ftsI [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532969|gb|ACI52906.1| Peptidoglycan glycosyltransferase [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 682

 Score =  311 bits (797), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 198/602 (32%), Positives = 311/602 (51%), Gaps = 60/602 (9%)

Query: 38  NMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRI-GMTIVVCLVIYIILAIRIIQYG 96
           +M SG +  Q+      G DL   R R     +++R+ G+++  C  ++  +A+++    
Sbjct: 11  SMRSGPSRPQRMDVRITGDDL---RSRTARERTQSRLLGVSVGFC-ALFGAVALKLAAAT 66

Query: 97  NIHP-EP----IAPSMNI----DEYGM----------SRPDIIDRNGEILATDIPTFSLY 137
            I P EP    +AP +      D  GM           R  I DRNG++LA  +P   +Y
Sbjct: 67  VIMPMEPERRQVAPQVPTIPKSDPKGMMAGDFALPQVHRASITDRNGQVLAISLPVAQVY 126

Query: 138 VEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPG 197
             P ++I P +  +KL+ VLP LD++   R+LS++ +F +L R +SP Q+  I + G+PG
Sbjct: 127 ANPQEMIDPQDAAQKLKSVLPALDTDETIRRLSTKKQFVYLARDISPMQEVAINNLGIPG 186

Query: 198 VGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIR 257
           + F   + R YP    A+H++G VDID+ G+ G+E+FLD           + + +  P+R
Sbjct: 187 IYFEPGERRHYPLGRVAAHIMGAVDIDDHGVAGVERFLD----------KRLDSDRTPLR 236

Query: 258 LALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG 317
           L+LD+RIQ +V  EL   K  + A     ++++V+TGE+I+MVS+PDYD ++  +   + 
Sbjct: 237 LSLDVRIQAVVRDELAAAKDMFQAIGACAIVMDVNTGEIIAMVSLPDYDANDFGRADPDA 296

Query: 318 WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQN--RI 375
            FNR   G++E GS FK+ T AM +  G+  + D F T  PI +G+  I D    +    
Sbjct: 297 RFNRAVTGMYEPGSTFKLQTAAMALQMGVAHIWDRFST-IPIHIGRFTISDMKTDHFAPW 355

Query: 376 LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKR 433
           L++P +  +SSN  AA IA  +G Q  +++L ++G  S    ELPE   P  P    W  
Sbjct: 356 LSLPGVMAFSSNPAAAHIALDVGAQRQQDWLRKMGFFSPAPIELPEAGRPIVPQTRNWGI 415

Query: 434 IHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRI--------- 484
              +T+ FGHG++  PL      AA +N G L+ PT + R    ++  +           
Sbjct: 416 STVMTVGFGHGVAEPPLAIVRGTAATVNGGLLLHPTLLARDDAGTDAPAAPSSDPSPTEP 475

Query: 485 ---------VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSD 534
                    V+       +R +LR  VT G+G+ A  PG+ VGGKTGTA+K+     Y  
Sbjct: 476 GAPAAAGTRVISPEISALLRRILRLDVTQGTGKSAESPGYFVGGKTGTAEKIGPHGGYLK 535

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGV 592
            +N  +F ++FP   P+Y V   +DSPK   +     TA  N AP V  I+ R   MLG+
Sbjct: 536 HVNVAAFTSIFPMNAPRYAVYVMLDSPKATPQTHGWTTAAWNAAPTVSKIVTRIGPMLGL 595

Query: 593 KP 594
            P
Sbjct: 596 FP 597


>gi|330994429|ref|ZP_08318354.1| Peptidoglycan synthase ftsI [Gluconacetobacter sp. SXCC-1]
 gi|329758429|gb|EGG74948.1| Peptidoglycan synthase ftsI [Gluconacetobacter sp. SXCC-1]
          Length = 674

 Score =  311 bits (796), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 174/500 (34%), Positives = 270/500 (54%), Gaps = 33/500 (6%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  IIDR G++LA  +P   +Y  P ++I   +   KL+  LP LD    RR+LS   +F
Sbjct: 97  RASIIDRTGQVLAMSLPVAQVYANPQEMIDAADAAHKLKGALPTLDEAETRRRLSLNKQF 156

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +L R +SP Q+  + + G+PG+ F   + R YP    A+ ++G VDID+ G+ G+E+F 
Sbjct: 157 VYLARDISPAQELAVNNLGIPGIYFEPGERRRYPMGRVAAQILGGVDIDDHGVAGVERFF 216

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
           D           + + +  P+RL++D+R+QN+VH EL      + A     ++++V TGE
Sbjct: 217 D----------RRLDADRTPLRLSVDVRVQNVVHDELQAAMDMFQAIGACAIVMDVHTGE 266

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +I+MVS+PDYD ++  +   +  FNR   G++E GS FK+ T AM +  G+  + D F +
Sbjct: 267 IITMVSLPDYDANDFGRAAPDARFNRAVTGMYEPGSTFKLQTTAMALQEGVAHIWDRFSS 326

Query: 356 RNPIKVGKHVIHDYHPQ--NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PIK+G+  I D      +  LT+PE+  YSSN  AA IA   G    +++L R+G  S
Sbjct: 327 -TPIKIGRFTISDMKSDHFDPWLTLPEVMAYSSNPAAAHIALDAGAARQQDWLRRMGFFS 385

Query: 414 KLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           ++  ELPE   P  PS   W    ++T++FGHG++  PL      AA  N G L+ PT +
Sbjct: 386 RVPIELPEAGRPIIPSVANWGVSTTMTVAFGHGVAEPPLSIVRGTAATANGGFLLRPTLV 445

Query: 472 IRSREESE--------------KVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
                 ++                 R++   N+   +R +LR  V  G+G++A  PG+ V
Sbjct: 446 AGQAASADATDGAPDAGQTIPPDAERLISAANS-DILRKILRLDVAKGTGQKAESPGYYV 504

Query: 518 GGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGIN 574
           GGKTGTA+K+     Y   +N ++F  +FP   P+Y +   +DSPK   +     TAG N
Sbjct: 505 GGKTGTAEKIGPHGGYLKHVNVSAFTGIFPMNAPRYAIYVMLDSPKPTAQTHGWTTAGWN 564

Query: 575 VAPMVGNIIRRSASMLGVKP 594
            AP   ++I R A MLG+ P
Sbjct: 565 AAPTASHMITRIAPMLGLFP 584


>gi|163741581|ref|ZP_02148972.1| penicillin-binding protein [Phaeobacter gallaeciensis 2.10]
 gi|161385315|gb|EDQ09693.1| penicillin-binding protein [Phaeobacter gallaeciensis 2.10]
          Length = 595

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 185/575 (32%), Positives = 314/575 (54%), Gaps = 45/575 (7%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-E 101
            NL Q+   M+      Q R+R     ++ R+ +  +  L  +  +  R+       P E
Sbjct: 28  ENLRQRHAEMQT-----QSRQR-----AEGRLLVLGMFFLCAFTAIGARMATLATSEPVE 77

Query: 102 PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD 161
           PIA S       M R DI+DR G ILAT+  T SLY +P +++ P+   ++L  + P+L+
Sbjct: 78  PIA-SAPGSAIAMQRADIVDRKGRILATNFETHSLYAQPPQMVDPEGAAQRLVEIFPDLE 136

Query: 162 SEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            E +    + + KF W+++K+SP+Q++ +   G PG+ F   + R YP  S A+HV+G  
Sbjct: 137 LERLVSDFTGKRKFIWIKKKISPEQKQAVHDIGDPGLLFGPREMRLYPNGSVAAHVLGGA 196

Query: 222 DIDNRGITGIEKFLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
                G++  E  + + G+ + F        N G    +P++L+LDL +Q    + L+  
Sbjct: 197 GFGKEGVSAAE-VIGVAGVEKQFDDYLRDPANGG----RPLQLSLDLTVQAASERVLLGG 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIFE 328
            K  NA+   +++++V TGEVIS+VS+PD+DP++  +    G+       FNR   G++E
Sbjct: 252 MKLMNAKGATSILMDVHTGEVISVVSLPDFDPNDRPRPPTSGFDPSTSPLFNRAVQGVYE 311

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSN 387
           +GS FK+FT A  +D G+   + + DT  P+++G+  I ++H +N   L++ +I   SSN
Sbjct: 312 LGSTFKIFTAAQAVDLGIVNSETIIDTSGPMRIGRFPIGEFHNKNYGKLSVADIIVNSSN 371

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGL 445
            G  ++A  +G Q  ++FL  +G+      E+ E     P  P +W  + ++TIS+GHGL
Sbjct: 372 RGTGRLALQIGAQRQQDFLRAMGMFEPTPIEIAEAAGGKPLKPRKWGELSTVTISYGHGL 431

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGG 505
           ST+P+  A   AA+ N G+ + PT +   R++  ++   ++        R++LR+ VT G
Sbjct: 432 STSPMHLAAGYAAIANGGQYVAPTIL---RQKGPQLGHRIMSPEAAGQARAMLRKVVTSG 488

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           +     VPG++VGGKTGTA K  K R  Y ++    +F A+FP  DP+Y+++  +D P +
Sbjct: 489 TASFGEVPGYQVGGKTGTADKP-KPRGGYYESKVIATFAAMFPAHDPKYVLVVTLDEPSV 547

Query: 564 ----KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               +ER   TAG    P+ G +I R A +LG++P
Sbjct: 548 IAHGEERR--TAGWTAVPVAGEMIGRVAPLLGLRP 580


>gi|332187164|ref|ZP_08388904.1| penicillin-binding Protein dimerization domain protein
           [Sphingomonas sp. S17]
 gi|332012864|gb|EGI54929.1| penicillin-binding Protein dimerization domain protein
           [Sphingomonas sp. S17]
          Length = 572

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 176/486 (36%), Positives = 278/486 (57%), Gaps = 14/486 (2%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNL-DSEMIRRKLSSE 172
           +R DI+DRNG  LA  I ++++ V P K+I  P EI  +L  ++P+  D      +L+ +
Sbjct: 68  ARGDIVDRNGSPLARTIDSWTIAVHPKKLIGDPMEIAARLAALMPDRGDQAWFYNQLTRK 127

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F +L+R+ SP   +++ + G PG+ F  E  R YP ++ A+H +G++  D  G++G+E
Sbjct: 128 ANFVYLQRRASPTLVEQVNAIGEPGIVFDRETQRLYPQSTLAAHALGFLSTDGHGMSGME 187

Query: 233 KFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           + LD + L      N  +   QP+ L++D R+Q  +  EL      ++A + G ++L+V+
Sbjct: 188 RVLDERLL------NPAQAG-QPVALSIDTRVQAAMESELGRAMNTFHARAGGGIVLDVN 240

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKD 351
           TGEV++MVS+P ++P+       E   N  +  +FE+GS FK  T+A  I++G+ T ++ 
Sbjct: 241 TGEVVAMVSMPTFNPNRVGMAGTEELRNITTQSVFELGSTFKPITMATAIENGVVTSMQR 300

Query: 352 LFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            FD  +P+KVG + IHD      R L + E   YSSNI  A+IAD +G Q  +    +LG
Sbjct: 301 RFDATHPLKVGGYTIHDERGDPKRWLNMAETLIYSSNIATARIADEIGPQRMQAMFKKLG 360

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
             +K + EL E   P  P+ W R  ++T ++GHG++ TPL  A A A L+N G   P T 
Sbjct: 361 FDTKPDIELREKGRPLLPTYWARTTTMTTAYGHGIAVTPLHLASAYATLVNGGIWRPATL 420

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           +  +   + +  R++ +  + K MR +LR  V  G+GR+   PG+ VGGKTGTA+  +  
Sbjct: 421 LKVAPGHAPQGRRVISEATSYK-MRQMLRLIVMRGTGRKGDAPGYRVGGKTGTAEAAVAG 479

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKER-NQLTAGINVAPMVGNIIRRSAS 588
            Y  + N  +F A FP   P+Y+VL+ +DSP+  KE     TA  N AP+VG  I R  +
Sbjct: 480 GYDRSRNVATFAAAFPMDQPRYVVLAMLDSPQGTKETFGWKTAAWNAAPVVGRTITRVGA 539

Query: 589 MLGVKP 594
           MLGV P
Sbjct: 540 MLGVVP 545


>gi|126726613|ref|ZP_01742453.1| penicillin-binding protein [Rhodobacterales bacterium HTCC2150]
 gi|126703942|gb|EBA03035.1| penicillin-binding protein [Rhodobacterales bacterium HTCC2150]
          Length = 596

 Score =  310 bits (794), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 179/548 (32%), Positives = 295/548 (53%), Gaps = 33/548 (6%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSRPDIIDRNGEILA 128
           ++ R+ +  +   V +  + +++    +  P EP   S     Y   R +I+DRNG ILA
Sbjct: 45  AEGRLLIASICFAVAFSAVGVKMFALSSTEPREPRTASSASKIYAQ-RANIVDRNGRILA 103

Query: 129 TDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQK 188
           T++ T+SLY +PH +  P+    +L  + P+L  E +    + + KF W+++K+SP+Q++
Sbjct: 104 TNLSTYSLYAQPHLMTDPENSAVELATIFPDLGVEDLLEDFTGKRKFLWIKKKISPEQKQ 163

Query: 189 RILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------GITGIEKFLDMQGL 240
           R+   G PG+ F   + R YP    A+HV+G               G  G+E+  D    
Sbjct: 164 RVHDIGDPGLLFGPREMRLYPNGKLAAHVLGGAGFGREDVHSAEVIGNAGVERTFD---- 219

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
              F  +  ++N  P+ LA+DL +Q+   + L    K  NA++  +V+++V TGE+IS+V
Sbjct: 220 --AFLRDPAQEN-APLELAIDLSVQDTAERVLYGGMKLMNAKAASSVLMDVKTGEIISLV 276

Query: 301 SIPDYDPH------EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           S+PD+DP+                FNR   G++E+GS FK+FTIA  ++ GL     +  
Sbjct: 277 SLPDFDPNTRPNPKATLDAADNPLFNRAVQGVYELGSTFKLFTIAQALELGLMNKNTMIP 336

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
           TR P+  GK  I D+H     L++ ++   SSNIG A+IA  +G++  KEFL  LGLL+ 
Sbjct: 337 TRGPLVWGKFKIRDFHDYGAKLSVTDVLVKSSNIGTAKIAIDIGVKRQKEFLDSLGLLTA 396

Query: 415 LETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
              E+ E     P  P  W  + ++TIS+GHG++ +P+  A A ++++N G  + PT + 
Sbjct: 397 TPLEISEAAGGRPQLPPNWSELSAMTISYGHGIANSPVHLAAAYSSILNGGYKVEPTIL- 455

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK-- 530
                 E+  R+V  +    TMR LLR+ V  G+     V G+EVGGKTGTA K   +  
Sbjct: 456 -KNPNPERGERVV-SEQVSATMRDLLRQVVVRGTASFGEVAGYEVGGKTGTADKPNPQGG 513

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE--RNQLTAGINVAPMVGNIIRRSAS 588
            Y D +   +F +VFP ++P+Y+++  +D P      + + TAG    P+   +IRR A 
Sbjct: 514 YYEDKV-IATFASVFPASNPRYVLIVTLDEPSENSGAKPRRTAGWTAVPVAAEMIRRIAP 572

Query: 589 MLGVKPVF 596
           ++G++PV 
Sbjct: 573 LVGLRPVI 580


>gi|163738708|ref|ZP_02146122.1| hypothetical protein RGBS107_11807 [Phaeobacter gallaeciensis
           BS107]
 gi|161388036|gb|EDQ12391.1| hypothetical protein RGBS107_11807 [Phaeobacter gallaeciensis
           BS107]
          Length = 595

 Score =  310 bits (794), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 185/575 (32%), Positives = 314/575 (54%), Gaps = 45/575 (7%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-E 101
            NL Q+   M+      Q R+R     ++ R+ +  +  L  +  +  R+       P E
Sbjct: 28  ENLRQRHAEMQT-----QSRQR-----AEGRLLVLGMFFLCAFTAIGARMATLATSEPVE 77

Query: 102 PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD 161
           PIA S       M R DI+DR G ILAT+  T SLY +P +++ P+   ++L  + P+L+
Sbjct: 78  PIA-SAPGSAIAMQRADIVDRKGRILATNFETHSLYAQPPQMVDPEGAAQRLVEIFPDLE 136

Query: 162 SEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            E +    + + KF W+++K+SP+Q++ +   G PG+ F   + R YP  S A+HV+G  
Sbjct: 137 LERLVGDFTGKRKFIWIKKKISPEQKQAVHDIGDPGLLFGPREMRLYPNGSVAAHVLGGA 196

Query: 222 DIDNRGITGIEKFLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
                G++  E  + + G+ + F        N G    +P++L+LDL +Q    + L+  
Sbjct: 197 GFGKEGVSAAE-VIGVAGVEKQFDDYLRDPANGG----RPLQLSLDLTVQAASERVLLGG 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIFE 328
            K  NA+   +++++V TGEVIS+VS+PD+DP++  +    G+       FNR   G++E
Sbjct: 252 MKLMNAKGATSILMDVHTGEVISVVSLPDFDPNDRPRPPTSGFDPSTSPLFNRAVQGVYE 311

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQN-RILTIPEIFRYSSN 387
           +GS FK+FT A  +D G+   + + DT  P+++G+  I ++H +N   L++ +I   SSN
Sbjct: 312 LGSTFKIFTAAQAVDLGIVNSETIIDTSGPMRIGRFPIGEFHNKNYGKLSVADIIVNSSN 371

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGL 445
            G  ++A  +G Q  ++FL  +G+      E+ E     P  P +W  + ++TIS+GHGL
Sbjct: 372 RGTGRLALQIGAQRQQDFLRAMGMFEPTPIEIAEAAGGKPLKPRKWGELSTVTISYGHGL 431

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGG 505
           ST+P+  A   AA+ N G+ + PT +   R++  ++   ++        R++LR+ VT G
Sbjct: 432 STSPMHLAAGYAAIANGGQYVAPTIL---RQKGPQLGHRIMSPEAAGQARAMLRKVVTSG 488

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           +     VPG++VGGKTGTA K  K R  Y ++    +F A+FP  DP+Y+++  +D P +
Sbjct: 489 TASFGEVPGYQVGGKTGTADKP-KPRGGYYESKVIATFAAMFPAHDPKYVLVVTLDEPSV 547

Query: 564 ----KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               +ER   TAG    P+ G +I R A +LG++P
Sbjct: 548 IAHGEERR--TAGWTAVPVAGEMIGRVAPLLGLRP 580


>gi|310814904|ref|YP_003962868.1| Stage V sporulation protein D [Ketogulonicigenium vulgare Y25]
 gi|308753639|gb|ADO41568.1| Stage V sporulation protein D [Ketogulonicigenium vulgare Y25]
          Length = 594

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 179/545 (32%), Positives = 291/545 (53%), Gaps = 22/545 (4%)

Query: 69  HSKNRIGMTIVVC----LVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSRPDIIDRN 123
           H + R  + ++V     ++ ++++  R+    +  P EP   S         R DI+DRN
Sbjct: 40  HGRQRAELRLLVLGAAFVMGFVMVGGRMALLASTDPGEPTMSSGAGAVITSQRGDIVDRN 99

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G +LAT+I T S+YV PH++I PD    +L  + P LD   + +  +SE +F W+RR++S
Sbjct: 100 GRLLATNIETASVYVHPHQLIDPDRAASELARIFPELDEARLHQDFNSERRFMWIRRQIS 159

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
           P+Q++ +   G PG+ F   ++R YP    A+H++G     + G+   E  + + G+ R 
Sbjct: 160 PEQRQAVHDIGDPGILFGARETRLYPNGPVAAHIMGGAGFGSEGVASAE-VIGVAGVERF 218

Query: 244 FTTNKGEKNL--QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
           F     +  +  +P++L++DL +Q  V + L       NA+    +I++  TGE+I+M S
Sbjct: 219 FDARLRDPAMAAEPLQLSIDLTVQAAVEEVLYGGMTMLNAKGASGIIMDAYTGEIIAMAS 278

Query: 302 IPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +PD+DP++  +    G       FNR   G++E+GS+FK+F  A  I+ GL     + DT
Sbjct: 279 LPDFDPNDRPRVLTTGDQSDSPLFNRAVQGVYELGSVFKIFAAAQAIELGLVNQDTVLDT 338

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
           R+P+ VG+  I D+       ++  I   SSN+G+A++A  +G +  + FL  LG L   
Sbjct: 339 RSPLVVGRFRISDFDNYGPTNSVHRIIEKSSNVGSARLAMLIGPERQRNFLGSLGFLQPT 398

Query: 416 ETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
             EL E     P  P  W  + S+T S+GHG S++P+  A   A ++N G L+ PT ++ 
Sbjct: 399 ALELSEAATGVPLLPRTWGELTSITASYGHGFSSSPVHLAAGYATMVNGGHLVRPT-LLH 457

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRY 532
           + E  + V   ++   T + +R +LR  VT G+   A VPG+EVGGKTG+A K      Y
Sbjct: 458 TEEHVQGVP--IISPATSQDVREMLRAVVTSGTASFADVPGYEVGGKTGSADKPRPTGGY 515

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMD--SPKIKERNQLTAGINVAPMVGNIIRRSASML 590
            D     +F   FP  DP+Y+ +  +D  S  I    + TAG    P+   IIRR A +L
Sbjct: 516 YDDKVIATFAGAFPMNDPRYVFVITLDEASEYIAGMTRRTAGWTTVPVTAEIIRRIAPLL 575

Query: 591 GVKPV 595
           GV+P 
Sbjct: 576 GVRPA 580


>gi|329890509|ref|ZP_08268852.1| penicillin-binding protein 2 [Brevundimonas diminuta ATCC 11568]
 gi|328845810|gb|EGF95374.1| penicillin-binding protein 2 [Brevundimonas diminuta ATCC 11568]
          Length = 592

 Score =  308 bits (790), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 170/484 (35%), Positives = 261/484 (53%), Gaps = 17/484 (3%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           ++R D++DRNG++LAT+I  + LY++P +V        +L+  LP + +  + R +S E 
Sbjct: 97  LTRADLVDRNGQLLATNITHYGLYIDPREVWDIPAAKAQLRRALPRISAARLDRVMSGER 156

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +   L   L+P +++ + +  L GV F  E  R YP  S A H++G  D   +G+ G E 
Sbjct: 157 RLIALN-GLTPSERRAVHALALGGVTFEPEDRRVYPLGSSAVHLIGRSDTGGQGVAGAEL 215

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
             D +    +       ++     L++DLR+Q +V  EL    +++ A+    V+ +V T
Sbjct: 216 AFDQE----IRAAGAASEDFP---LSIDLRVQGVVENELAIAAEEHKAKGAVAVVADVQT 268

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+++M S P YD +      +E   NR+    +EMGS+FK FT+A GID+G   +  LF
Sbjct: 269 GEILAMASWPTYDANRRNAAPEEATLNRVVSAHYEMGSVFKSFTVAAGIDTGRADMNTLF 328

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D    +++GK  I D+H  N++LT+ E++ +SSNIG +++A  MG    +++  RLGLL 
Sbjct: 329 DASQALQIGKRRITDFHATNKVLTLEEVYLHSSNIGTSRLAVEMGGDVMRDYFRRLGLLD 388

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
               EL E  AP    +W      ++SFG+G+  TP+Q   A  AL+N GR +PPT    
Sbjct: 389 AAPIELKESAAPPKVRKWDDSTLASLSFGYGIMVTPIQYVSAYGALVNGGRYVPPTLRKG 448

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
            R  ++  +  V+   T   M  L+R  VT GSGR A  PG  +GGKTG+A K++  RY+
Sbjct: 449 GRPNAQ--THQVVSPETSAVMLDLMRRNVTRGSGRFADAPGLRMGGKTGSANKLVNGRYN 506

Query: 534 DTLNFNSFLAVFPTTDP----QYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
             +   SF  VFP   P    +Y V   MD P +  R   T G   AP VG I  R A  
Sbjct: 507 PAVAVGSFAGVFPADGPVDAKRYTVFVLMDEPGVYPR---TGGYVAAPAVGRIADRIAGF 563

Query: 590 LGVK 593
           LGV+
Sbjct: 564 LGVE 567


>gi|296116431|ref|ZP_06835045.1| Peptidoglycan glycosyltransferase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977024|gb|EFG83788.1| Peptidoglycan glycosyltransferase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 671

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 174/501 (34%), Positives = 272/501 (54%), Gaps = 34/501 (6%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  I+DRNG+ LA  +P   +Y  P ++I P +   KL+ VLP++D+    R+LSS  +F
Sbjct: 98  RASIVDRNGQALAISLPVAQVYANPQEMIDPQDATRKLKQVLPHIDAAETLRRLSSARQF 157

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +L R +SP ++  I + G+PG+ F   + R YP    A+ ++G VDID+ G+ G+E+F 
Sbjct: 158 VYLARDISPAEELAINNLGIPGIYFEPGERRRYPMGRVAAQIMGGVDIDDHGVAGVERFF 217

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
           D           + + N  P+ L+LD+R+QN+VH EL      + A     ++++V  GE
Sbjct: 218 D----------KRLDSNRAPLTLSLDVRVQNVVHDELQSAMDTFQAIGACAIVMDVRNGE 267

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +I+MVS+PDYD ++      +  FNR   G++E GS FK+ T AM +  G+  + D F +
Sbjct: 268 IIAMVSLPDYDANDFGHAPADARFNRAVTGMYEPGSTFKLQTTAMALQDGVAHIWDRFSS 327

Query: 356 RNPIKVGKHVIHDYHPQ--NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
             PIKVG+  I D      +  L++PE+  +SSN  AA IA   G    +++L  +G  +
Sbjct: 328 V-PIKVGRFTISDMKNDHFDPWLSLPEVMAHSSNPAAAHIALDAGAARQQDWLRNMGFFA 386

Query: 414 KLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           ++  ELPE   P  PS   W     +T++FGHG++  PL      AA  N G L+ PT +
Sbjct: 387 RVPIELPEAGHPIIPSTRNWGVSTVMTVAFGHGVAEPPLAIVRGTAATANGGFLLKPTLL 446

Query: 472 IRSRE---------------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFE 516
           +  ++               ++    R++  +N+   +R +LR  VT G+G RA   G+ 
Sbjct: 447 LHDQDRTPGGTPVPDTDMAAQTPDAQRLISAENS-SILRKILRLDVTKGTGDRAESAGYY 505

Query: 517 VGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGI 573
           VGGKTGTA+K+     Y   +N ++F  +FP   P+Y V   +DSPK   +     TAG 
Sbjct: 506 VGGKTGTAEKIGAHGGYLKHVNVSAFTGIFPMNAPRYAVYVMLDSPKPTAQTHGWTTAGW 565

Query: 574 NVAPMVGNIIRRSASMLGVKP 594
           N AP   +II R A M+G+ P
Sbjct: 566 NAAPTASHIITRIAPMMGLFP 586


>gi|241762286|ref|ZP_04760367.1| UDP-N-acetylmuramyl-tripeptide synthetase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373189|gb|EER62819.1| UDP-N-acetylmuramyl-tripeptide synthetase [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 1058

 Score =  308 bits (788), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 183/532 (34%), Positives = 285/532 (53%), Gaps = 29/532 (5%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYG---NIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATD 130
            G+  V+  +I++I    I  +G     HP P+AP         +R DI+DRNG  LA  
Sbjct: 36  CGIAAVIAKLIWLIF---ITGWGVEERRHP-PVAPLQ-------ARADIVDRNGRTLART 84

Query: 131 IPTFSLYVEP-----HKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           I  +S+ + P     + +  PD +   L  +LP   ++  R+ L S   F +LRR  SP+
Sbjct: 85  IDVWSIGIHPRTLQANHISDPDILAANLAALLPERTADEYRKILHSNRSFVFLRRHASPE 144

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
             + +   G P + F  E SR YP  +  +HV+G++  D  G +G+E   D +      T
Sbjct: 145 LVRALNMLGEPAIDFLHEPSRLYPEGNLCAHVIGWIGEDGHGQSGMEYSFDKE-----LT 199

Query: 246 TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
             K  +  +P+ L++D+R+Q  V + L    +KY+A     ++L+V TGEV++M S+P++
Sbjct: 200 DPK--RQSEPLALSIDIRVQAAVEKSLAAAMQKYSAVGASAIVLDVDTGEVLAMASLPNF 257

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRNPIKVGKH 364
           +P++        + N+ +  ++E+GS FK  T+A  I  G+ T +   +D   P+ VG+ 
Sbjct: 258 NPNDRSSSDPTAFDNKATLSVYELGSTFKPLTMATAIQDGVVTSLAKRYDATEPLAVGRF 317

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            IHD H Q R L +PE   +SSNI  A+IAD +G +  +     L    +   EL     
Sbjct: 318 HIHDEHAQKRWLDVPETLVHSSNIVTARIADELGPERMQAMFRNLNFDHRPAIELAAKGR 377

Query: 425 PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRI 484
           P +P+ W R   +T  +GHG++ TPL    A AA++N G   P T + R+ +     SR 
Sbjct: 378 PIWPAFWARTTVMTTGYGHGIAVTPLHLTSAYAAIVNGGIWRPATLLKRNPDYRPDGSRQ 437

Query: 485 VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
           ++   T  TMR LLR  VT G+GR+A V GF VGGKTGTA K  K RY+     ++F AV
Sbjct: 438 IISGQTSATMRRLLRLIVTDGTGRKANVEGFRVGGKTGTADKAEKGRYNHGARISTFAAV 497

Query: 545 FPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           FP   P+Y +++ +D+P+   +     TAG+  APMVG+II+    +LGV P
Sbjct: 498 FPMDTPRYAIVAMLDNPQGTAETGGYATAGMVTAPMVGDIIQHIGPLLGVIP 549


>gi|260752704|ref|YP_003225597.1| peptidoglycan glycosyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856339|ref|YP_162560.2| peptidoglycan glycosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|258552067|gb|ACV75013.1| Peptidoglycan glycosyltransferase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283775336|gb|AAV89449.2| Peptidoglycan glycosyltransferase [Zymomonas mobilis subsp. mobilis
           ZM4]
          Length = 571

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 181/532 (34%), Positives = 284/532 (53%), Gaps = 29/532 (5%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYG---NIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATD 130
            G+  V+  +I++I    I  +G     HP P+AP         +R DI+DRNG  LA  
Sbjct: 36  CGIAAVIAKLIWLIF---ITGWGVEERRHP-PVAPLQ-------ARADIVDRNGRTLART 84

Query: 131 IPTFSLYVEP-----HKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           I  +S+ + P     + +  PD +   L  +LP   ++  R+ L S   F +LRR  SP+
Sbjct: 85  IDVWSIGIHPRTLQANHISDPDILAANLAALLPERTADEYRKILHSNRSFVFLRRHASPE 144

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
             + +   G P + F  E SR YP  +  +HV+G++  D  G +G+E   D +       
Sbjct: 145 LVRALNMLGEPAIDFLHEPSRLYPEGNLCAHVIGWIGEDGHGQSGMEYSFDKE------- 197

Query: 246 TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
               ++  +P+ L++D+R+Q  V + L    +KY+A     ++L+V TGEV++M S+P++
Sbjct: 198 LTDPKRQSEPLALSIDIRVQAAVEKSLAAAMQKYSAVGASAIVLDVDTGEVLAMASLPNF 257

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRNPIKVGKH 364
           +P++        + N+ +  ++E+GS FK  T+A  I  G+ T +   +D   P+ VG+ 
Sbjct: 258 NPNDRSSSDPTAFDNKATLSVYELGSTFKPLTMATAIQDGVVTSLAKRYDATEPLAVGRF 317

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            IHD H Q R L +PE   +SSNI  A+IAD +G +  +     L    +   EL     
Sbjct: 318 HIHDEHAQKRWLDVPETLVHSSNIVTARIADELGPERMQAMFRNLNFDHRPAIELAAKGR 377

Query: 425 PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRI 484
           P +P+ W R   +T  +GHG++ TPL    A AA++N G   P T + R+ +     SR 
Sbjct: 378 PIWPAFWARTTVMTTGYGHGIAVTPLHLTSAYAAIVNGGIWRPATLLKRNPDYRPDGSRQ 437

Query: 485 VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
           ++   T  TMR LLR  VT G+GR+A V GF VGGKTGTA K  K RY+     ++F AV
Sbjct: 438 IISGQTSATMRRLLRLIVTDGTGRKANVEGFRVGGKTGTADKAEKGRYNHGARISTFAAV 497

Query: 545 FPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           FP   P+Y +++ +D+P+   +     TAG+  APMVG+II+    +LGV P
Sbjct: 498 FPMDTPRYAIVAMLDNPQGTAETGGYATAGMVTAPMVGDIIQHIGPLLGVIP 549


>gi|149914520|ref|ZP_01903050.1| hypothetical protein RAZWK3B_13044 [Roseobacter sp. AzwK-3b]
 gi|149811313|gb|EDM71148.1| hypothetical protein RAZWK3B_13044 [Roseobacter sp. AzwK-3b]
          Length = 594

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 175/551 (31%), Positives = 294/551 (53%), Gaps = 22/551 (3%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDI 119
           ++ R +    ++ R+ +  ++  + ++++  R+    N  P     S+   +    R DI
Sbjct: 35  EQMRDRARKRAEGRLFVLGIMFTLSFVLIGGRMGVLANSEPTEPRSSVAGAQIVAQRADI 94

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR 179
           +DR G ILAT+  T SLY +P +++ P+   ++L  + P+LD   + +  + + KF W++
Sbjct: 95  VDRQGRILATNFETHSLYAQPEQLVDPERAADELVRIFPDLDRARLVKDFTGKRKFLWIK 154

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQG 239
           RK+SP+Q++ +   G PG+ F   + R YP    ASHV+G       G+   E  + + G
Sbjct: 155 RKISPEQKQAVHDIGEPGLLFGPREMRLYPNGRLASHVLGGASFGREGVHAAE-VIGVAG 213

Query: 240 LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           + + F        ++ +P+RL+LDL +Q  + + L    K  NA+    +++ V TGE++
Sbjct: 214 IEKEFDARLRDPAQSHEPLRLSLDLSVQAAIERVLYGGMKLMNAKGATAILMEVKTGEIV 273

Query: 298 SMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
           ++ S+PD+DP++  +   EG       FNR   G++E+GS  K+FT+A  +D GL     
Sbjct: 274 AVASLPDFDPNDRPRPPTEGDPTDSPLFNRAVQGVYELGSTLKIFTVAQALDMGLVNPTT 333

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT+ P++ GKH I D+      +++ ++   SSNIG A+IA  +G +  K FL  LG 
Sbjct: 334 IIDTKGPLRWGKHRISDFRNYGNEMSVTKVIVKSSNIGTARIAQMIGGERQKAFLEDLGF 393

Query: 412 LSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
           L     E+ E     P  P  W  + ++TIS+GHG+ST+P+  A   A L N GR + PT
Sbjct: 394 LDPPPVEIVEADGAQPLLPRNWSELSTMTISYGHGISTSPMHLAAGYATLANGGRKVTPT 453

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK 529
            +      +      V+ + T +    +LR+ VT G+     VPG+ VGGKTGTA K  K
Sbjct: 454 LL---HGTTTAPGPQVISEQTARVSMDMLRKVVTEGTASFGEVPGYAVGGKTGTADKP-K 509

Query: 530 KR----YSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGNII 583
            R    Y D +   +F +VFP  DP+Y+++  +D P     +  + TAG    P+   II
Sbjct: 510 ARGGGYYEDKV-LATFASVFPAHDPEYVLVVTLDEPVETSGDEPRRTAGWTAVPVAAEII 568

Query: 584 RRSASMLGVKP 594
           RR A +LG++P
Sbjct: 569 RRVAPLLGLRP 579


>gi|84686329|ref|ZP_01014223.1| penicillin-binding protein [Maritimibacter alkaliphilus HTCC2654]
 gi|84665512|gb|EAQ11988.1| penicillin-binding protein [Rhodobacterales bacterium HTCC2654]
          Length = 596

 Score =  307 bits (787), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 183/573 (31%), Positives = 294/573 (51%), Gaps = 28/573 (4%)

Query: 42  GHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP- 100
            H         E+ Q   ++ R +    ++ R+ +   +    ++ + +R+    +  P 
Sbjct: 17  AHGGDPDAIERENKQRRHEEMRDRARLRAEGRLLVLAAMFFCAFVTVGVRMGMLSSSVPS 76

Query: 101 EP--IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
           EP   AP   I +   +R DI+DR G ++AT+  T +LY EP  ++ P     +L  + P
Sbjct: 77  EPRAYAPGAQISQ---TRADIVDRQGRLMATNFVTHALYAEPPNMVEPAHAAAELARIFP 133

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
           +L+ + +    +   KF W++ ++SP+Q++ +   G PG+ F   + R YP    A+HV+
Sbjct: 134 DLEEDKLLALFTGPRKFLWIKPQISPEQKQAVHDIGEPGLLFGPREMRLYPNGPVAAHVM 193

Query: 219 GYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE--KNLQPIRLALDLRIQNIVHQELVENK 276
           G      + +   E  + + G+   F     +  +  +P+ L LDL IQ  V + L    
Sbjct: 194 GGARYGEQAVQAAE-LIGVAGIESAFNDRLSDPARAGEPLMLTLDLTIQAAVERVLAGGM 252

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHE-------AFKGKKEGWFNRISYGIFEM 329
              NA+    ++++  TGE+IS+ S+PD+DP++        F   +   FNR   G++E+
Sbjct: 253 TVMNAKGAAAILMDAHTGEIISLASLPDFDPNDRPSPLTTGFDPSESPLFNRAVQGVYEL 312

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS FK+F  A  ++ GL     + +TR PI+ GKH I+D+H     LT+ ++   SSNIG
Sbjct: 313 GSTFKIFAAAQALEMGLVNPNTMINTRGPIRWGKHRINDFHDYGAELTVSDVIVRSSNIG 372

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLST 447
            A++A  +G    +EFL RLG       +L E     P  PS W  + ++TIS+GHGLS 
Sbjct: 373 TARLAQQIGAANQREFLDRLGFTKPTAIQLTEASGSQPLLPSNWSELSTMTISYGHGLSA 432

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSG 507
           +PL  A A A+L+N G  + PT +   R         V+ + T    R +LR+ V    G
Sbjct: 433 SPLHLATAYASLLNGGTRVTPTLV---RTGPVAPGPRVVSERTSAVARDMLRQVVASDHG 489

Query: 508 RRAF--VPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
             +F  V G++VGGKTGTA K  K R  Y D     +F +VFPT DP+YI++  +D P +
Sbjct: 490 TASFAEVAGYQVGGKTGTADKP-KPRGGYYDDKVIATFASVFPTNDPKYILIVTLDEPVV 548

Query: 564 KERNQL--TAGINVAPMVGNIIRRSASMLGVKP 594
              N+   TAG    P+   IIRR A +LG+KP
Sbjct: 549 TILNEARRTAGFTAVPVAAEIIRRVAPLLGLKP 581


>gi|126735373|ref|ZP_01751119.1| Cell division protein FtsI/penicillin-binding protein 2
           [Roseobacter sp. CCS2]
 gi|126715928|gb|EBA12793.1| Cell division protein FtsI/penicillin-binding protein 2
           [Roseobacter sp. CCS2]
          Length = 594

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 185/559 (33%), Positives = 295/559 (52%), Gaps = 33/559 (5%)

Query: 60  QKRRRKVIAHSKNR--IGMTIVVCLVIYIILAIRIIQYG----NIHPEPIAPSMNIDEYG 113
           + RR + +A  + +   G  +V+ L  +    +  ++ G    ++  EP A ++     G
Sbjct: 30  RARRHEAMADKQRQRAEGRLLVLGLAFFCAFGLIGLRMGALAADVREEPQASAIGNPIIG 89

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
             R DI+DRNG ILAT++ T SLY  P  +I P  + ++L ++ P LD   +      + 
Sbjct: 90  -QRSDIVDRNGRILATNLQTHSLYAHPRDMIDPAHVAKELAMIFPELDEAELLEDFEGDR 148

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F W+RR++SP+Q + +   G PG+ F   + R YP    A+HV+G       G+   E 
Sbjct: 149 RFLWVRRQISPEQMQAVHDIGSPGLLFGPREMRLYPNGPIAAHVLGGASYGREGVASAE- 207

Query: 234 FLDMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
            + + G+ R F        N+G     P+ L+LDL +Q    Q L       NA+   +V
Sbjct: 208 VIGVAGVERQFDAYLRDPANEG----APLALSLDLTVQAAAEQVLAGGMSIMNAKGATSV 263

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMG 341
           ++++ TGEVISMVS+PD+DP+   + +  G       FNR   G++E+GS+FK+FT A  
Sbjct: 264 LMDIHTGEVISMVSLPDFDPNNRPRVQTTGDQSDSPLFNRAVQGVYELGSVFKIFTTAQA 323

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           ++ GL     + DT+ P+  G+  I D+      L+  ++   SSNIG A+IA  +G + 
Sbjct: 324 MELGLVNPNTMIDTQGPLTWGRFRIRDFRDYGPELSTTDVIVKSSNIGTARIAMQIGGER 383

Query: 402 HKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
            + FL  LG L     E+ E     P  P  W  I ++TIS+GHGLS++P+  A   A+L
Sbjct: 384 QRAFLASLGFLEPTPLEMVEAPTGRPLLPPNWSEISTMTISYGHGLSSSPVHLAAGYASL 443

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
           +N G  + PT +   R+  E   RIV +  + ++ R +LR+ V  G+     VPG+EVGG
Sbjct: 444 LNGGTKVEPTLL--RRDAVEVGPRIVSEAVSARS-RQMLRQVVVRGTASFGEVPGYEVGG 500

Query: 520 KTGTAQK--VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINV 575
           KTGTA K       Y +    ++F  VFP  DPQY+++  +D P     ++   TAG   
Sbjct: 501 KTGTADKPRAAGGGYYEDKVISTFATVFPANDPQYVLIVTLDEPSENSGDEPRRTAGWTA 560

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   +IRR+A +LG++P
Sbjct: 561 VPVAAEMIRRTAPLLGLRP 579


>gi|5834376|gb|AAD53942.1|AF179611_26 penicillin-binding protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 544

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 183/532 (34%), Positives = 285/532 (53%), Gaps = 29/532 (5%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYG---NIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATD 130
            G+  V+  +I++I    I  +G     HP P+AP         +R DI+DRNG  LA  
Sbjct: 9   CGIAAVIAKLIWLIF---ITGWGVEERRHP-PVAPLQ-------ARADIVDRNGRTLART 57

Query: 131 IPTFSLYVEP-----HKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           I  +S+ + P     + +  PD +   L  +LP   ++  R+ L S   F +LRR  SP+
Sbjct: 58  IDVWSIGIHPRTLQANHISDPDILAANLAALLPERTADEYRKILHSNRSFVFLRRHASPE 117

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
             + +   G P + F  E SR YP  +  +HV+G++  D  G +G+E   D +      T
Sbjct: 118 LVRALNMLGEPAIDFLHEPSRLYPEGNLCAHVIGWIGEDGHGQSGMEYSFDKE-----LT 172

Query: 246 TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
             K  +  +P+ L++D+R+Q  V + L    +KY+A     ++L+V TGEV++M S+P++
Sbjct: 173 DPK--RQSEPLALSIDIRVQAAVEKSLAAAMQKYSAVGASAIVLDVDTGEVLAMASLPNF 230

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRNPIKVGKH 364
           +P++        + N+ +  ++E+GS FK  T+A  I  G+ T +   +D   P+ VG+ 
Sbjct: 231 NPNDRSSSDPTAFDNKATVSVYELGSTFKPLTMATAIQDGVVTSLAKRYDATEPLAVGRF 290

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            IHD H Q R L +PE   +SSNI  A+IAD +G +  +     L    +   EL     
Sbjct: 291 HIHDEHAQKRWLDVPETLVHSSNIVTARIADELGPERMQAMFRNLNFDHRPAIELAAKGR 350

Query: 425 PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRI 484
           P +P+ W R   +T  +GHG++ TPL    A AA++N G   P T + R+ +     SR 
Sbjct: 351 PIWPAFWARTTVMTTGYGHGIAVTPLHLTSAYAAIVNGGIWRPATLLKRNPDYRPDGSRQ 410

Query: 485 VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
           ++   T  TMR LLR  VT G+GR+A V GF VGGKTGTA K  K RY+     ++F AV
Sbjct: 411 IISGQTSATMRGLLRLIVTDGTGRKANVEGFRVGGKTGTADKAEKGRYNHGARISTFAAV 470

Query: 545 FPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           FP   P+Y +++ +D+P+   +     TAG+  APMVG+II+    +LGV P
Sbjct: 471 FPMDTPRYAIVAMLDNPQGTAETGGYATAGMVTAPMVGDIIQHIGPLLGVIP 522


>gi|326388912|ref|ZP_08210494.1| peptidoglycan glycosyltransferase [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206512|gb|EGD57347.1| peptidoglycan glycosyltransferase [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 584

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 191/565 (33%), Positives = 301/565 (53%), Gaps = 25/565 (4%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILA-IRIIQYGNIHPEP 102
           N   K   +  G+      R++ +A ++ R+ + +V+  V + + A +RI Q G +   P
Sbjct: 10  NGTAKATAITSGRLHLANLRQRSLATARTRL-LWVVIGFVFFTLTAFVRIAQLGIVQQAP 68

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHK--------VISPDEIIEKLQ 154
               +  +     R +I+DRNG  LA   P +SL+  P          V +P+E+   L 
Sbjct: 69  EHGPLG-EALVPPRAEILDRNGVPLARAFPAYSLWFNPKALGENGSPLVKTPEEVARALS 127

Query: 155 IVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHA 214
            + P+LD   +  KL +  K  +LRR++ P++  ++ + G P + F  E  RFYP  S A
Sbjct: 128 QIFPDLDYADVLGKLKT-GKGTYLRRRVLPEEANKVFALGEPALEFPRETQRFYPQGSLA 186

Query: 215 SHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVE 274
           +HV+GYVD D  G  G+E+ LD +       T+   +  +P+ L++D R Q  +  EL  
Sbjct: 187 AHVLGYVDADGHGKLGMEEVLDQR------LTDPAHRA-EPVTLSIDSRAQGALEDELSR 239

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
              + +A+    +IL+V TGE+ISM S+P +DP+     +    FNR S  ++E+GS FK
Sbjct: 240 GMLETHAKGAAGIILDVDTGELISMASLPSFDPNRGDLARNALVFNRASNEVYELGSAFK 299

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
             TIA  ID+G+ T   +  +  P+K+    IHD H     L +PE   +SSNI  AQ+A
Sbjct: 300 PITIASAIDAGVVTDLAVRYSAAPLKIDGFTIHDSHNFGASLNVPEALIHSSNIVTAQVA 359

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTA 453
           D +G    ++ +  LG+ ++   ELP    P +P   W R+ ++T+S+GHG++ TPL  A
Sbjct: 360 DKLGGARLRQTMLALGMNARPTVELPARGFPIWPKGDWPRLRTMTVSYGHGIAVTPLHLA 419

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A AAL+N G +  P+ + +         R V + +T   +R LLR  V  G+GR+A  P
Sbjct: 420 AAYAALVNGG-IWRPSTLYKVDPAHVPAGRRVFQASTSARIRQLLRLIVVDGTGRKADAP 478

Query: 514 GFEVGGKTGTAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQL 569
           GF VGGKTG+A+K   +   Y  T    +F A FP   P+Y+V++ +D P+  +    Q 
Sbjct: 479 GFRVGGKTGSAEKAGGRGAGYKKTSLIATFAAAFPMDRPRYVVIAMLDEPQATVATSGQR 538

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
           TA  N AP+VG ++ R   MLGV P
Sbjct: 539 TAAWNAAPIVGRVVGRVGPMLGVVP 563


>gi|326402229|ref|YP_004282310.1| peptidoglycan synthase FtsI [Acidiphilium multivorum AIU301]
 gi|325049090|dbj|BAJ79428.1| peptidoglycan synthase FtsI [Acidiphilium multivorum AIU301]
          Length = 696

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 185/553 (33%), Positives = 294/553 (53%), Gaps = 32/553 (5%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-----HPEPIA---PSMNIDEYGM 114
           RR  I    +R+       ++IY++LA R++    +         IA   PS  +     
Sbjct: 49  RRAAIGVLHSRLAAGFAGFVLIYLLLAARVVYVTVVHPVPPDKAAIAAQTPSTTVVLPPP 108

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R +I DRNGEILA  +P  +LY  P +V  P     ++  V+P LD   +  +L+  ++
Sbjct: 109 ARAEITDRNGEILAVSLPAAALYANPKQVEDPGVAAREIAAVIPGLDPGFLEARLADRSR 168

Query: 175 -FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F +L RKL+  Q+  +   G+PGV F   + R YP  + A+H++G V  D RGI G+E 
Sbjct: 169 DFVYLDRKLTASQELAVNRLGIPGVYFENTERRHYPEGNLAAHILGGVTPDQRGIAGVED 228

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           + + +      T+  G    +P+RL++D+  + IV Q + +    Y+A+    ++++  T
Sbjct: 229 WFNKR-----LTSAPG----KPLRLSIDIGAEGIVRQAIWQAMSDYDAKGACGIVISART 279

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           G V++M S+PDY+  +      +  FNR   G +E GS+FK+ T++M I+SG+    D F
Sbjct: 280 GRVLAMASVPDYNADDLGSAPADARFNRCVSGDYEPGSVFKLQTLSMAINSGMIQPWDRF 339

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           +T +P+ VG+  + D+ P +  + +P I   SSNIGA++IA  +G Q  + +L +LG   
Sbjct: 340 NTTHPLHVGRFTVTDFEPAHIWMAVPHILAVSSNIGASRIATILGPQIQRAWLRKLGFFR 399

Query: 414 KLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           +   +LPE   P Y   S WK + ++T+SFG+G++ +PLQ   A   ++N G   PPT +
Sbjct: 400 RPPIQLPEATPPMYHPKSSWKLLTTMTVSFGNGIAMSPLQLISAVVPVVNGGIWYPPTLL 459

Query: 472 IRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFEVGGKTGTAQKV-I 528
              +  +      V+ + T   MR ++R  VT   G+G  A VPG+ VGGKTGTAQ V  
Sbjct: 460 DHGKRSA---GVRVMSERTSLIMRKMMRNVVTAPDGTGVYARVPGYLVGGKTGTAQVVGP 516

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER------NQLTAGINVAPMVGNI 582
             RY   LN  SF+A FP  DP+Y+V   +  P   ++         T G   AP V  I
Sbjct: 517 NGRYLQHLNNASFMAAFPMNDPRYVVYVVVLQPHATKQMLPFCHGFTTGGYVAAPAVAQI 576

Query: 583 IRRSASMLGVKPV 595
           I R   MLG+ P+
Sbjct: 577 ISRIGPMLGIMPL 589


>gi|296284504|ref|ZP_06862502.1| penicillin-binding protein [Citromicrobium bathyomarinum JL354]
          Length = 584

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 190/538 (35%), Positives = 290/538 (53%), Gaps = 40/538 (7%)

Query: 83  VIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHK 142
           ++ ++  +RI  +G +   P  P    +     R +I DRNG  LA +   F+L+  P  
Sbjct: 41  LVAVVALMRIATFGVLG-APDTPLSMEERLLPPRGEITDRNGLPLARNYDAFALWYNPTA 99

Query: 143 --------VISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFG 194
                   V  P+E+  KL  + P LD   +  +L+S  + Q+LRR+L P++  R+   G
Sbjct: 100 MKDGGSPLVHRPEEVAAKLAAIFPELDEADVAARLAS-GRAQYLRRRLLPEEANRVFDLG 158

Query: 195 LPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQ 254
            P +    EK RFYP  S A+HV+GYV  D  G  G+E  L+ + LT   ++ +GE    
Sbjct: 159 EPALELPAEKDRFYPQGSMAAHVLGYVK-DGEGHLGMESVLNDR-LTD--SSLRGE---- 210

Query: 255 PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH------ 308
           P  +ALDLR+Q  +  EL +     NA     V+L+V TGEVI+M S+P +DP+      
Sbjct: 211 PTAIALDLRVQGALEDELNKGMLSVNARGAAGVVLDVDTGEVIAMASLPAFDPNDIKTSD 270

Query: 309 ------EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL---FDTRNPI 359
                 EA  G+    FN ++  ++E+GS FK  T+A  ID+G+  V+DL   +D + P+
Sbjct: 271 LMISDAEAKLGRTPRVFNSVTNQVYELGSTFKPLTVAAAIDAGI--VRDLSLRYDAK-PV 327

Query: 360 KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETEL 419
           KV    + D H     L +PE   +SSN   A++AD +G +  ++ +  LGL  +   EL
Sbjct: 328 KVAGRTLADSHNLGDTLNVPEALIHSSNTVTARVADKLGPERLRDTMRALGLAERPYIEL 387

Query: 420 PEIQAPSYPSQ-WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           P   AP +P + W R+ ++T+++GHG++ TPL  A A AA++N G   P T + +     
Sbjct: 388 PARGAPLWPGEKWSRVTTMTVAYGHGIAVTPLHLASAYAAMVNGGVWRPAT-LYKVEPGQ 446

Query: 479 EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNF 538
           E   R V K++T   MR LLR     G+G+ A  PG+ VGGKTG+A+K     Y   L  
Sbjct: 447 EAAGRRVFKEDTSARMRQLLRMIAVYGTGQSADAPGYRVGGKTGSAEKPSAGGYRKKLLV 506

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPKIKERN--QLTAGINVAPMVGNIIRRSASMLGVKP 594
           ++F A FP  +P+Y+V++ +D PK    +  Q TA  N AP+VG +I R   ML V+P
Sbjct: 507 STFAAAFPMDNPRYVVVAMLDEPKGTTASSFQRTAAWNAAPIVGKLIPRIGPMLDVRP 564


>gi|58038637|ref|YP_190601.1| transpeptidase FtsI [Gluconobacter oxydans 621H]
 gi|58001051|gb|AAW59945.1| Transpeptidase FtsI [Gluconobacter oxydans 621H]
          Length = 661

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 179/513 (34%), Positives = 270/513 (52%), Gaps = 47/513 (9%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           + R  I DR G+ LA  +P   +Y  P ++I P +  +KL+ VLP LD +   R+LS + 
Sbjct: 104 VKRATITDRTGQALALSLPVAQVYANPMELIDPADAADKLRKVLPQLDRDETIRRLSLKK 163

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L R +SP Q+  I + G+PG+ F   + R YP    A+ ++G VDID+ GI G+E+
Sbjct: 164 QFVYLARDISPVQEIAINNLGIPGIYFEAGERRHYPLGRTAAQIMGSVDIDDHGIAGVER 223

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           + D           +   +  P+RL+LD+R+Q + H EL   K +++A     ++++V T
Sbjct: 224 YFD----------KRLNSDRTPLRLSLDVRVQTVAHDELQAAKDEFSAIGASAIVMDVRT 273

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+++MVS+PDYD ++      +  FNR   G++E GS FK+ T AMG+  G+  + D F
Sbjct: 274 GEILAMVSLPDYDANDFGHAPNDARFNRAVTGMYEPGSTFKLQTAAMGLQLGIVHLWDRF 333

Query: 354 DTRNPIKVGKHVIHDYHPQN--RILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
            T  PIKVG+  I D    +    L++P +  YSSN  AA IA  +G    +++L  +G 
Sbjct: 334 ST-IPIKVGRFTIRDMKTDHFAPWLSLPGVLAYSSNPAAAHIALDVGATRQQDWLRNMGF 392

Query: 412 LSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
            +++  ELPE   P  P+   W     +T+ FGHG++  PL      AA +N G L+ PT
Sbjct: 393 FNRVPVELPEAGRPLVPASRNWGISTVMTVGFGHGVAEPPLAIVRGTAATVNGGILLKPT 452

Query: 470 FMIRSREESEK-----------------------------VSRIVLKKNTVKTMRSLLRE 500
            + R  E+  K                             V   VL + T   +R LLR 
Sbjct: 453 LVARDTEDDSKSAPDADAAQVRPVAYRPGTDTDEIGAETPVGTRVLSEQTSALLRKLLRL 512

Query: 501 GVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
            VT GSG+ A VPG+ VGGKTGTA+K+     Y   +N ++F +VFP  +P Y V   +D
Sbjct: 513 DVTMGSGKSAEVPGYYVGGKTGTAEKIGAHGGYLKHVNVSAFTSVFPMNNPHYAVYVMLD 572

Query: 560 SPK--IKERNQLTAGINVAPMVGNIIRRSASML 590
           SP+  +      TA  N AP V  II R   +L
Sbjct: 573 SPQGTVATHGWTTAAWNAAPTVKKIISRVGPIL 605


>gi|255261408|ref|ZP_05340750.1| peptidoglycan glycosyltransferase [Thalassiobium sp. R2A62]
 gi|255103743|gb|EET46417.1| peptidoglycan glycosyltransferase [Thalassiobium sp. R2A62]
          Length = 594

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 172/502 (34%), Positives = 280/502 (55%), Gaps = 34/502 (6%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI+DRNG ILAT++ T+S+Y +P  +I P+    +L  + P+L +E +    +   KF
Sbjct: 91  RSDIVDRNGRILATNLDTYSVYAQPPHMIDPENAATQLAAIFPDLKAEKLLEDFTGSRKF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R++SP+Q + +   G PG+ F   + R YP  + ASH++G       G+   E  +
Sbjct: 151 LWIKRQISPEQMQAVHDIGDPGLLFGPREMRLYPNGAVASHILGGASFGREGVDSAE-VI 209

Query: 236 DMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            + G+ + F        N+G     P+ L++DL +Q    + L       NA+   +V++
Sbjct: 210 GVAGVEKNFDDFLRDPANEG----APLELSIDLTVQATAERVLAGGMSLMNAKGAASVLM 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGID 343
           +V TGE+ISMVS+PD+DP+E  +   EG       FNR   G++E+GS FK+FT A  I+
Sbjct: 266 DVHTGEIISMVSLPDFDPNERPQVLTEGDQSDSPLFNRAVQGVYELGSTFKIFTAAQAIE 325

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
             L       DT  P+  G H I D+      L++ ++   SSNIG A++A  +G    +
Sbjct: 326 LRLVNADTSIDTSGPLVWGHHKIRDFRDYGPSLSVTDLIVKSSNIGTARVAMMIGAARQR 385

Query: 404 EFLYRLGLLSKLETELPEIQAPS----YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
            FL +LG+ +    E+  ++APS     P++W  I ++TIS+GHG+ST+P+  A   A+L
Sbjct: 386 AFLDQLGMTTATPVEM--VEAPSGRPLLPARWTEISTMTISYGHGISTSPVHLAAGYASL 443

Query: 460 INEGRLIPPTFMIR-SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVG 518
           +N G  + PT + R +R+  E+    ++ + T    R++LR+ V  G+     VPG+ VG
Sbjct: 444 LNGGTRVEPTLLRRDTRQRGER----IVSEQTSALARNMLRQVVVRGTASFGEVPGYAVG 499

Query: 519 GKTGTAQKVIKKR---YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGI 573
           GKTGTA K  K+R   Y D     +F +VFP  DP+Y+++  +D P+     + + TAG 
Sbjct: 500 GKTGTADKP-KERGGGYYDDKVIATFASVFPAHDPKYVLIVTLDEPEETSGSKPRRTAGW 558

Query: 574 NVAPMVGNIIRRSASMLGVKPV 595
              P+   +IRR+A +LG++P 
Sbjct: 559 TAVPIAAEMIRRTAPLLGLRPT 580


>gi|83949457|ref|ZP_00958190.1| penicillin-binding protein [Roseovarius nubinhibens ISM]
 gi|83837356|gb|EAP76652.1| penicillin-binding protein [Roseovarius nubinhibens ISM]
          Length = 593

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 270/498 (54%), Gaps = 29/498 (5%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI+DR G ILAT+  T SLY +P ++I P+  + +L  + P+LD + + R  + + KF
Sbjct: 91  RADIVDRKGRILATNFDTHSLYAQPQQMIEPERAVRELVKIFPDLDQDRLMRDFTGKRKF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------G 227
            W+++K+SP+Q++ +   G PG+ F   + R YP    A+HV+G               G
Sbjct: 151 LWIKKKISPEQRQAVHDIGEPGLLFGPREMRLYPNGKLAAHVLGGASFGREGVHAAEVIG 210

Query: 228 ITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           + GIE+F D     R+    +G    +P++L++DL IQ+ + Q L    +  NA+    V
Sbjct: 211 VAGIERFYD----DRLRDPAQGH---EPLKLSIDLTIQSAIEQVLHGGMRLMNAKGAAAV 263

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMG 341
           +++V TGEVIS+ S+PD+DP++  +    G       FNR   G++E+GS FK+FT+A  
Sbjct: 264 LMDVHTGEVISIASLPDFDPNDRPRPAVSGDASDSPLFNRAVQGVYELGSTFKIFTVAQA 323

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +D GL   + + DT+ P++     I D+      L+   +   SSNIG A+IA  +G   
Sbjct: 324 MDLGLINPETMIDTKGPLRQDGFSIRDFRNYGSSLSATTVIVKSSNIGTARIAQMIGASR 383

Query: 402 HKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
            +EFL  LG       E+ E     P  P++W  + ++TIS+GHGLS++PL  A   AA+
Sbjct: 384 QQEFLKSLGFFEPTPFEIIEAAGGKPLLPARWNELSTMTISYGHGLSSSPLHLAAGYAAI 443

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
            N G  + PT + + R E       V+ + + +  R +LR+ V+ G+     VPG+ VGG
Sbjct: 444 ANGGTYVKPTLLHKPRVEP---GHRVMSEKSARAARDMLRKVVSEGTASMGEVPGYAVGG 500

Query: 520 KTGTAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVA 576
           KTGTA K      Y D     +F  +FP  DP+Y+++  +D P     +  + TAG    
Sbjct: 501 KTGTADKPKPTGGYYDDKVIATFATIFPAHDPKYVLVVTLDEPVETSGKEPRRTAGWTAV 560

Query: 577 PMVGNIIRRSASMLGVKP 594
           P+   II R A +LG++P
Sbjct: 561 PVAAEIIGRVAPLLGLRP 578


>gi|16126798|ref|NP_421362.1| penicillin-binding protein B [Caulobacter crescentus CB15]
 gi|221235579|ref|YP_002518016.1| division specific D,D-transpeptidase/cell division protein FtsI
           [Caulobacter crescentus NA1000]
 gi|6318316|gb|AAF06836.1|AF099190_4 penicillin binding protein B [Caulobacter crescentus CB15]
 gi|13424126|gb|AAK24530.1| penicillin-binding protein B [Caulobacter crescentus CB15]
 gi|220964752|gb|ACL96108.1| division specific D,D-transpeptidase/cell division protein ftsI
           [Caulobacter crescentus NA1000]
          Length = 589

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 176/492 (35%), Positives = 269/492 (54%), Gaps = 23/492 (4%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R D++DRNG++LA D+  ++LYV+P +V    E    L   LP + ++ + + +  + +
Sbjct: 87  ARGDVVDRNGKLLAVDLAHYALYVDPREVWDAKETRAALGRALPQVPAKRLDKAVFGDHR 146

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
             ++   L+P ++  I + GLPGV F  ++ R YP    A+H++G+VD   +G+ G E+ 
Sbjct: 147 -AFVLGGLTPDEKDAIFNLGLPGVTFEEQERRMYPLGPTAAHLIGFVDSGGKGLAGAERA 205

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
           LD      +     GE    P +L++D+R+Q  +  EL +  +++  +    ++ NV TG
Sbjct: 206 LD----DPIRKAAGGEGG--PAQLSIDVRVQAALEDELRKAAEEFTPKGAVGLVTNVHTG 259

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           E++ M S PDYD ++A     +   NR +  ++EMGS FK FT+A+G+D+G+ T    FD
Sbjct: 260 EILGMASWPDYDANKAGGATDDQRLNRAAASVYEMGSTFKAFTVAIGLDTGVATAASTFD 319

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
            R P K+G   IHDYH    +L + E+F++SSNIG A +A+ +G Q   ++   LGL   
Sbjct: 320 AREPYKLGYRTIHDYHATKAVLNLVEVFQHSSNIGTAMLAERVGGQRLSQYFTNLGLTKP 379

Query: 415 LETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            + EL E   P  P +W +    + SFGHG++ +PL  A A  AL+N G + P T  IR 
Sbjct: 380 AKVELQESARPLTPRKWDQDTVASTSFGHGMNISPLALAQAMNALLNGGEMRPLT--IRK 437

Query: 475 REESEK-VSRIVLKKNTVKTMRSLLREGVT---GGSGRRAFVPGFEVGGKTGTAQKVIK- 529
                +   R VL ++T   M  ++R  V    GGSG +A VPG  VGGKTGT +K    
Sbjct: 438 LPPGVRPEGRRVLSEHTSAEMLKIMRANVVPGEGGSGGKADVPGLSVGGKTGTGEKYDPA 497

Query: 530 -KRYSDTLNFNSFLAVFPTTDP----QYIVLSFMDSPKIKERNQL---TAGINVAPMVGN 581
            +RY+     +SF A FPT  P    +Y VL  +D PK    N     T G   AP  G 
Sbjct: 498 IRRYNHQRQVSSFAATFPTDGPLEADRYFVLILLDEPK-GNANSFGFSTGGWVAAPAAGR 556

Query: 582 IIRRSASMLGVK 593
           +I R A  LGVK
Sbjct: 557 VIERIAPFLGVK 568


>gi|83858920|ref|ZP_00952442.1| penicillin-binding protein [Oceanicaulis alexandrii HTCC2633]
 gi|83853743|gb|EAP91595.1| penicillin-binding protein [Oceanicaulis alexandrii HTCC2633]
          Length = 612

 Score =  303 bits (777), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 192/564 (34%), Positives = 296/564 (52%), Gaps = 28/564 (4%)

Query: 39  MESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI 98
           +ES      +   +E+  +   +RR ++     + IG+ + V  VI    A++I  +G +
Sbjct: 26  VESAPARAMQRVRIENRANKAGRRRSRL-----SVIGLVLSVGFVISAGRAVQIAAFGAL 80

Query: 99  HPEPIAPSMNIDEYG-MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVL 157
             +     M + E   + R  I+DR+GEILA  +   S+Y +P  V   +E+ ++L  VL
Sbjct: 81  AND--EEEMVVAETAPVRRASILDRDGEILAATLDFHSVYADPLYVWDAEEVAQQLATVL 138

Query: 158 PNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHV 217
           P+LD E + R+LSS +++  +   LSP+ ++ I   GLPG+ F +E  R YP    A+H+
Sbjct: 139 PDLDVERLTRRLSSNSRYVPIADGLSPRMRQAIHLLGLPGIYFEVEPGRIYPKQRVAAHL 198

Query: 218 VGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKK 277
           VGYVD   +G+ G E         R F     E   +P+ L++DL  Q  V   L E   
Sbjct: 199 VGYVDGQMQGVAGAE---------RAFEAELAEGG-RPVSLSIDLTAQYRVESVLRERMA 248

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG-----WFNRISYGIFEMGSI 332
            + A     V++ V TGE+I+M S+PDYDP+   +    G      FN+   G++E+GS+
Sbjct: 249 AHQAAGASAVLMRVGTGEIIAMASLPDYDPNRFAEATAPGSDIDPLFNQPVQGVYELGSV 308

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           FK   +A G+++G   + D++D  +P+++G H I DY  +NR LT  E+  YSSNI A++
Sbjct: 309 FKPLALAAGLEAGSVHMDDVYDASSPVRIGGHTIGDYRGENRPLTAREMVLYSSNIAASR 368

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQT 452
           +AD +G      F   L L      EL E   P+ P +W RI ++T S+GHG   +PL  
Sbjct: 369 MADVIGADDLTGFYSDLRLFEAPPIELMEAAGPNLPRRWGRIQTMTASYGHGFQVSPLAL 428

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRI-VLKKNTVKTMRSLLREGVTGGSGRRAF 511
           A A AAL N G   PPT  +R     E V+ + V+  +    +  ++RE V       A 
Sbjct: 429 AAAYAALANGGVYTPPT--LRPVAPGETVAGVPVMSPSVAAQVLGVMREYVARSQTGSAD 486

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--L 569
           V G  V GKTGTA++V+  +Y +   FN+F+A+FP  DPQY++   MD P+         
Sbjct: 487 VEGLAVAGKTGTAERVVGGQYMERNTFNTFVAIFPFDDPQYVLTVSMDRPQPTPETHGFS 546

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
           TAG    P  G IIR  A +L + 
Sbjct: 547 TAGWTSMPAAGEIIRSLAGVLDID 570


>gi|167647635|ref|YP_001685298.1| peptidoglycan glycosyltransferase [Caulobacter sp. K31]
 gi|167350065|gb|ABZ72800.1| Peptidoglycan glycosyltransferase [Caulobacter sp. K31]
          Length = 584

 Score =  302 bits (774), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 175/487 (35%), Positives = 263/487 (54%), Gaps = 15/487 (3%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R D++DRNG++LA D+  ++LY++P  V         L   LP + ++ + + + S+ +
Sbjct: 85  ARGDLVDRNGQLLAVDLTHYALYIDPKDVWDAKATRLALGKALPEVPAKRLDQAVFSDRR 144

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
             ++   ++P +++ I   GLPGV F  +  R YP  + A+H +G+VD   RG++G EK 
Sbjct: 145 -SFVVGGMTPAEKQAIFDLGLPGVQFEEQARRVYPLGASAAHFIGFVDKGGRGLSGAEKA 203

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
           LD           KG     P  L++DLRIQ  +  E+ +   ++ A+    ++ NV TG
Sbjct: 204 LDKPVRD---AAAKGPDGAIP--LSIDLRIQAALEDEVRKTAIEFQAKDAVGIVTNVHTG 258

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           E++ MVS PDYDP+   +   E   N  +  ++EMGS FK FT+A+G+D+G  T    FD
Sbjct: 259 EILGMVSYPDYDPNRLDQASSEQMTNHAAASVYEMGSTFKAFTVAIGLDTGAATPASTFD 318

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
            R P K+G   IHD+H   +ILT+ E+F++SSNIG A +A+ +G +    +   LGL   
Sbjct: 319 AREPFKLGYRTIHDFHAARKILTLVEVFQHSSNIGTAMLAERIGGERLSHYFAALGLTKP 378

Query: 415 LETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            + EL E   P  P +W      + SFGHG++ +PL  A A  AL+N G L P T    +
Sbjct: 379 AKVELLESARPLTPKKWDDDSVASTSFGHGINVSPLALAQAMGALLNGGTLQPLTIRKMA 438

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK--KRY 532
                +  R V  + T + M  ++R  VTGGSG+ A +PG  VGGKTGT +K     + Y
Sbjct: 439 PGVRPEGPRAV-SEETSQQMLQIMRANVTGGSGKSANIPGLTVGGKTGTGEKYDPAIRGY 497

Query: 533 SDTLNFNSFLAVFPTTDP----QYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRS 586
           +     +SF AVFPT       +Y VL  +D PK   K     T G   AP  G +I R 
Sbjct: 498 NHQRQVSSFAAVFPTEGAIEADRYFVLVLLDEPKGNAKTSGFSTGGWVAAPAAGRVIDRI 557

Query: 587 ASMLGVK 593
           A  LGV+
Sbjct: 558 APFLGVR 564


>gi|148259078|ref|YP_001233205.1| peptidoglycan glycosyltransferase [Acidiphilium cryptum JF-5]
 gi|146400759|gb|ABQ29286.1| Peptidoglycan glycosyltransferase [Acidiphilium cryptum JF-5]
          Length = 696

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 184/553 (33%), Positives = 293/553 (52%), Gaps = 32/553 (5%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-----HPEPIA---PSMNIDEYGM 114
           RR  I    +R+       ++IY++LA R++    +         IA   PS  +     
Sbjct: 49  RRAAIGVLHSRLAAGFAGFVLIYLLLAARVVYVTVVHPVPPDKAAIAAQTPSTTVVLPPP 108

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R +I DRNGEILA  +P  +LY  P +V  P     ++  V+P LD   +  +L+  ++
Sbjct: 109 ARAEITDRNGEILAVSLPAAALYANPKQVEDPGVAAREIAAVIPGLDPGFLEARLADRSR 168

Query: 175 -FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F +L RKL+  Q+  +   G+PGV F   + R YP  + A+H++G V  D RGI G+E 
Sbjct: 169 DFVYLDRKLTASQELAVNRLGIPGVYFENTERRHYPEGNLAAHILGGVTPDQRGIAGVED 228

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           + + +      T+  G    +P+RL++D+  + IV Q + +    Y+A+    ++++  T
Sbjct: 229 WFNKR-----LTSAPG----KPLRLSIDIGAEGIVRQAIWQAMSDYDAKGACGIVISART 279

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           G V++M S+PDY+  +      +  FNR   G +E GS+FK+ T++M I+S +    D F
Sbjct: 280 GRVLAMASVPDYNADDLGSAPADARFNRCVSGDYEPGSVFKLQTLSMAINSDMIQPWDRF 339

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           +T +P+ VG+  + D+ P +  + +P I   SSNIGA++IA  +G Q  + +L +LG   
Sbjct: 340 NTTHPLHVGRFTVTDFEPAHIWMAVPHILAVSSNIGASRIATILGPQIQRAWLRKLGFFR 399

Query: 414 KLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           +   +LPE   P Y   S WK + ++T+SFG+G++ +PLQ   A   ++N G   PPT +
Sbjct: 400 RPPIQLPEATPPMYHPKSSWKLLTTMTVSFGNGIAMSPLQLISAVVPVVNGGIWYPPTLL 459

Query: 472 IRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFEVGGKTGTAQKV-I 528
              +  +      V+ + T   MR ++R  VT   G+G  A VPG+ VGGKTGTAQ V  
Sbjct: 460 DHGKRSA---GVRVMSERTSLIMRKMMRNVVTAPDGTGVYARVPGYLVGGKTGTAQVVGP 516

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER------NQLTAGINVAPMVGNI 582
             RY   LN  SF+A FP  DP+Y+V   +  P   ++         T G   AP V  I
Sbjct: 517 NGRYLQHLNNASFMAAFPMNDPRYVVYVVVLQPHATKQMLPFCHGFTTGGYVAAPAVAQI 576

Query: 583 IRRSASMLGVKPV 595
           I R   MLG+ P+
Sbjct: 577 ISRIGPMLGIMPL 589


>gi|163732139|ref|ZP_02139585.1| penicillin-binding protein, putative [Roseobacter litoralis Och
           149]
 gi|161394437|gb|EDQ18760.1| penicillin-binding protein, putative [Roseobacter litoralis Och
           149]
          Length = 593

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 181/546 (33%), Positives = 291/546 (53%), Gaps = 38/546 (6%)

Query: 75  GMTIVVCLVIYIILAIRIIQYGNIH-PEPIAPSMNIDEYGM----SRPDIIDRNGEILAT 129
           G  +V+ L   +   +  ++ G +   EP  P   +D  G     +R DI+DR+G +LAT
Sbjct: 47  GRLLVLGLFFVVAFGVVGLRMGMLATSEPTEP--RVDAPGAQIHAARADIVDRHGNLLAT 104

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           +  T +LY +P ++I P+   ++L  V P+LD+  +    + + KF W++RK+SP+Q + 
Sbjct: 105 NFETHALYAQPPQMIDPEHAAQELAKVFPDLDAADLLEDFTGKRKFLWVKRKISPEQMQA 164

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------GITGIEKFLDMQGLT 241
           +   G PG+ F     R YP    A+HV+G               G+ G+EK+ D + L 
Sbjct: 165 VHEIGDPGLLFATRDMRLYPNGQLAAHVLGGASFGKEGVKAAEVIGVAGVEKYFD-EYLR 223

Query: 242 RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
              T +      QP++L+LDL +Q    + L    K  NA+   +++++V TGEVIS+VS
Sbjct: 224 DPATVS------QPLQLSLDLTVQAAAERVLYGGMKLMNAKGATSILMDVHTGEVISVVS 277

Query: 302 IPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +P +DP+   +    G       FNR   G++E+GS FK+FT+A  +D GL     + DT
Sbjct: 278 LPTFDPNNRPRPATSGDASDSPLFNRSVQGVYELGSTFKIFTVAQAMDLGLVNPDSIIDT 337

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
           + P++ GKH I D+      +++ ++   SSNIG A+IA  +G+   K FL  LG+L   
Sbjct: 338 KGPLRWGKHRIRDFRNYGDEMSVTKVIVKSSNIGTARIAQDIGVARQKAFLGELGMLETT 397

Query: 416 ETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
             E+ E     P  P  W  + ++TIS+GHGLST+P+  A   AA+ N G  + PT +  
Sbjct: 398 GFEIVEAATGRPLLPPNWSELSTMTISYGHGLSTSPMHLAAGYAAIANGGYRVQPTILKA 457

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK--R 531
           +    EK  R V  +++    R +LR+ VT G+     V G+ VGGKTGTA K   +   
Sbjct: 458 T--NPEKGPR-VFSESSSAASRKMLRQVVTEGTASFGNVEGYAVGGKTGTADKPGSRGGY 514

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGNIIRRSASM 589
           Y D +   +F ++FP  DP+Y+++  +D P     +  + TAG    P+   +IRR A +
Sbjct: 515 YEDKV-IATFASIFPIDDPKYVLIVTLDEPVETTSDEPRRTAGWTAVPVAAEMIRRVAPL 573

Query: 590 LGVKPV 595
           LG++P 
Sbjct: 574 LGLRPT 579


>gi|163746122|ref|ZP_02153481.1| penicillin-binding protein [Oceanibulbus indolifex HEL-45]
 gi|161380867|gb|EDQ05277.1| penicillin-binding protein [Oceanibulbus indolifex HEL-45]
          Length = 595

 Score =  302 bits (773), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 181/554 (32%), Positives = 296/554 (53%), Gaps = 26/554 (4%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPI--APSMNIDEYGMSR 116
           ++ R K    ++ R+ +  V  L  + ++  R+       P EP   AP   I     SR
Sbjct: 35  EQMRDKARMRAEGRLLVLGVCFLCAFTVIGGRMGLLAMSEPSEPRGHAPGAVIS---ASR 91

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
            DI DRNG +LAT+  T +LY +P  +I P+   +KL  + P+L  E + +  + + KF 
Sbjct: 92  ADITDRNGNLLATNFETHALYAQPRHMIDPEAAAKKLVKIFPDLKEERLIKDFTGKRKFL 151

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W+++K+SP+Q + +   G PG+ F     R YP  S A+HV+G       G+   E  + 
Sbjct: 152 WIKKKISPEQMQAVHDIGDPGLLFAPRDMRLYPNGSLAAHVLGGASYGKEGVHAAE-VIG 210

Query: 237 MQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
           + G  + F           +P+ L+LDL +Q    + L    K  NA+   +++++V TG
Sbjct: 211 VAGAEKYFDDYLRDPANGAKPLELSLDLTVQAASERVLYGGMKLMNAKGATSILMDVHTG 270

Query: 295 EVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           EVIS+ S+PD+DP+   +   +G       FNR   G++E+GS FK+F  A  I+ GLF 
Sbjct: 271 EVISVASLPDFDPNNRPRPLTQGDASDSPLFNRSVQGVYELGSTFKIFAAAQAIELGLFN 330

Query: 349 VKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
              + DT  P+KVG   I ++  +N   L++ +I  +SSN G  ++A  +GI+  +EFL 
Sbjct: 331 ADTIIDTSGPMKVGGFRIGEFRNKNYGKLSVADIIVHSSNRGTGRMALEIGIERQQEFLK 390

Query: 408 RLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
            LG       E+ E     P  PS+W  + S+TIS+GHGLS+TP+  A   AA+ N GR+
Sbjct: 391 SLGFFEPTPFEIVEASGGKPLLPSRWTELSSVTISYGHGLSSTPMHLAAGYAAIANGGRV 450

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
           + PT +   ++ + ++   V+ + T    R++LR+ VT G+   A VPG+++ GKTGTA 
Sbjct: 451 VKPTLL---KQTAPQLGPRVMSEETAAQARNMLRKVVTDGTASFAEVPGYQIAGKTGTAD 507

Query: 526 --KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGN 581
             K     Y D +  N+F ++FP   P+Y+++  +D P      + + TAG    P+   
Sbjct: 508 KPKPTGGYYEDKV-INTFASIFPIDSPKYVLIVTLDEPVETSGPKPRRTAGWTAVPVAAE 566

Query: 582 IIRRSASMLGVKPV 595
           ++RR A +LG++P 
Sbjct: 567 MVRRIAPLLGLRPA 580


>gi|110680540|ref|YP_683547.1| penicillin-binding protein, putative [Roseobacter denitrificans OCh
           114]
 gi|109456656|gb|ABG32861.1| penicillin-binding protein, putative [Roseobacter denitrificans OCh
           114]
          Length = 543

 Score =  301 bits (771), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 176/531 (33%), Positives = 289/531 (54%), Gaps = 25/531 (4%)

Query: 82  LVIYIILAIRIIQYGNIHP-EPI--APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYV 138
           +V + ++ +R+       P EP   AP   I     +R DI+DR+G +LAT+  T +LY 
Sbjct: 7   VVAFGVVGLRMGMLATSEPTEPRVGAPGAQIH---AARADIVDRHGNLLATNFETHALYA 63

Query: 139 EPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGV 198
           +P ++I P+    +L  V P+LD+  +    + + KF W++RK+SP+Q + +   G PG+
Sbjct: 64  QPPQMIDPEHAARELAKVFPDLDAADLLEDFTGKRKFLWVKRKISPEQMQAVHEIGDPGL 123

Query: 199 GFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT--NKGEKNLQPI 256
            F     R YP    A+HV+G       G+   E  + + G+ + F        K  +P+
Sbjct: 124 LFATRDMRLYPNGQLAAHVLGGASFGKEGVRAAE-VIGVAGVEKYFDDYLRDPAKAHEPL 182

Query: 257 RLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKE 316
           +L+LDL +Q    + L    K  NA+   +++++V TGEVIS+VS+P +DP++  +    
Sbjct: 183 QLSLDLTVQAAAERVLYGGMKLMNAKGATSILMDVHTGEVISVVSLPTFDPNDRPRPATS 242

Query: 317 G------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH 370
           G       FNR   G++E+GS FK+FT+A  +D GL     + DT+ P++ GKH I D+ 
Sbjct: 243 GDASDSPLFNRSVQGVYELGSTFKIFTVAQAMDLGLVNPDTIIDTKGPLRWGKHRIRDFR 302

Query: 371 PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYP 428
                +++ ++   SSNIG A+IA  +G++  K FL  LG+L     E+ E     P  P
Sbjct: 303 NYGDEMSVTKVIVKSSNIGTARIAQDIGVERQKAFLDELGMLETTGFEIVEAATGRPLLP 362

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
             W  + ++TIS+GHGLST+P+  A   AA+ N G  + PT +  +    EK  R+  ++
Sbjct: 363 PNWSELSTMTISYGHGLSTSPMHLAAGYAAIANGGYRVQPTILKTT--NPEKGPRVFSEE 420

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK--RYSDTLNFNSFLAVFP 546
           ++  + R +LR+ VT G+     V G+ VGGKTGTA K   +   Y D +   +F ++FP
Sbjct: 421 SSAAS-REMLRKVVTEGTASFGNVEGYAVGGKTGTADKPGSRGGYYEDKV-IATFASIFP 478

Query: 547 TTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
             DP+Y+++  +D P     +  + TAG    P+   +IRR A +LG++P 
Sbjct: 479 IDDPKYVLIVTLDEPVETTSDEPRRTAGWTAVPVAAEMIRRIAPLLGLRPT 529


>gi|84501748|ref|ZP_00999920.1| penicillin-binding protein [Oceanicola batsensis HTCC2597]
 gi|84390369|gb|EAQ02928.1| penicillin-binding protein [Oceanicola batsensis HTCC2597]
          Length = 597

 Score =  300 bits (767), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 172/552 (31%), Positives = 293/552 (53%), Gaps = 25/552 (4%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM--SRP 117
           ++ R +    ++ RI +   V  + ++ + +++  +     EP  P  +I    +   R 
Sbjct: 39  EEMRDRARVRAEGRILVLGAVFALAFLTIGVKM--WIVAESEPAEPRTSIAGASIVAQRG 96

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
           DI+DR+G +LAT++ T++LY  PH+++ P+   E L  + P+LD   + R  +   +F W
Sbjct: 97  DILDRHGRVLATNLDTYALYAHPHQMVEPERAAEALVGIFPDLDLARLTRDFTGNRRFVW 156

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           +RRK+SP+Q++ +   G PG+ F   + R YP  + ASH++G       G+   E     
Sbjct: 157 IRRKISPEQRQAVHDIGEPGLLFGPREMRLYPNGAIASHILGGAGYGEEGVHAAE-IKGT 215

Query: 238 QGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
            G+ R F           +P+ L+LDL +Q    + L    +  NA+   +++++V TGE
Sbjct: 216 AGVERAFDDYLTDPANGGKPLELSLDLTVQAASEKVLYGGMRLMNAKGAASILMDVKTGE 275

Query: 296 VISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +ISMVS+PD+DP++      +G       FNR   G++E+GS FK+F  A  +D GL T 
Sbjct: 276 IISMVSLPDFDPNDRPNPPTQGHPDDSPLFNRAVQGVYELGSTFKIFAAAQALDLGLVTP 335

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
           + + D R PI+ G+H I DYH   + L++ +I   SSNIG A++A+ +G +  K+FL  L
Sbjct: 336 ETVVDIRGPIRWGRHSIRDYHWYGKELSVADIIIKSSNIGTARLAEQIGAERQKQFLADL 395

Query: 410 GLLSKLETELPEIQAPS----YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
           GL      E+  I+APS        W  + ++T+SFGHG+S +PL  A A A + N+G+ 
Sbjct: 396 GLFEPTPVEM--IEAPSGKPLVQKNWSELTTMTVSFGHGISISPLHLAAAYATIANDGQR 453

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
           + PT +   R+ + +    V+ K   +  + +LR  VT G+   A +  + + GKTGTA 
Sbjct: 454 VRPTLL---RQSAPQDGPQVMSKPAARRAQDMLRRVVTEGTASFARIDHYSIAGKTGTAD 510

Query: 526 KVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGNI 582
           K      Y       +F ++FP   P+Y+++  +D       +  + TAG    P+   +
Sbjct: 511 KPKPTGGYYKDRTITTFASMFPAHSPRYVLIVTLDEAVETSGDEPRRTAGWTAVPVAAEM 570

Query: 583 IRRSASMLGVKP 594
           I R A +LG++P
Sbjct: 571 ITRVAPLLGLRP 582


>gi|83942759|ref|ZP_00955220.1| penicillin-binding protein [Sulfitobacter sp. EE-36]
 gi|83953998|ref|ZP_00962719.1| penicillin-binding protein [Sulfitobacter sp. NAS-14.1]
 gi|83841943|gb|EAP81112.1| penicillin-binding protein [Sulfitobacter sp. NAS-14.1]
 gi|83846852|gb|EAP84728.1| penicillin-binding protein [Sulfitobacter sp. EE-36]
          Length = 595

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 172/517 (33%), Positives = 276/517 (53%), Gaps = 33/517 (6%)

Query: 99  HPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
            P   AP   I     +R DI+DRNG +LAT+  T +LY +PH +I P   ++KL  V P
Sbjct: 77  EPRAAAPGSVIS---ATRADIVDRNGNLLATNFETHALYAQPHHMIDPQGAVKKLMAVFP 133

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
           +L+ E + R  + + KF W+++K+SP+Q + +   G PG+ F     R YP  S A+H++
Sbjct: 134 DLNEERLLRDFTGKRKFLWIKKKISPEQMQAVHDIGEPGLLFAPRDMRLYPNGSLAAHIM 193

Query: 219 GYVDIDNR--------GITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQ 270
           G               G+ G EK+ D       +  +    N +P+ L++D+ +Q    +
Sbjct: 194 GGASYGREGVHAAEVIGVAGAEKYFDD------YLRDPANGN-KPLELSIDMTVQAASER 246

Query: 271 ELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYD----PHEAFKGKKEG--WFNRISY 324
            L    K  NA+   +V+++V TGEVIS VS+P +D    PH A  G       FNR   
Sbjct: 247 ILYGGMKLMNAKGATSVLMDVHTGEVISAVSLPSFDPNDRPHAAVTGDASDSPLFNRSVQ 306

Query: 325 GIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFR 383
           G++E+GS+FK+FT A  ID G+ T   + DT  P+KVG   I ++H +N    T+  I  
Sbjct: 307 GVYELGSVFKIFTAAQAIDLGIATADTVIDTSGPMKVGGFRIGEFHGKNYGKQTVTGIIV 366

Query: 384 YSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISF 441
           +SSN G  ++A  +G +  +EFL  LG       E+ E     P  P +W+ + ++T+S+
Sbjct: 367 HSSNRGTGRLALEIGAERQQEFLKNLGFFEPTPFEIVEASGGKPLLPQRWQELSTVTVSY 426

Query: 442 GHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREG 501
           GHGLS++P+  A   +A+ N G  + PT     ++    V   V+ +      R++LR  
Sbjct: 427 GHGLSSSPMHLAAGYSAIANGGHKVTPTL---RKQSGPVVGPRVMSERAAADARAMLRAV 483

Query: 502 VTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDS 560
           VT G+   A VPG+++GGKTGTA K   +  Y +     +F ++FP  DP+Y+++  +D 
Sbjct: 484 VTEGTASFAEVPGYQIGGKTGTADKPGPRGGYLEDTVIATFASMFPAHDPKYVLIVTLDE 543

Query: 561 P--KIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           P     ++ + TAG    P+   ++RR A +LG++P 
Sbjct: 544 PVETSGDKPRRTAGWTAVPVAAEMVRRVAPLLGLRPT 580


>gi|149201996|ref|ZP_01878970.1| Peptidoglycan glycosyltransferase [Roseovarius sp. TM1035]
 gi|149145044|gb|EDM33073.1| Peptidoglycan glycosyltransferase [Roseovarius sp. TM1035]
          Length = 594

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 173/560 (30%), Positives = 297/560 (53%), Gaps = 36/560 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS 115
           +++  + RR+    ++ R+ +   V ++ + ++  R+       P     S+   +    
Sbjct: 35  EEMRDRARRR----AEGRLLVLAGVFILAFGVVGGRMGVLAGTEPSEPTTSVAGAQIFAQ 90

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI+DR G ILAT+  T SLY +P ++I P++  +KL  + P+LD   + +  +   KF
Sbjct: 91  RADIVDREGRILATNFDTHSLYAQPQQMIDPEQAADKLVEIFPDLDRARLIKDFTGPRKF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------G 227
            W+++KLSP+Q++ +   G PG+ F   + R YP    A+HV+G               G
Sbjct: 151 LWIKKKLSPEQKQAVHDIGEPGLLFGPREMRLYPNGRLAAHVLGGTSFGREGVHAAELVG 210

Query: 228 ITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           + GIE+  D +            +  +P+RL+LDL +Q  + + L    K  NA+    +
Sbjct: 211 VAGIERHQDAR-------LRDPAQAHEPLRLSLDLSVQAAMERVLFGGMKIMNAKGAAGI 263

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMG 341
           +++  +GEV+++ S+PD+DP++       G       FNR   G++E+GS  KVF +A  
Sbjct: 264 LMDAHSGEVVAVASLPDFDPNDRPALPTSGSPSDSPLFNRAVQGVYELGSTLKVFPVAQA 323

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +D GL   + + +T++P++ GK  I D+      L+  ++   SSN+G A+IA  +G + 
Sbjct: 324 LDLGLINPETMINTKSPMQWGKFRIRDFKNYGPELSATKVIVKSSNVGTARIALEIGAKR 383

Query: 402 HKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
            +EFL +LG ++ +  E+ E     P  P  W  + ++TIS+GHGLS +P+  A   A +
Sbjct: 384 QREFLDQLGFIAPVHLEIAEASGSTPLLPKNWSDLSTMTISYGHGLSISPMHLAAGYATI 443

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
            N GRL+ PT +   R+ +      ++ + T   MR +LR+ V+ G+     VPG+ VGG
Sbjct: 444 ANGGRLVTPTLL---RDPTRAPGERIITEATSAAMRRMLRQVVSEGTASLGEVPGYAVGG 500

Query: 520 KTGTAQKVIKKR---YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGIN 574
           KTGTA K  K+R   Y      ++F ++FP  DP+Y+++  +D P     ++   TAG  
Sbjct: 501 KTGTADKP-KERGGGYHKDKVISTFASIFPAHDPKYVLVVTLDEPVETSGSEARRTAGWT 559

Query: 575 VAPMVGNIIRRSASMLGVKP 594
             P+   IIRR A +LGV+P
Sbjct: 560 AVPVAAEIIRRVAPLLGVRP 579


>gi|126729245|ref|ZP_01745059.1| penicillin-binding protein [Sagittula stellata E-37]
 gi|126710235|gb|EBA09287.1| penicillin-binding protein [Sagittula stellata E-37]
          Length = 598

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 179/559 (32%), Positives = 293/559 (52%), Gaps = 36/559 (6%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R ++   ++ R+ +  ++    Y ++  R+       PE      +      SR DI+DR
Sbjct: 38  RDRMRLRAEGRLLVLAMMFFCAYGVIGARMGMLSASEPEEPRAQTSGASIIASRADIVDR 97

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE-MIRRKLSSETKFQWLRRK 181
           +G ILAT++ T SLY  P+++I P+    +L  + P+LD E + +R +  + KF W+++K
Sbjct: 98  HGRILATNMSTHSLYAHPNQMIDPERAALRLAEIFPDLDGEKLAKRFMDPKRKFLWVKKK 157

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI--------TGIEK 233
           LSP+Q + +   G PG+ F   + R YP  + ASHV+G       G+         GIEK
Sbjct: 158 LSPEQMQAVHDIGEPGLLFGPREMRLYPNGALASHVLGGASFGAEGVHSAEVIGTAGIEK 217

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           F D              +   P+ L++DL +Q    + L    K  NA    +V+L+V T
Sbjct: 218 FFDKD-------LRDPAREGVPLTLSIDLTVQAAAEEVLNAGMKLMNARGAASVLLDVHT 270

Query: 294 GEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           GEV+++VS+PD+DP++  +   EG       FNR   G++E+GS FK+F  A  +  GL 
Sbjct: 271 GEVLAIVSLPDFDPNDRPRPPTEGSPSDSPLFNRAVQGVYELGSTFKIFAAAQAMQLGLV 330

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
               + DT  P KVG H I ++   N   L++ +I   SSN G  ++A A+G    ++FL
Sbjct: 331 NSSTVIDTSPPFKVGGHRIGEFQNHNYGKLSVEKIIVKSSNRGTGKLALAIGPTRQQDFL 390

Query: 407 YRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
             LGL      E+ E     P +PS+W  + ++TIS+GHG+STTPL  A   AA+ N G 
Sbjct: 391 KALGLFDATPLEIVEASGGKPLWPSRWTDLSAVTISYGHGISTTPLHLAAGYAAIANGGH 450

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF--VPGFEVGGKTG 522
           ++ PT +   ++   +   ++L+++       +LR+ V    G  +F  VPG+ VGGKTG
Sbjct: 451 IVKPTLL---KQSGPRYQDVILREDVAHDALHMLRQVVASEDGTASFAEVPGYHVGGKTG 507

Query: 523 TAQKVIKK---RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAP 577
           TA K  ++    Y D +   +F ++FP  DP+Y+++  +D P      + + TAG    P
Sbjct: 508 TADKPKERGGGYYKDKV-IATFASIFPANDPKYVLVVTLDEPVETSGAKPRRTAGWTAVP 566

Query: 578 MVGNIIRRSASMLGVKPVF 596
           +   +I R A +LG++P +
Sbjct: 567 VAAEMIGRIAPLLGLRPDY 585


>gi|294677902|ref|YP_003578517.1| peptidoglycan synthetase FtsI [Rhodobacter capsulatus SB 1003]
 gi|294476722|gb|ADE86110.1| peptidoglycan synthetase FtsI [Rhodobacter capsulatus SB 1003]
          Length = 599

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 174/547 (31%), Positives = 283/547 (51%), Gaps = 19/547 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R    A    RIG+ I +  V +  + +R+       PE    +         R DI DR
Sbjct: 39  REAARARVAWRIGLVIGIFCVCFGAVGVRMGTLAASTPEEPQRADTAPAILAQRADITDR 98

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
            G +LAT++ T +LY +P  ++ P    +KL  + P+LD++ +    +   KF W+++K+
Sbjct: 99  EGRVLATNLVTHALYAQPPMMVDPVGTAKKLAKIFPDLDAKRLAADFTGTRKFVWIKKKI 158

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTR 242
           SP+Q +++   G PG+ F   + R YP    A+HV+G     N G+   E  +   G+ +
Sbjct: 159 SPEQLQQVHDIGEPGLLFGPREMRLYPNGRLAAHVLGGARFGNEGVDSAE-IIGTAGVEK 217

Query: 243 VFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
            F         N  P++L++DL +Q  V + L    K  NA+    V+++  +GE++++ 
Sbjct: 218 AFDGWLRDPANNGAPLKLSIDLTVQQAVEEILAGGMKLMNAKGATAVVMDAHSGEIVALA 277

Query: 301 SIPDYDPHE----AFKGKKEG--WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           S+PD+DP++      KG       FNR   G++E+GS FK+F +A  ++ GL     + D
Sbjct: 278 SLPDFDPNDRPTPLVKGDASDSPLFNRAVQGVYELGSTFKIFAVAQALELGLVNPTTMLD 337

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
           T++P+  G+  I D+H     L+I +I   SSN+G A+IA  +G Q  K FL  LG ++ 
Sbjct: 338 TKSPMVWGRFRIRDFHNYGPALSITDIVVESSNVGTARIALLIGGQRQKAFLESLGFMAP 397

Query: 415 LETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM- 471
              EL E  +  P  P +W  I S+T+ +GHGL+ +PL  A A A + N G  + PT + 
Sbjct: 398 TPVELSEAPSGRPIVPGKWSEITSMTVGYGHGLAASPLHLAAAYATIANGGYRVKPTLVH 457

Query: 472 IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK-K 530
             + E   +V      + ++  MR++    VT G+   A V G+EV GKTGTA KV    
Sbjct: 458 AATHERGPQVMSTEAARKSLAMMRAV----VTRGTASFADVKGYEVAGKTGTADKVKPGG 513

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSAS 588
            Y D     +F + FP +DP+Y+++  +D P     N+   TAG    P+   +IRR A 
Sbjct: 514 GYYDNKVIATFASAFPASDPKYVLVLTLDEPSSFAANETRRTAGWTAVPVAAEVIRRIAP 573

Query: 589 MLGVKPV 595
           +LG++P 
Sbjct: 574 ILGLRPA 580


>gi|114763023|ref|ZP_01442453.1| penicillin-binding protein [Pelagibaca bermudensis HTCC2601]
 gi|114544347|gb|EAU47355.1| penicillin-binding protein [Roseovarius sp. HTCC2601]
          Length = 596

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 182/561 (32%), Positives = 296/561 (52%), Gaps = 36/561 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSRPD 118
           ++ R K    ++ R+ +  V+ LV + ++  R+       P EP A +        SR D
Sbjct: 35  EQMRDKARVRAEGRLLVMSVMFLVAFAVVGARMGMLAASEPAEPRAHASGASIIA-SRAD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS-ETKFQW 177
           I DR+G ILAT++ T SLY  P ++I P    ++L+ + P+L+ E + +  +  + KF W
Sbjct: 94  ITDRHGRILATNMETHSLYAHPQQMIEPLRAAKELKAIFPDLEEERLVKDFTDPKRKFLW 153

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT-------- 229
           +++K+SP+Q + +   G PG+ F   + R YP  + ASHV+G       G+         
Sbjct: 154 VKKKISPEQMQAVHDIGEPGLLFGPREMRLYPNGALASHVMGGASFGREGVASAEVIGTA 213

Query: 230 GIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
           GIEKF D +            +   P+ L++DL +Q    + L    +  NA+   +V++
Sbjct: 214 GIEKFFDAE-------LRDPARGGAPLELSIDLSVQAASERVLDAGMRLLNAKGAASVLM 266

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGID 343
           +V TGEVIS+ S+PD+DP++  +    G       FNR   G++E+GS FK+F  A  +D
Sbjct: 267 DVHTGEVISIASLPDFDPNDRPRPPTSGSPSDSPLFNRAVQGVYELGSTFKIFAAAQAMD 326

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGH 402
            GL     + DTR P KVG H I ++   N   + + EI   SSN G  ++A A+GI   
Sbjct: 327 LGLVRPDTIIDTRPPFKVGGHRIGEFEGHNYGEIPVEEIIIKSSNRGTGKMALAIGIDRQ 386

Query: 403 KEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALI 460
           ++FL +LG       E+ E     P  P++W  + S+TIS+GHGLS++PL  A A +A+ 
Sbjct: 387 QDFLKKLGFFEPTPLEIVEAAGGKPLLPARWTDLSSVTISYGHGLSSSPLHLAAAYSAIA 446

Query: 461 NEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGK 520
           N G L+ PT +   +++  +    V+        R +LR+ V+ G+     VPG+ VGGK
Sbjct: 447 NGGTLVKPTLL---KQQGAQFGDRVMSPQVAAASRDMLRKVVSTGTASFGEVPGYHVGGK 503

Query: 521 TGTAQKVIKK---RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINV 575
           TGTA K  ++    Y D +   +F A+FP  DP+Y+++  +D P      + + TAG   
Sbjct: 504 TGTADKPREQGGGYYKDKV-IATFAAMFPAHDPKYVLIVTLDEPVETSGSKPRRTAGWTA 562

Query: 576 APMVGNIIRRSASMLGVKPVF 596
            P+   +I R A +LG++P +
Sbjct: 563 VPVAAEMIGRIAPLLGLRPDY 583


>gi|260430919|ref|ZP_05784890.1| penicillin-binding protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414747|gb|EEX08006.1| penicillin-binding protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 595

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 170/513 (33%), Positives = 282/513 (54%), Gaps = 28/513 (5%)

Query: 101 EPIA--PSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
           EP+A  P  +I    M R +I+DR+G ILAT++ T+S+Y +P  +I P    EKL  + P
Sbjct: 77  EPVASAPGASI---AMQRANIVDRHGRILATNLDTYSVYAQPPLMIDPHGAAEKLAAIFP 133

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
           +LD E + +  + + KF W+++++SP+Q++ +   G PG+ F   + R YP    A+H++
Sbjct: 134 DLDKERLIKDFTGKRKFLWIKKRISPEQKQAVHDIGDPGILFGPREMRLYPNGRLAAHIL 193

Query: 219 GYVDIDNRGITGIEKFLDMQGLTRVFTT---NKGEKNLQPIRLALDLRIQNIVHQELVEN 275
           G       G++  E  + + G+ + F     +    N +P++L+LDL +Q  V Q L   
Sbjct: 194 GGSGFGREGVSAAE-VIGVAGVEKQFDDYLRDPANGN-KPLQLSLDLTVQAAVEQVLDGG 251

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIFE 328
            K  NA+    V++N  TGEVI+  S+P +DP++  +    G+       FNR   G++E
Sbjct: 252 MKIMNAKGASAVLMNAHTGEVIAAASLPSFDPNDRPRPPTSGFDPSDSPLFNRYVQGVYE 311

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSN 387
           +GS+FK+FT A  +D GL     + DT  P+K+G+  I +++ +N   +++ ++  +SSN
Sbjct: 312 LGSVFKIFTAAQAVDLGLVNADTIIDTSGPMKIGRFPIGEFNGKNYGEISVTDVIVHSSN 371

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGL 445
            G  ++A  +G +  ++FL  LG+      E+ E +   P  P +W  + ++TIS+GHGL
Sbjct: 372 RGTGRLALQIGAERQQQFLDALGMFDPTPFEIVEAKGGVPLKPKKWGELSTVTISYGHGL 431

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGG 505
           ST+P+  A   AA+ N G  + PT +   R    +    V+ +N  +    +LR  VT G
Sbjct: 432 STSPMHLAAGYAAIANGGHYVSPTIL---RRNGPQYGPRVMSENAAQQSLMMLRRVVTDG 488

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           +     VPG+ V GKTGTA K  K R  Y D     +F +VFP  DP+Y+++  +D P I
Sbjct: 489 TASFGDVPGYAVAGKTGTADKP-KPRGGYYDDKVIATFASVFPAYDPKYVLVVALDEPSI 547

Query: 564 KE--RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
                 + TAG    P+   +I R A +LG++P
Sbjct: 548 LAYGEKRRTAGWTAVPVAAELIGRIAPLLGLRP 580


>gi|329115571|ref|ZP_08244293.1| Stage V sporulation protein D [Acetobacter pomorum DM001]
 gi|326694999|gb|EGE46718.1| Stage V sporulation protein D [Acetobacter pomorum DM001]
          Length = 672

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 190/602 (31%), Positives = 302/602 (50%), Gaps = 76/602 (12%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSM-- 107
           G DL  +  R  + H +  +G+    CL I+ ++AI++     +HP       IAP +  
Sbjct: 18  GDDLRARAHRDQM-HVR-LLGVAGGFCL-IFAVVAIKLTIATVVHPMAPEKRQIAPQVPE 74

Query: 108 --NIDEYG----------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQI 155
              ID  G          + R  I+DRNG+ LA  +P   +Y  P ++I P ++  KL+ 
Sbjct: 75  IPKIDPKGSLAGDFSLPQVHRASIVDRNGQTLALSLPVAQVYANPQELIDPKDVAHKLKS 134

Query: 156 VLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHAS 215
           +L ++D +    +LS   +F ++ R +SPQQ+  I + G+PG+ F   + R YP    A+
Sbjct: 135 ILKDIDEQETADRLSRPKQFVYIARNISPQQELAINNLGIPGIYFEPGERRHYPLGRMAA 194

Query: 216 HVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
            ++G VDID+ G+ GIEK+ D + L+          + +P+ L+LD+R+Q+ V +E+   
Sbjct: 195 QIMGTVDIDDHGVAGIEKYFDKRLLS----------DHRPLHLSLDIRVQSAVREEVANA 244

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            + + A     ++++V TGE+I+MVS+PD+D +       +  FNR   G++E GS FK+
Sbjct: 245 MQTFQAIGACGIVMDVRTGEIIAMVSLPDFDANNFAHATNDERFNRAVTGLYEPGSTFKL 304

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTIPEIFRYSSNIGAAQI 393
            T AMG+++G   + D F +  P+ +G+  I D      +  LT+PE+  YSSN  AA I
Sbjct: 305 QTTAMGLETGTIHIWDRFSSV-PLHIGRFTIRDMKSDHFSPWLTLPEVMAYSSNPAAAHI 363

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTA 453
           A  +G +   E+L  +G  S +  ELPE   P  P QW     +T+ FGHG++  PL   
Sbjct: 364 ALDVGGKKQSEWLRSMGFFSPVPVELPEAARPLVPHQWGIATVMTVGFGHGVAEPPLAIV 423

Query: 454 VAAAALINEGRLIPPTFMIR-------------SREESEKVSRIVLKKNTVKTMRS---- 496
              AA +N G L+ PT + +             S + +  +    L+++     +S    
Sbjct: 424 RGTAATVNGGILVTPTLLDKEDPANATASAPGISPQFASGIQNAALEQSVEDDTQSSAAD 483

Query: 497 ---------LLRE------------GVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSD 534
                    +L E             VT G+GR A  PG+ VGGKTGTA+K+     Y  
Sbjct: 484 APVTPAGPRILSEKVSSLLRRLLRLDVTHGTGRTAESPGYFVGGKTGTAEKIGPHGGYLK 543

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGV 592
            +N ++F  +FP   P Y V   +DSPK   +     TAG N AP V  I+ R   ML +
Sbjct: 544 HVNISAFTGIFPMNSPHYAVYVMLDSPKPTPQTHGWTTAGWNAAPTVSKIVSRIGPMLQI 603

Query: 593 KP 594
            P
Sbjct: 604 FP 605


>gi|260576882|ref|ZP_05844865.1| Peptidoglycan glycosyltransferase [Rhodobacter sp. SW2]
 gi|259020919|gb|EEW24232.1| Peptidoglycan glycosyltransferase [Rhodobacter sp. SW2]
          Length = 595

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 272/501 (54%), Gaps = 33/501 (6%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI DRNG ILAT++ T SLYV+P  ++ P  +  +L  + P+LD+  + R+ +    F
Sbjct: 91  RADITDRNGRILATNLMTNSLYVQPKDMVDPARVAAELAQIFPDLDAAALERRFTDGRSF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI------- 228
            W+R+ LSP+QQ+++   G PG+ F   + R YP    A+HV+G       G+       
Sbjct: 151 MWVRKVLSPEQQQQVHEIGDPGLLFGPREMRLYPNGRLAAHVLGGASFGAEGVDSAEVIG 210

Query: 229 -TGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
             G+EK LD +            +   P+ L++DL +Q    + L    K  NA+    +
Sbjct: 211 TAGVEKALDAR-------LRDPAQAGAPLALSIDLTVQAATQEVLEAGMKMMNAKGAAAI 263

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMG 341
           +++V TGEV+SMVS+PD+DP++  +    G       FNR   G++E+GS FK+F +A  
Sbjct: 264 LMDVHTGEVLSMVSLPDFDPNDRPQPLLTGDPGDSPLFNRAVQGVYELGSTFKIFAVAQA 323

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR--ILTIPEIFRYSSNIGAAQIADAMGI 399
           +D GL   + + D + P+  GK  I+++   N   +L++ E+   SSN+GAA IA  +G 
Sbjct: 324 MDLGLVNPETMVDAKAPMYWGKFKINEFEGHNYGPLLSVTEVIVKSSNVGAAHIAMQIGG 383

Query: 400 QGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
              + F   LGL      EL E     P  PS+W  I ++T ++GHG+S +P+  A A A
Sbjct: 384 LRQQAFFKSLGLFDATPVELVEAPGAKPLIPSKWPEIVTITTAYGHGMSDSPMHLAAAYA 443

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           A+ N G  + PT +   R ++   +  ++ +   +   S+LR+ VT G+     VPG+ V
Sbjct: 444 AIANGGLAVKPTLL---RRDAPLQAERIMSETAARAAVSMLRQVVTRGTASLGDVPGYAV 500

Query: 518 GGKTGTAQ--KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGI 573
           GGKTGTA   K     Y D +  N+F ++FPT DP+Y+++  +D P      + + TAG 
Sbjct: 501 GGKTGTADKPKPTGGYYKDKV-VNTFASMFPTNDPKYVLIVTLDEPVETSGPKPRRTAGW 559

Query: 574 NVAPMVGNIIRRSASMLGVKP 594
              P+   IIRR+A +LG++P
Sbjct: 560 TAVPVAAEIIRRTAPLLGLRP 580


>gi|254441333|ref|ZP_05054826.1| Penicillin-binding Protein dimerisation domain family
           [Octadecabacter antarcticus 307]
 gi|198251411|gb|EDY75726.1| Penicillin-binding Protein dimerisation domain family
           [Octadecabacter antarcticus 307]
          Length = 593

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 175/520 (33%), Positives = 277/520 (53%), Gaps = 34/520 (6%)

Query: 96  GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQI 155
           G++  EPIA +      G  R DI+DRNG +LA ++ T SLY +   +I P +    L  
Sbjct: 72  GSVPEEPIAQASGSPIIG-QRSDIVDRNGRVLAMNLDTHSLYAQIPDMIDPAKAARDLAE 130

Query: 156 VLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHAS 215
           + P L  E +    +   +F W+RR++SP+Q + +   G PG+ F   + R YP  S A+
Sbjct: 131 IFPELVEEDLFADFTGGRRFLWIRRQISPEQMQAVHDIGDPGLLFGPREMRLYPNGSVAA 190

Query: 216 HVVGYVDIDNRGI--------TGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNI 267
           H++G       G+         G+EKF D       F  +   +   P+ L++DL +Q  
Sbjct: 191 HILGGATYGREGVNSAEVIGVAGVEKFFDD------FLRDPANEG-APLELSIDLTVQAA 243

Query: 268 VHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNR 321
             + L       +A+   +V+++V TGE+ISMVS+PD+DP++  +    G       FNR
Sbjct: 244 SERVLQGGMMLMSAKGASSVLMDVHTGEIISMVSLPDFDPNDRPRVLTSGDQSDSVLFNR 303

Query: 322 ISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEI 381
              G++E+GS+FK+F +A  I+ GL     + DT+ P+  G+  I D+H     L+  ++
Sbjct: 304 AVQGVYELGSVFKIFAVAQAIEIGLIEASTMIDTQGPLAWGRFRIRDFHDYGPQLSAEDV 363

Query: 382 FRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS----YPSQWKRIHSL 437
              SSNIG A+IA  +G    +EFL  LGLL +   E+  I+AP+     P+ W  I ++
Sbjct: 364 IIESSNIGTARIAMMIGADRQREFLGSLGLLVQTPVEM--IEAPTGDPLLPANWSEISAM 421

Query: 438 TISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL 497
           TIS+GHGLS++ +  A A A+L+N G  + PT +   R++  +    V+ +    T R +
Sbjct: 422 TISYGHGLSSSIVHLATAYASLLNGGYRVEPTIV---RQDGPRHGPRVVSEQVSTTARDM 478

Query: 498 LREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLS 556
           LR  V  G+     V G+EVGGKTGTA K      Y D     +F +VFP  DP+Y+++ 
Sbjct: 479 LRATVVRGTASFGDVQGYEVGGKTGTADKPRSTGGYYDDRTIATFASVFPANDPRYVLIV 538

Query: 557 FMDSPKIKE--RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            +D P ++     + TAG    P+   +IRR A +LG++P
Sbjct: 539 TLDEPSVEALGEQRRTAGWTAVPIAAEMIRRVAPLLGLRP 578


>gi|149186208|ref|ZP_01864522.1| penicillin-binding protein [Erythrobacter sp. SD-21]
 gi|148830239|gb|EDL48676.1| penicillin-binding protein [Erythrobacter sp. SD-21]
          Length = 570

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 171/494 (34%), Positives = 271/494 (54%), Gaps = 27/494 (5%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHK--------VISPDEIIEKLQIVLPNLDSEMIRR 167
           R +I+DRNG  +A   P ++L+  P          V  P  +  KLQ + P LD + +  
Sbjct: 66  RGEIVDRNGVPMARAFPAYALWFNPEALGEGEAPLVAEPAAVAAKLQTIFPALDEKAVTA 125

Query: 168 KLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           +L+S +   ++RR+L P++  R+   G   +   +E+ R YP    A+HV+GYV  D +G
Sbjct: 126 QLASGSG-GYIRRRLLPEEANRVQDIGELALEMPMEEDRHYPQGKMAAHVLGYVAADGKG 184

Query: 228 ITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
             G+E+  D   L    T         P+ L++D+R+Q  +  EL    K   A+    +
Sbjct: 185 RVGMEQVFDKH-LRDPLTRGT------PVALSIDVRVQGALEDELRRGMKLTRAQGGAGI 237

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +L+V TGEV+++ S+P++DP++     ++  FNR++  ++E+GS FK  T+A  IDSG  
Sbjct: 238 VLDVDTGEVLALASLPEFDPNKIDAEGQKLMFNRVTNQVYELGSTFKPLTVAAAIDSG-- 295

Query: 348 TVKDL---FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           T++DL   FD  + +KVG+  I D H     L   E   +SSN   A+IAD +G +  ++
Sbjct: 296 TIRDLGRRFDASS-VKVGRFTIRDSHAMGADLNAVETLIHSSNTTTARIADEVGPERMRQ 354

Query: 405 FLYRLGLLSKLETELPEIQAPSYPSQ-WKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           ++  LG+ ++ E ELP    P +P + W R+ ++T+ FGHG++ TPL  A A A ++N G
Sbjct: 355 YMIDLGMNARPEIELPAKGFPLWPGEKWARLTNMTVGFGHGIAVTPLHLASAYATMVNGG 414

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
              P T       E+ K  R V K +T   MR +LR     G+GR A  PG+ VGGKTG+
Sbjct: 415 VYRPATLKKLGPGEAPK-GRRVFKASTSSRMRQMLRAIAIYGTGRNADAPGYRVGGKTGS 473

Query: 524 AQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVG 580
           A+K   K  Y  T   ++F A FP   P+Y+V++ +D PK  +    Q TA  N AP+VG
Sbjct: 474 AEKPGGKVGYRRTALVSTFAAAFPMDRPRYVVIAMLDEPKGTLASSYQRTAAWNAAPIVG 533

Query: 581 NIIRRSASMLGVKP 594
            ++ R   ++GV+P
Sbjct: 534 RLVPRIGPLIGVRP 547


>gi|159045013|ref|YP_001533807.1| peptidoglycan synthetase ftsI [Dinoroseobacter shibae DFL 12]
 gi|157912773|gb|ABV94206.1| peptidoglycan synthetase ftsI precursor [Dinoroseobacter shibae DFL
           12]
          Length = 597

 Score =  293 bits (749), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 163/509 (32%), Positives = 274/509 (53%), Gaps = 19/509 (3%)

Query: 101 EPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
           EP+A +++      +R DI+DR G +LAT++ + SLY +P  +  P+    +L  + P+L
Sbjct: 80  EPVA-AVSDARIDAARADIVDREGRVLATNLVSHSLYAQPPLMTEPERSAAELARIFPDL 138

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           D   +R   + E KF WL+R++SP+Q + +   G PG+ F   + R YP  + A+H++G 
Sbjct: 139 DEARMRDWFTGERKFLWLKRRISPEQMQAVHDIGDPGLQFGPREMRLYPNGALAAHILGG 198

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQ--PIRLALDLRIQNIVHQELVENKKK 278
                 G+   E  + + G+ + F     +      P+ L++DL +Q +V   L    + 
Sbjct: 199 TGFGREGVQSAE-LIGVAGVEKAFNARLSDPATASTPLALSIDLTVQAVVEDVLASGMRL 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSI 332
            NA+    V+++V TGE+I+  S+PD+DP+   +   +G       FNR   G++E+GS 
Sbjct: 258 MNAKGAAAVLMDVHTGEIIAKASLPDFDPNSRPRPLTQGDQGDSPLFNRAVQGVYELGSS 317

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           FK+FT A  ++ GL + + + DT +P+  G+  I D+      L++ ++   SSN+G A+
Sbjct: 318 FKIFTTAQALELGLVSPETMLDTTSPMTWGRFRIRDFRNYGPELSVTDVIVKSSNVGTAR 377

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPL 450
           +A  +G    K+FL +LG L+    E+ E     P +PS W  IH++TIS+GHG+ST+PL
Sbjct: 378 LALQIGGARQKDFLEQLGFLAPTPVEMIEAPGAVPLWPSNWSDIHTMTISYGHGISTSPL 437

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
             A   A+L+N G  + PT +   R+++      V+ + T +  R +L   V  G+    
Sbjct: 438 HLAAGYASLLNGGTKVTPTLL---RQDAPVKGPRVVSERTSRISREMLHAVVERGTASFG 494

Query: 511 FVPGFEVGGKTGTAQK--VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKER 566
            + G+ +GGKTGTA K       Y D     +F +VFP  DP+Y+++  +D P     E 
Sbjct: 495 RIEGYAIGGKTGTADKPRAAGGGYYDDKVIATFASVFPADDPEYVLVVTLDEPVETSGEE 554

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            + TAG    P+   I RR   +LG++P 
Sbjct: 555 PRRTAGWTAVPVSAEITRRILPLLGLRPT 583


>gi|258542964|ref|YP_003188397.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256634042|dbj|BAI00018.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256637102|dbj|BAI03071.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256640154|dbj|BAI06116.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643211|dbj|BAI09166.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646266|dbj|BAI12214.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649319|dbj|BAI15260.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652305|dbj|BAI18239.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655363|dbj|BAI21290.1| cell division transpeptidase protein FtsI [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 672

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 192/602 (31%), Positives = 298/602 (49%), Gaps = 76/602 (12%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSM-- 107
           G DL  +  R  + H +  +G+    CL I+ ++AI++     I P       IAP +  
Sbjct: 18  GDDLRARAHRDQM-HVR-LLGVAGGFCL-IFAVVAIKLSIATVIRPMAPEKRQIAPQVPE 74

Query: 108 --NIDEYG----------MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQI 155
              ID  G          + R  I+DRNG+ LA  +P   +Y  P ++I P ++  KL+ 
Sbjct: 75  IPKIDPKGSLAGDFSLPQVHRASIVDRNGQTLALSLPVAQVYANPQELIDPKDVAHKLKS 134

Query: 156 VLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHAS 215
           +L +LD +    +LS   +F ++ R +SPQQ+  I + G+PG+ F   + R YP    A+
Sbjct: 135 ILKDLDEQETADRLSRPKQFVYIARNISPQQELAINNLGIPGIYFEPGERRHYPLGRMAA 194

Query: 216 HVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
            ++G VDID+ G+ GIEK+ D + L+          + +P+ L+LD+R+Q+ V +E+   
Sbjct: 195 QIMGTVDIDDHGVAGIEKYFDKRLLS----------DRRPLHLSLDIRVQSAVREEVANA 244

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
            + + A     ++++V TGE+I+MVS+PD+D +       +  FNR   G++E GS FK+
Sbjct: 245 MQTFQAIGACGIVMDVRTGEIIAMVSLPDFDANNFAHATNDERFNRAVTGLYEPGSTFKL 304

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTIPEIFRYSSNIGAAQI 393
            T AMG+++G   + D F +  P+ +G+  I D      +  LT+PE+  YSSN  AA I
Sbjct: 305 QTTAMGLETGTIHIWDRFSSV-PLHIGRFTIRDMKSDHFSPWLTLPEVMAYSSNPAAAHI 363

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTA 453
           A  +G +   E+L  +G  S +  ELPE   P  P QW     +T+ FGHG++  PL   
Sbjct: 364 ALDVGGKKQSEWLRSMGFFSPVPVELPEAARPLVPHQWGIATVMTVGFGHGVAEPPLAIV 423

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRI----------------------------- 484
              AA +N G L+ PT + +    +   S                               
Sbjct: 424 RGTAATVNGGILVTPTLLDKEDPANATASAPGISPQFASGIQNAALEQSVEDDTPSSAAD 483

Query: 485 ---------VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSD 534
                    +L +     +R LLR  VT G+GR A  PG+ VGGKTGTA+K+     Y  
Sbjct: 484 APVTPAGPRILSEKVSSLLRRLLRLDVTHGTGRTAESPGYFVGGKTGTAEKIGPHGGYLK 543

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGV 592
            +N ++F  +FP   P Y V   +DSPK   +     TAG N AP V  I+ R   ML +
Sbjct: 544 HVNISAFTGIFPMNSPHYAVYVMLDSPKPTPQTHGWTTAGWNAAPTVSKIVSRIGPMLQI 603

Query: 593 KP 594
            P
Sbjct: 604 FP 605


>gi|254511126|ref|ZP_05123193.1| penicillin-binding protein [Rhodobacteraceae bacterium KLH11]
 gi|221534837|gb|EEE37825.1| penicillin-binding protein [Rhodobacteraceae bacterium KLH11]
          Length = 543

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 165/511 (32%), Positives = 280/511 (54%), Gaps = 24/511 (4%)

Query: 101 EPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNL 160
           EP+A +       M R +I+DR G ILAT++ T+S+Y +P  +I P    E+L  + P+L
Sbjct: 25  EPLASAAGA-SIAMQRANIVDREGRILATNLDTYSVYAQPPLMIDPIAAAEQLVAIFPDL 83

Query: 161 DSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
           + E + +  +   KF W+++++SP+Q++ +   G PG+ F   + R YP    A+H++G 
Sbjct: 84  EKERLVKDFTGGRKFLWIKKRISPEQKQAVHDIGDPGILFGPREMRLYPNGRLAAHILGG 143

Query: 221 VDIDNRGITGIEKFLDMQGLTRVFTT---NKGEKNLQPIRLALDLRIQNIVHQELVENKK 277
                 G++  E  + + G+ + F     +    N +P++L+LDL +Q  V Q L    K
Sbjct: 144 SGFGREGVSAAE-VIGVAGVEKQFDEYLRDPANGN-KPLQLSLDLTVQAAVEQVLYGGMK 201

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIFEMG 330
             NA+    V++N  TGEV+S  S+P +DP++  +    G+       FNR   G++E+G
Sbjct: 202 IMNAKGASAVLMNAHTGEVVSAASLPSFDPNDRPRPPTSGFDPSDSPLFNRYVQGVYELG 261

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIG 389
           S+FK+FT A  +  GL     + DT  P+++G+  I +++ +N   +++ ++  +SSN G
Sbjct: 262 SVFKIFTAAQAVQLGLVNSNTIIDTSGPMRIGRFPIGEFNGKNYGEISVADVIVHSSNRG 321

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLST 447
             ++A  +G +  +EFL  LG+      E+ E +   P  P +W  + ++TIS+GHGLST
Sbjct: 322 TGRLALQIGGKRQQEFLQSLGMFDPTPFEIVEAKGGEPLKPKKWGELSTVTISYGHGLST 381

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSG 507
           +P+  A   AA+ N G  + PT +   R    +    V+ +NT K  +++LR+ VT G+ 
Sbjct: 382 SPMHLAAGYAAIANGGHYVSPTIL---RRNGPQYGPRVMSENTAKQAQNMLRKVVTDGTA 438

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
               V G++V GKTGTA K  K R  Y D     +F  +FP  DP+Y+++  +D P I  
Sbjct: 439 SFGDVAGYDVAGKTGTADKP-KPRGGYYDDKVIATFATIFPAYDPKYVLIVTLDEPSIVA 497

Query: 566 --RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               + TAG    P+   +I R A +LG++P
Sbjct: 498 YGEKRRTAGWTAVPVAAELIARIAPLLGLRP 528


>gi|56696074|ref|YP_166428.1| penicillin-binding protein [Ruegeria pomeroyi DSS-3]
 gi|56677811|gb|AAV94477.1| penicillin-binding protein [Ruegeria pomeroyi DSS-3]
          Length = 595

 Score =  290 bits (742), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 170/552 (30%), Positives = 293/552 (53%), Gaps = 24/552 (4%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSRP 117
            Q R R   A ++ R+ +  V     + ++  R+    +    EP+A S         R 
Sbjct: 37  MQDRSR---ARAEGRLLVLGVFFFCAFSVVGARMGMLASSEAQEPLA-SATGATIAAQRA 92

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
           DI+DR G +LAT+  T SLY +P  ++ P    E L  + P+LD + + R  S + KF W
Sbjct: 93  DIVDREGRLLATNFETHSLYAQPPLMVDPVAAAEGLVRIFPDLDKDRLVRDFSGKRKFIW 152

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           +++++SP+Q++ +   G PG+ F   + R YP    A+HV+G       G+   E  + +
Sbjct: 153 IKKRISPEQKQAVHDIGDPGLLFGPREMRLYPNGRLAAHVLGGAGFGREGVDAAE-VIGV 211

Query: 238 QGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
            G+ + F           +P++L+LDL +Q  + Q L    K  +A+    V+++V TGE
Sbjct: 212 AGVEKQFDGYLRDPANGAKPLQLSLDLTVQAAMEQVLDGGMKIMSAKGASAVLMDVHTGE 271

Query: 296 VISMVSIPDYDPHEAFKGKKEGW-------FNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           V++  S+P +DP++  +    G+       FNR   G++E+GS+FK+F  A  +D GL  
Sbjct: 272 VVAASSLPSFDPNDRPRPPTSGFDPSDSPLFNRYVQGVYELGSVFKIFAAAQAVDLGLVN 331

Query: 349 VKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
              + DT  P+++GK  I +++ +N   ++I ++  +SSN G  ++A  +G +  + FL 
Sbjct: 332 SDTIIDTSGPMRIGKFPIGEFNNKNYGKISIADVIVHSSNRGTGRLALQIGAERQQAFLN 391

Query: 408 RLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
            LG+      E+ E     P  P  W  + ++TIS+GHGLST+P+  A   AA+ N G+ 
Sbjct: 392 SLGMFDPTPFEIVEASGGQPLKPKTWGELSTVTISYGHGLSTSPMHLAAGYAAIANGGQY 451

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
           + PT +   +++  +    V+ +N  +  R++LR+ VT G+     VPG++VGGKTGTA 
Sbjct: 452 VSPTVL---KQKGPQYGPRVMSENAARQARAMLRKVVTSGTASFGEVPGYQVGGKTGTAD 508

Query: 526 KV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE--RNQLTAGINVAPMVGNI 582
           K   +  Y D     +F ++FP +DP+Y+++  +D P I      + TAG    P+   +
Sbjct: 509 KPKPRGGYYDDKVIATFASLFPASDPKYVLVVTLDEPSILAYGEKRRTAGWTAVPVAAEL 568

Query: 583 IRRSASMLGVKP 594
           I R A +LG++P
Sbjct: 569 IGRVAPLLGLRP 580


>gi|85703615|ref|ZP_01034719.1| penicillin-binding protein [Roseovarius sp. 217]
 gi|85672543|gb|EAQ27400.1| penicillin-binding protein [Roseovarius sp. 217]
          Length = 594

 Score =  290 bits (741), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 166/512 (32%), Positives = 278/512 (54%), Gaps = 24/512 (4%)

Query: 101 EPIAPSMNI--DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
           EP  P+ ++   +    R DI+DR G ILAT+  T SLY +P  ++ P    ++L  + P
Sbjct: 74  EPAEPATSVAGSQIFAQRADIVDREGRILATNFDTHSLYAQPQMMVDPGHAADRLVEIFP 133

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
           +L  E + +  +   KF W+++KLSP+Q++ +   G PG+ F   + R YP    A+HV+
Sbjct: 134 DLKRERLIKDFTGPRKFLWIKKKLSPEQKQAVHDIGEPGLLFGPREMRLYPNGRLAAHVL 193

Query: 219 GYVDIDNRGITGIEKFLDMQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENK 276
           G       G+   E  + + G+ R          +  +P+ L+LDL +Q  + + L    
Sbjct: 194 GGTSFGREGVHAAE-LVGVAGVERHQDARLRDPAQAHEPLVLSLDLSVQAAMERVLYGGM 252

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMG 330
           K  NA+    ++++  +GEV+++ S+PD+DP++       G       FNR   G++E+G
Sbjct: 253 KIMNAKGAAGILMDAKSGEVVAVASLPDFDPNDRPALPTSGSPSDSPLFNRAVQGVYELG 312

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA 390
           S FKVF IA  ++  L T   + +T++P++ GK  I D+      L++ ++   SSN+G 
Sbjct: 313 STFKVFPIAQAMELKLVTPDSIVNTKSPMQWGKFRIRDFKNYGPELSVTKVIVKSSNVGT 372

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTT 448
           A+IA  +G +  +EFL +LG +  ++ E+ E     P  P  W  + ++TIS+GHGLS +
Sbjct: 373 ARIAMEIGAKRQREFLDQLGFIDPVQLEIAEASGSTPLLPKNWSELSTMTISYGHGLSVS 432

Query: 449 PLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR 508
           P+  A   A + N GR + PT +   R+ +      V+ + T   MR +LR+ V+ G+  
Sbjct: 433 PMHLAAGYATIANGGRRVTPTLL---RDPTRAPGERVMSEATSAAMRKMLRQVVSEGTAS 489

Query: 509 RAFVPGFEVGGKTGTAQKVIKKR----YSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--K 562
              VPG+ VGGKTGTA K  K+R    Y D +  ++F ++FP  DP+Y+++  +D P   
Sbjct: 490 LGEVPGYAVGGKTGTADKP-KERGGGYYKDKV-ISTFASMFPAHDPKYVLVVTLDEPVET 547

Query: 563 IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
             +  + TAG    P+   IIRR A +LG++P
Sbjct: 548 SGDEPRRTAGWTAVPVAAEIIRRVAPLLGLRP 579


>gi|114798338|ref|YP_761707.1| putative penicillin-binding protein 2 [Hyphomonas neptunium ATCC
           15444]
 gi|114738512|gb|ABI76637.1| putative penicillin-binding protein 2 [Hyphomonas neptunium ATCC
           15444]
          Length = 547

 Score =  289 bits (739), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 171/503 (33%), Positives = 267/503 (53%), Gaps = 26/503 (5%)

Query: 102 PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD 161
           P+A S+       +R DI+DR+GE+LAT + ++SL+  P  +    +   +L  VLP+L 
Sbjct: 43  PVAASLE------TRADIVDRHGELLATSVVSWSLWANPSLIWDGADAARQLAGVLPDLS 96

Query: 162 SEMIRRKLSS-ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
              +  +LS  + KF W++R L+P+Q++ +++ GL G+ FR E  R YP    A  V+G+
Sbjct: 97  EADLGARLSDPDRKFVWVKRGLTPRQREHVVALGLEGLDFREEARRAYPRGVLAGQVLGF 156

Query: 221 VDIDNRGITGIEKFLD--MQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKK 278
            ++D +GI GIE   D  +QG               P+RL LD+  Q  +  EL      
Sbjct: 157 TNVDGKGIAGIELAHDEALQG------------GGDPVRLTLDIGAQAALEAELATAAMD 204

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKE--GWFNRISYGIFEMGSIFKVF 336
           Y+ +    ++++  +GE+  M S P +DP+ A     +     NR    ++E+GSIFK F
Sbjct: 205 YDMKGGAAILMDTRSGEIRGMASWPPFDPNRASDTPADDPARTNRAISAVYELGSIFKPF 264

Query: 337 TIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           TIA  ++ G  T +D F    P+ +    I D H   R   + +I   SSNIG  Q+  A
Sbjct: 265 TIAAALEVGAITPEDRFQVGQPLLIQGRRISDTHWFARDANVWKILSESSNIGTVQVNYA 324

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAA 456
           +G Q  ++FL R GL  +   +LP   AP  P ++  + + T+S+GHG+S TPL   +A 
Sbjct: 325 LGTQRQQQFLERAGLTRRAPIDLPGSAAPLMPERFDEVTAATVSYGHGISVTPLAFLLAF 384

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRI---VLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
           +A  N+G +I P  +    +  +  +     +  + T   +  ++R+ V  G+ RRA V 
Sbjct: 385 SAFGNDGLMIAPVLVEAGADAGDIAAPAPVRLFSEETTHLVTQMMRDTVLQGTARRADVA 444

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           G+ V GKTGTA+K I   Y+   N +SF AVFP   PQY ++  +D PK  E   +TA +
Sbjct: 445 GYRVAGKTGTAEKPIAGGYAKDRNVSSFAAVFPADSPQYALIVTLDEPKAIEDGTMTAAV 504

Query: 574 NVAPMVGNIIRRSASMLGVKPVF 596
           N AP+ G II R A +L V P F
Sbjct: 505 NAAPVAGRIIERVAPLLEVDPRF 527


>gi|254419149|ref|ZP_05032873.1| Penicillin-binding Protein dimerisation domain family
           [Brevundimonas sp. BAL3]
 gi|196185326|gb|EDX80302.1| Penicillin-binding Protein dimerisation domain family
           [Brevundimonas sp. BAL3]
          Length = 590

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 173/528 (32%), Positives = 268/528 (50%), Gaps = 18/528 (3%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           ++ RI + ++V   ++  LAI    Y  +  E        +   + R D+ DRNGE+LAT
Sbjct: 52  TRVRIFLILIVFSCVFAGLAIGA-SYKALFGEAGGRWAGANPDALVRGDLTDRNGELLAT 110

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           +I  + LY++P ++   D    +L+  LP L +  +RR L  + +   L   L+PQ++  
Sbjct: 111 NIVHYGLYLDPAEIWDRDLAFRQLRRALPRLQAARLRRVLDGDRRLIVLT-GLTPQEKAA 169

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           +    L GV F  E  R YP  + A H++G  D   +G++G E   + +          G
Sbjct: 170 VHDLALGGVTFEPEDRRAYPLGTSAVHLIGDADTGGQGVSGAELAFNDE------IRAAG 223

Query: 250 EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHE 309
           ++  +   L++DLR+Q ++  EL     K  A+    ++ +V TGEV+ M S P++    
Sbjct: 224 QRG-ESFPLSIDLRVQGVLENELAAAAVKNQAKGAVGIVTDVQTGEVLGMASWPNFSQSN 282

Query: 310 AFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDY 369
                     NR   G +EMGS+FK FT+A G+D+G   +  LFD     ++G   I D+
Sbjct: 283 RGAAPDGATLNRAVSGHYEMGSVFKTFTVAAGLDTGRADMNTLFDASQAFQIGDRKIKDF 342

Query: 370 HPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS 429
           H QNR++T+ E++ +SSNIG +Q+A  MG    +++  RLGLL     EL E   P  P 
Sbjct: 343 HAQNRVMTLEEVYLHSSNIGTSQLAVQMGPDTMRDYFRRLGLLDAAGIELKESARPVVPR 402

Query: 430 QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKN 489
           +W      ++SFG+G+  TP Q   A  AL N GR++P + + R      +  +IV ++ 
Sbjct: 403 RWDSSTLASLSFGYGIMITPAQMVQAMGALTNGGRMVPLS-LRRGGARGAQPHQIVTEE- 460

Query: 490 TVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD 549
           T + +  L+R  V  GSG  A  PG  VGGKTG+A K++  RY  +    SF AVFP   
Sbjct: 461 TSRAILELMRSNVVKGSGGFADAPGLRVGGKTGSANKLVNGRYDPSRALGSFAAVFPVDG 520

Query: 550 P----QYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
           P    +Y V   MD P    +   T     AP V N+  R A  LGV+
Sbjct: 521 PLEAKRYAVFILMDEPGTYPK---TGAYVAAPAVRNVADRIAGFLGVE 565


>gi|87199149|ref|YP_496406.1| peptidoglycan glycosyltransferase [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134830|gb|ABD25572.1| Peptidoglycan glycosyltransferase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 581

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 188/571 (32%), Positives = 295/571 (51%), Gaps = 32/571 (5%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
           N       +  G+      R++ +  +K R+ +   + L   +   +RI+Q G     P 
Sbjct: 2   NALTASAAIASGRVRLANVRQRSLVEAKVRVLVVAFLFLFAGVAALVRILQLGLFEDAPE 61

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHK--------VISPDEIIEKLQI 155
             S+  +     R +I DRNG  LA   P ++L+  P          V SP+E+ + L  
Sbjct: 62  RRSL-AEALLPPRGEITDRNGVPLARAFPAYALWYNPKAFGENGSPLVKSPEEVAKALLA 120

Query: 156 VLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHAS 215
           + P+ D   + ++L S+ K  +LR+++ P+   RI + G P + F  E  R+YP  S  +
Sbjct: 121 IFPDADYNDLLKRLKSD-KPSYLRQRVMPEDANRIFALGEPALEFPRENQRYYPQGSLGA 179

Query: 216 HVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVEN 275
           HV+GYVD +  G  G+E+ L+ Q L       +G    +P+ L++D+R Q  +  EL   
Sbjct: 180 HVLGYVDTEGHGHVGMEQVLEKQLLD---PAQRG----RPVALSIDMRAQGALEDELGRG 232

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
             +  A+    VIL+V TGEV+++ S+P ++P+ + +      FN+++  ++E+GS FK 
Sbjct: 233 MLETEAKGAAGVILDVDTGEVVALASLPSFNPNRSDQALNNLVFNKVTNQVYELGSTFKP 292

Query: 336 FTIAMGIDSGLFTVKDL---FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            +IA  ID+G+ T  DL   + +  P+ +G   I D H     L +PE   +SSNI  AQ
Sbjct: 293 LSIAAAIDAGVVT--DLSVRYPSDKPLAIGGFHIRDSHSFGASLNVPEALIHSSNIVTAQ 350

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP------SQWKRIHSLTISFGHGLS 446
           +AD +G    K+ +  LG+  +   ELP    P +P        W RI ++T+S+GHG++
Sbjct: 351 VADKLGGPALKKTMAALGMNERPYIELPARGFPLWPRGTNKNGDWARITTMTVSYGHGIA 410

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
            TPL  A A AAL+N G   P T   R   +  +  R V K +T   MR LLR  V  G+
Sbjct: 411 VTPLHLAAAYAALVNGGIWRPATLFKRDPSQIPE-GRRVYKASTSARMRQLLRMIVVDGT 469

Query: 507 GRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--I 563
           G+ A   GF VGGKTG+A+K   K  Y+ T    +F A FP   P+Y+V++ +D PK   
Sbjct: 470 GKSANAVGFRVGGKTGSAEKPGGKGGYNRTSLIATFAAAFPMDKPRYVVIAMLDEPKGTA 529

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               Q TA  N AP+VG ++ R   +LGV P
Sbjct: 530 ATSYQRTAAWNAAPIVGRVVPRIGPLLGVVP 560


>gi|71082738|ref|YP_265457.1| cell division protein FtsI [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71061851|gb|AAZ20854.1| cell division protein FtsI [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 558

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 182/571 (31%), Positives = 310/571 (54%), Gaps = 40/571 (7%)

Query: 47  QKGCHMEDGQDLFQKRRRKV-IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP 105
           +K   +E+ ++ F  ++ K  +    NRI     V LVI +I +I+++  G++  E    
Sbjct: 4   KKNIILEEYENEFSYKKSKTNLDIQFNRIAFIFFVFLVISVIYSIQLLHLGSLKEENTKE 63

Query: 106 SMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMI 165
              I++    R DI+DRNG  L   + +  + + P +VI   +++  LQ++ P+ + E I
Sbjct: 64  FSTINK--NYRADILDRNGNYLVKTVKSIDIGINPIEVIDKKKLLINLQLIFPDKNYEEI 121

Query: 166 RRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDN 225
            +KL  + KF +L +K+S    ++I+  G   +    + +R YP  +  SH++G +D DN
Sbjct: 122 TKKLE-KNKFFYLEKKISSDNYEKIMLLGDKSIKSEEKLTRIYPQKNLFSHIIGQIDDDN 180

Query: 226 RGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
           +GI+G+EK  +     ++  TNK      P++L +D  IQ ++ +ELV+ +  + ++   
Sbjct: 181 KGISGLEKSFN----EKLKQTNK------PLKLTVDTDIQFLIREELVKFQSIFRSKGST 230

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            +++NV+ GE+ISMVS PD+D ++  K     + NR + G++E+GS+FK FT+A G++ G
Sbjct: 231 AILMNVNNGEIISMVSYPDFDLNKREKIVDLNFINRATKGVYELGSVFKTFTVAAGLEEG 290

Query: 346 LF-TVKDLFDTRNPIKVGKHVIHDYHPQNRI---LTIPEIFRYSSNIGAAQIADAMGIQG 401
           L  T  +  +    ++ GK  I +Y   N+I   LT+ +I   S NIG+ +I   + I  
Sbjct: 291 LIDTDTEFLNLEKKLQCGKSSISEY--DNKIPSDLTVEQILIRSGNIGSVRIGQKLEIIK 348

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
            K FL ++G+LSK+  ++ E+  P  P +W +    T+SFGHG++TTPLQ A A A + N
Sbjct: 349 LKAFLEKIGILSKINFDIEEVGEP-IPFKWGKCKLATVSFGHGITTTPLQLAKAYAIISN 407

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV--PGFEVGG 519
            G  I P+ + +  ++ EK  RI+ K    + +  +LR+ V    G    V   G+EVGG
Sbjct: 408 GGFAIEPSLIKKELKDPEKERRII-KAGISEKINPILRKIVNTKEGTAGLVNIEGYEVGG 466

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE------RNQL---- 569
           KTGTAQK I   YS     N+F  +FPT+ P+Y+++  +D PK         +N+     
Sbjct: 467 KTGTAQKTIVGGYSKA-KVNTFAGIFPTSKPKYVLIVLLDEPKTSSDYVYEYKNKKGSYK 525

Query: 570 -----TAGINVAPMVGNIIRRSASMLGVKPV 595
                TAG     + G II +   +L  K +
Sbjct: 526 GTPFNTAGWTSVEVAGKIIEKIGPILATKHI 556


>gi|148261228|ref|YP_001235355.1| peptidoglycan glycosyltransferase [Acidiphilium cryptum JF-5]
 gi|146402909|gb|ABQ31436.1| peptidoglycan synthetase FtsI [Acidiphilium cryptum JF-5]
          Length = 646

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 166/501 (33%), Positives = 265/501 (52%), Gaps = 20/501 (3%)

Query: 105 PSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEM 164
           P ++       R  I+DRNG +LA  +P  SLY +P ++  P      L   +  LD   
Sbjct: 63  PDLSTRPLEPDRAAILDRNGRLLAVSLPGASLYADPRQIRHPWRDARALATKIAGLDVRS 122

Query: 165 IRRKLS-SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
             R+L      F ++ R L+  Q+  +   G+PG+ F+    R YP    A+H++G V  
Sbjct: 123 TARRLGMKHYGFVYISRHLTATQELAVNRLGIPGLYFQRTWQRHYPQGDLAAHILGGVTP 182

Query: 224 DNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G++G+E + D + L+         K  QP+RL++DLR++ IVH E+    + Y A  
Sbjct: 183 GQHGLSGVEAYYDKRLLS---------KPGQPLRLSIDLRVEAIVHHEVARAMRDYKARG 233

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              ++ ++S G +++MVS+PDY+ ++      +  F+R   G +E GS+ K+ T+   + 
Sbjct: 234 ACGIVESMS-GRIVAMVSLPDYNANDYHDAPADSLFDRCISGDYEPGSVMKLMTLPAALQ 292

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           SGL    D F+T +P+ +    I DY P +R L +P I  YSSNIGA++IA  +G +  +
Sbjct: 293 SGLMHYWDKFNTTHPLVMNGFAITDYEPVHRWLAMPSILAYSSNIGASRIATILGPKLQR 352

Query: 404 EFLYRLGLLSKLETELPEIQAPSY-PSQ-WKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
            +L ++G       ++   Q P + P+  WK + ++T+SFG+G++  PL    A  A +N
Sbjct: 353 AWLRKMGFFKPPPIQMTGAQPPIWHPADTWKLLTTMTVSFGNGIAMAPLTLVNAVVADVN 412

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKT 521
            G L  PT + R      +    V++    +TMR L+R  V  G+G  A V G+ VGGKT
Sbjct: 413 GGILFRPTLLARRPGAPPRTGVRVMRPGVSETMRRLMRGVVLSGTGVYARVKGYRVGGKT 472

Query: 522 GTAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ------LTAGIN 574
           GTAQ V +  RY + LN +SF+AVFP  DP+Y++   +  P+  ++         T G  
Sbjct: 473 GTAQVVGRDGRYRNHLNNSSFMAVFPADDPRYVIYVLVIHPRPTKKMAGFSHGFTTGGYV 532

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP VG II R   MLG+ P+
Sbjct: 533 AAPAVGRIIARIGPMLGIAPL 553


>gi|148284403|ref|YP_001248493.1| penicillin-binding protein [Orientia tsutsugamushi str. Boryong]
 gi|146739842|emb|CAM79766.1| penicillin-binding protein [Orientia tsutsugamushi str. Boryong]
          Length = 583

 Score =  285 bits (729), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 169/527 (32%), Positives = 288/527 (54%), Gaps = 10/527 (1%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIP 132
           RI   I+  LV ++++A RII+    + +    S N+  +   R +I+DRN  ILA ++ 
Sbjct: 40  RILFVILSFLVAFLVVAFRIIKLSTYNSQYSYCSRNM--HFKHRKEIVDRNNNILAVNLF 97

Query: 133 TFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILS 192
             S+     K+ SP+ ++++LQ V  +++ + +   L +   F  ++R L+P Q K++  
Sbjct: 98  APSIIARTKKISSPERLVKQLQYVFTDINGDKLLHALKNNKNFVVVKRHLTPTQHKQVYD 157

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKN 252
            G+PG+ F  +  R Y   +  SHV+GYV  D RG+ GIE +     L+   +  K E+ 
Sbjct: 158 LGIPGLDFEEDYKRVYTYGNLLSHVLGYVSTDMRGLAGIENYYH-NYLSNNDSQLKEEEL 216

Query: 253 LQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFK 312
            +P+ L++D+RIQ+IV +EL +  K ++A     ++ + + GE++++VS PD+DPH   K
Sbjct: 217 NKPLVLSIDIRIQDIVSKELDKTIKDFSAIGGVGIVADPNNGEILALVSKPDFDPHYPAK 276

Query: 313 GKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ 372
                 FN+ S G++E+GS+    TIA+G+D+   T+ + +D  +  K+    I DY   
Sbjct: 277 AVGRQLFNKASLGVYELGSVMHALTIAIGLDTQTITLNNTYDLTD-FKIDNFRIKDYKNF 335

Query: 373 NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQ 430
                +PEIF YSSNIG  QI   +G    K++   L L   L+ ELPE     Y   + 
Sbjct: 336 VGYYNVPEIFMYSSNIGIVQIGLDIGQFNLKKYFKLLALDKTLKIELPEKANSLYHANTS 395

Query: 431 WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNT 490
           W  I + TIS+G+G+S +PL    A   ++N G L P T + R+  ++  +S+ +L   T
Sbjct: 396 WNNITTATISYGYGISISPLHFVQAMIPIVNGGNLYPITLIKRTPNDN-LISQKILSSKT 454

Query: 491 VKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDP 550
            K + SLLR  V  G+ + + V G+ VGGK GTA+K+  ++Y      +SF+ ++P+  P
Sbjct: 455 SKELNSLLRLAVKHGTSKNSDVVGYLVGGKVGTAKKIKDRKYDSNSIRSSFIGIYPSIAP 514

Query: 551 QYIVLSFMDSPKIKERN-QLT--AGINVAPMVGNIIRRSASMLGVKP 594
           ++I+   +D PK      +LT  A   +      II +  ++ G++P
Sbjct: 515 KFIIYLMLDEPKSNNSTYELTNAAEHGITSAAAKIISKIGTLYGIQP 561


>gi|326404643|ref|YP_004284725.1| putative peptidoglycan synthase FtsI [Acidiphilium multivorum
           AIU301]
 gi|325051505|dbj|BAJ81843.1| putative peptidoglycan synthase FtsI [Acidiphilium multivorum
           AIU301]
          Length = 623

 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 166/501 (33%), Positives = 265/501 (52%), Gaps = 20/501 (3%)

Query: 105 PSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEM 164
           P ++       R  I+DRNG +LA  +P  SLY +P ++  P      L   +  LD   
Sbjct: 40  PDLSTRPLEPDRAAILDRNGRLLAVSLPGASLYADPRQIRHPWRDARALARKIAGLDVRS 99

Query: 165 IRRKLS-SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
             R+L      F ++ R L+  Q+  +   G+PG+ F+    R YP    A+H++G V  
Sbjct: 100 TARRLGMKHYGFVYISRHLTATQELAVNRLGIPGLYFQRTWQRHYPQGDLAAHILGGVTP 159

Query: 224 DNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G++G+E + D + L+         K  QP+RL++DLR++ IVH E+    + Y A  
Sbjct: 160 GQHGLSGVEAYYDKRLLS---------KPGQPLRLSIDLRVEAIVHHEVARAMRDYKARG 210

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              ++ ++S G +++MVS+PDY+ ++      +  F+R   G +E GS+ K+ T+   + 
Sbjct: 211 ACGIVESMS-GRIVAMVSLPDYNANDYHDAPADTLFDRCISGDYEPGSVMKLMTLPAALQ 269

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           SGL    D F+T +P+ +    I DY P +R L +P I  YSSNIGA++IA  +G +  +
Sbjct: 270 SGLMHYWDKFNTTHPLVMNGFAITDYEPVHRWLAMPSILAYSSNIGASRIATILGPKLQR 329

Query: 404 EFLYRLGLLSKLETELPEIQAPSY-PSQ-WKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
            +L ++G       ++   Q P + P+  WK + ++T+SFG+G++  PL    A  A +N
Sbjct: 330 AWLRKMGFFKPPPIQMTGAQPPIWHPADTWKLLTTMTVSFGNGIAMAPLTLVNAVVADVN 389

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKT 521
            G L  PT + R      +    V++    +TMR L+R  V  G+G  A V G+ VGGKT
Sbjct: 390 GGILFRPTLLARRPGAPPRTGVRVMRPGVSETMRRLMRGVVLSGTGVYARVKGYRVGGKT 449

Query: 522 GTAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ------LTAGIN 574
           GTAQ V +  RY + LN +SF+AVFP  DP+Y++   +  P+  ++         T G  
Sbjct: 450 GTAQVVGRDGRYRNHLNNSSFMAVFPADDPRYVIYVLVIHPRPTKKMAGFSHGFTTGGYV 509

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP VG II R   MLG+ P+
Sbjct: 510 AAPAVGRIIARIGPMLGIAPL 530


>gi|146276737|ref|YP_001166896.1| peptidoglycan glycosyltransferase [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554978|gb|ABP69591.1| Peptidoglycan glycosyltransferase [Rhodobacter sphaeroides ATCC
           17025]
          Length = 597

 Score =  284 bits (726), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 168/506 (33%), Positives = 270/506 (53%), Gaps = 41/506 (8%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI DR G ILAT++ T SLY  PH ++ P  +  +L ++ P L  E + ++ +   +F
Sbjct: 91  RGDITDRAGRILATNLLTHSLYAHPHDMVDPVRVARELAVIFPELKEEDLVKRFTDGRRF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI------- 228
            W+R+KLSP+Q +++   G PG+ F   + R YP    A+HV+G       G+       
Sbjct: 151 LWIRKKLSPEQMQQVHDIGDPGLLFGPREMRLYPNGRLAAHVLGGASFGAEGVHSAEVIG 210

Query: 229 -TGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
             GIEK LD +               +P+ L++DL IQ  + + L   K   NA+    +
Sbjct: 211 TAGIEKALDARLRDPAMAG-------EPLALSIDLTIQAAITEVLGAGKTMMNAKGAAAI 263

Query: 288 ILNVSTGEVISMVSIPDYDPHE-----AFKGKKEG---WFNRISYGIFEMGSIFKVFTIA 339
           ++   +GE+++M S+PD+DP++       K    G    FNR   G++E+GS FK+FT+A
Sbjct: 264 LMEARSGEILAMASLPDFDPNDRPAPLVEKTADPGDSPLFNRAVQGVYELGSTFKIFTVA 323

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVI-----HDYHPQNRILTIPEIFRYSSNIGAAQIA 394
             ++ GL   + L D   P++ G+ +I     H+Y P   +LT  ++   SSN+G A++A
Sbjct: 324 QAMELGLVNAQTLVDANAPMRWGRFLIKEFRNHNYGP---LLTATDVIVKSSNVGTARLA 380

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEI--QAPSYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +G    + FL  LG       EL E     P  P++W  I ++T S+GHGL+ +P+  
Sbjct: 381 LQIGGLRQQAFLKSLGFFDPTPIELIEAPYARPLVPAKWPEITTITTSYGHGLAASPMHL 440

Query: 453 AVAAAALINEGRLIPPTFMIR-SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
           A A  A+ N G ++ PT + + +R + E+  R  + ++++    S+LR+ VT G+     
Sbjct: 441 AAAYGAIANGGIMVRPTLVHQENRPQGERAMRPEVARDSL----SMLRQVVTRGTASYGD 496

Query: 512 VPGFEVGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ-- 568
           V G+EV GKTGTA K   +  Y      N+F A+FP +DPQY+++  +D P      Q  
Sbjct: 497 VVGYEVAGKTGTADKPNPRGGYHHDKVVNTFAAIFPASDPQYVLIVTLDEPVETSGPQPR 556

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
            TAG    P+   IIRR+A +LG++P
Sbjct: 557 RTAGYTAVPVAAEIIRRTAPLLGLRP 582


>gi|294012785|ref|YP_003546245.1| cell division protein FtsI [Sphingobium japonicum UT26S]
 gi|292676115|dbj|BAI97633.1| cell division protein FtsI [Sphingobium japonicum UT26S]
          Length = 566

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 181/544 (33%), Positives = 282/544 (51%), Gaps = 24/544 (4%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM--SRPD 118
           K+R  + A + NR+ + +++ + I  +L +R+   G             D  G   +R D
Sbjct: 15  KQRVDLTAIAHNRLMLLLILFMAITAVLILRLTWVGVF----AGNGRGGDAMGGLPARAD 70

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
           I+DRNG  LA  +  +S+ V P K+I  P E+  KL  + P+  +    +KL+    + +
Sbjct: 71  IVDRNGVPLARTMDAYSIAVRPSKLIGDPSELARKLHEIFPDEPAAAFYKKLTGR-GWAY 129

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV-DIDNRGITGIEKFLD 236
           LRR+  P++   + + G  G+ F  EK R YP  + A+HV+G+  + D +G  G+E   +
Sbjct: 130 LRRRALPEEVAAVNALGEIGIEFPREKERLYPQRTLAAHVMGFAPNADGKGGMGVEAAFN 189

Query: 237 MQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
            +       T+   +  QP  +++D R+Q  +  EL     +  A+    VIL+ ++GEV
Sbjct: 190 DR------LTDAAMRG-QPFAMSIDSRVQGALESELYAQLVQTRAKGASGVILDANSGEV 242

Query: 297 ISMVSIPDYDPH--EAFKGK---KEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VK 350
           I+M SIP +DP+  + + GK   +    N +    +E+GS FK  +IA  +D G+ T + 
Sbjct: 243 IAMASIPVFDPNKLQNYAGKSCSESPLCNHMVQARYELGSAFKPLSIAAAMDRGVVTSMS 302

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
             +D   P+ +    I D HP  R + +PEI  +SSNIG A+IAD MG +  +     L 
Sbjct: 303 KTYDATAPLGIAGFRIKDDHPLGRWINVPEILVHSSNIGTARIADQMGAEPLQHLFRELH 362

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
              +   EL E     +P+ W RI +LT+S+GHG++ TPL  A A AAL+N G   P T 
Sbjct: 363 FDQRAPIELNERAGTLWPANWGRITTLTVSYGHGIAVTPLHLASAYAALVNGGLWRPATL 422

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
                EE  +  R V    T   MR LLR  V  G+GR A   G+ VGGKTG+A+K  + 
Sbjct: 423 RKLKAEEVPE-GRRVFSAATSARMRQLLRMIVAAGTGRSADAKGYRVGGKTGSAEKPQEG 481

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASML 590
           RY+ T    +F + FP  +P+Y+VL  MD     +    TA    AP+V  ++ R+  ML
Sbjct: 482 RYNKTSLVTTFASAFPMDNPRYVVLVTMDE-ATGQYGLRTAAWTAAPVVKRVVERTGPML 540

Query: 591 GVKP 594
           GV P
Sbjct: 541 GVLP 544


>gi|260425976|ref|ZP_05779955.1| penicillin-binding protein [Citreicella sp. SE45]
 gi|260420468|gb|EEX13719.1| penicillin-binding protein [Citreicella sp. SE45]
          Length = 596

 Score =  283 bits (724), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 175/560 (31%), Positives = 288/560 (51%), Gaps = 34/560 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSRPD 118
           ++ R K    ++ R+ +   +    ++++  R+       P EP A +        SR D
Sbjct: 35  EQMRDKARVRAEGRLLVMGAMFFCAFVVIGARMGLLSATEPSEPRARATGASIIA-SRAD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I DR G +LAT++ T SLY  P ++I P    ++L+ + P+LD E + +  + E  KF W
Sbjct: 94  ITDRRGRLLATNMETHSLYAHPQQMIEPLRAAKELKAIFPDLDEERMVKDFTDEKRKFLW 153

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI--------T 229
           +R+K+SP+Q + +   G PG+ F   + R YP  + ASH++G       G+         
Sbjct: 154 VRKKISPEQMQAVHEIGEPGLLFGPREMRLYPNGAIASHILGGASFGREGVDSAEVVGTA 213

Query: 230 GIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
           GIEK+ D +            +   P+ L++DL IQ    + L    +  NA+   +V++
Sbjct: 214 GIEKYFDEE-------LRDPAREGAPLELSIDLTIQAATERVLDSGMRLMNAKGAASVLM 266

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGID 343
           +V TGE+++M S+PD+DP++  +    G       FNR   G++E+GS FK+   +  ++
Sbjct: 267 DVHTGEILAMASLPDFDPNDRPRPPTSGSPSDSPLFNRAVQGVYELGSAFKILAASQAME 326

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGH 402
            G+ T + + DTR P +VG H I ++   N   +++ E+   SSN G  +IA A+G +  
Sbjct: 327 LGIVTPETIIDTRPPFRVGGHAIGEFEGHNYGQISVEEVIMNSSNRGTGKIALAIGTERQ 386

Query: 403 KEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALI 460
           K+FL RLG    +  E+ E     P  P +W  + ++TIS+GHGLS TPL  A A AA+ 
Sbjct: 387 KDFLRRLGFFDPVPLEMVEAPGGKPLIPQRWTDLSTVTISYGHGLSATPLHLAAAYAAIA 446

Query: 461 NEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGK 520
           N G L+ PT +   + +       VL +      R +LR  V  G+     VPG+ VGGK
Sbjct: 447 NGGHLVKPTLL---KHKGISYGDTVLSEEVSANARHMLRRVVKEGTASFGDVPGYHVGGK 503

Query: 521 TGTAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVA 576
           TGTA K  +K   Y       +F ++FP   P+Y+++  +D P      + + TAG    
Sbjct: 504 TGTADKPREKGGGYYKDKTITTFASMFPAEAPKYVLIVTLDEPVETSGPKPRRTAGWTSV 563

Query: 577 PMVGNIIRRSASMLGVKPVF 596
           P+   +I R A +LG++P +
Sbjct: 564 PVAAEMIGRIAPLLGLRPDY 583


>gi|254452553|ref|ZP_05065990.1| penicillin-binding protein [Octadecabacter antarcticus 238]
 gi|198266959|gb|EDY91229.1| penicillin-binding protein [Octadecabacter antarcticus 238]
          Length = 593

 Score =  283 bits (723), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 179/550 (32%), Positives = 292/550 (53%), Gaps = 35/550 (6%)

Query: 69  HSKNRI-GMTIVVCLVIY---IILAIRI-IQYGNIHPEPIAPSMNIDEYGMSRPDIIDRN 123
           H +NR  G  +V+ +  +   +++  R+ +  G++  EPIA +      G  R DI+DRN
Sbjct: 40  HDRNRAEGRFLVMGIAFFCAFLVIGTRMGMLAGSVPEEPIAQASGSPIVG-QRSDIVDRN 98

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G +LAT++ T SLY +   +I P +    L  + P L+ + + +  + E +F W+RR++S
Sbjct: 99  GRVLATNLDTHSLYAQIPDMIDPAKAARDLAAIFPELEEDDLLKDFTGERRFLWIRREIS 158

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------GITGIEKFL 235
           P+Q + +   G PG+ F   + R YP  S A+H++G               G+ G+EK+ 
Sbjct: 159 PEQMQAVHDIGDPGLLFGPREMRLYPNGSVAAHILGGATYGREGVHSAEVIGVAGVEKYF 218

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
           D       F  +   +   P+ L++DL +Q    + L       +A+   +V+++V TGE
Sbjct: 219 DD------FLRDPANEG-APLELSIDLTVQAASERVLQGGMMLMSAKGASSVLMDVHTGE 271

Query: 296 VISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +ISMVS+PD+DP++  +   EG       FNR   G++E+GS+FK+F ++  I+ GL   
Sbjct: 272 IISMVSLPDFDPNDRPRILTEGDQSDSVLFNRALQGVYELGSVFKIFAVSQAIELGLIEA 331

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             + DT  P+  G+  I D+H     L+   +   SSNIG A+IA  +G    +EFL  L
Sbjct: 332 GTMIDTSGPLTWGRFRIRDFHDYGPELSAENVIVESSNIGTARIAMMIGADRQREFLGTL 391

Query: 410 GLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GLL +   E+ E     P  P+ W  I ++TIS+GHGLS++P+  A A A+L+N G  + 
Sbjct: 392 GLLLETPVEMVEAPTGDPLLPANWSEISTMTISYGHGLSSSPVHLATAYASLLNGGYRVE 451

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV 527
           PT +   R++  +    V+ +      R +LR  V  G+     V G+ VGGKTGTA K 
Sbjct: 452 PTIV---RQDGPRRGPRVVSEQVSAAARDMLRAVVVRGTASFGDVVGYNVGGKTGTADKP 508

Query: 528 -IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE--RNQLTAGINVAPMVGNIIR 584
                Y D     +F +VFP  DP+Y+++  +D P ++     + TAG    P+   +IR
Sbjct: 509 RPSGGYYDDRTIATFASVFPANDPRYVLIVTLDEPSVEALGEQRRTAGWTAVPVAAEMIR 568

Query: 585 RSASMLGVKP 594
           R A +LG++P
Sbjct: 569 RVAPLLGMRP 578


>gi|189184782|ref|YP_001938567.1| penicillin-binding protein PbpA2 [Orientia tsutsugamushi str.
           Ikeda]
 gi|189181553|dbj|BAG41333.1| penicillin-binding protein PbpA2 [Orientia tsutsugamushi str.
           Ikeda]
          Length = 583

 Score =  283 bits (723), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 170/527 (32%), Positives = 284/527 (53%), Gaps = 10/527 (1%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIP 132
           RI   I+  LV ++++A RII+    + +    S N+  +   R +I+DRN  ILA ++ 
Sbjct: 40  RILFVILSFLVAFLVVAFRIIKLSTYNSQYSHCSRNM--HFKHRKEIVDRNNNILAVNLF 97

Query: 133 TFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILS 192
             S+     K+ SP+ ++++LQ V  +++ + +   L +   F  ++R L+P Q K++  
Sbjct: 98  APSIIARTKKISSPEGLVKQLQYVFTDINGDKLLNALKNNKNFVVVKRHLTPTQHKQVYD 157

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKN 252
            G+PG+ F  +  R Y   +  SHV+GYV  D RG+ GIE +             + E N
Sbjct: 158 LGIPGLDFEEDYKRVYTYGNLLSHVLGYVSTDMRGLAGIENYYHNYLSNNDAQLKEAELN 217

Query: 253 LQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFK 312
            +P+ L++D+RIQ+IV +EL +  K +NA     +I + + GE++++VS PD+DPH   K
Sbjct: 218 -KPLVLSIDIRIQDIVSKELDKIIKDFNAIGGVGIIADPNNGEILALVSKPDFDPHYPAK 276

Query: 313 GKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ 372
                 FN+ S G++E+GS+    TIA+G+D+   T+ + +D  +  K+    I DY   
Sbjct: 277 AVGRQLFNKASLGVYELGSVMHALTIAIGLDTQTITLNNTYDLTD-FKIDNFRIKDYKNF 335

Query: 373 NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQ 430
               ++PEIF YSSNIG  QI   +G    K++   L L   L+ ELPE     Y   + 
Sbjct: 336 VGYYSVPEIFMYSSNIGIVQIGLDIGQFNLKKYFKLLALDKTLKIELPEKANSLYHANTS 395

Query: 431 WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNT 490
           W  I + TIS+G+G+S +PL    A   ++N G L P T + R+  ++    +I   K T
Sbjct: 396 WNNITTATISYGYGISISPLHFVQAMIPIVNGGNLYPITLIKRTPNDNLIAQKIFSSK-T 454

Query: 491 VKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDP 550
            K + SLLR  V  G+ + + V G+ VGGK GTA+K+  ++Y      +SF+ ++P+  P
Sbjct: 455 SKELNSLLRLAVKHGTSKNSDVVGYLVGGKVGTAKKIKDRKYDKNSIRSSFIGIYPSIAP 514

Query: 551 QYIVLSFMDSPKIKERN-QLT--AGINVAPMVGNIIRRSASMLGVKP 594
           ++I+   +D PK      +LT  A   +      II +  ++ G++P
Sbjct: 515 KFIIYLMLDEPKSNNSTYELTNAAEHGITSAAAKIISKIGTLYGIQP 561


>gi|254460573|ref|ZP_05073989.1| penicillin-binding protein [Rhodobacterales bacterium HTCC2083]
 gi|206677162|gb|EDZ41649.1| penicillin-binding protein [Rhodobacteraceae bacterium HTCC2083]
          Length = 594

 Score =  282 bits (722), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 174/558 (31%), Positives = 299/558 (53%), Gaps = 36/558 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-EPIAPSMNIDEYGMSRPD 118
           ++ R K    ++ R+ +  V+    + ++  R+       P EP A +         R D
Sbjct: 35  EQMRDKARTRAEGRLLILSVIFFCAFGVIGARMGVLAATEPSEPRAAAAG-SIIQAQRAD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I DR+G ILAT+  T +LY +P +++  + +  +L  + P+L  E + +  + + KF W+
Sbjct: 94  ITDRHGRILATNFETHALYAQPLQMVDKERVAAELAAIFPDLKQEKLLKDFTGKRKFLWI 153

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR--------GITG 230
           ++KLSP+Q++ + + G PG+ F   + R YP    A+HV+G               G+ G
Sbjct: 154 KKKLSPEQKQAVHNIGDPGLLFGPREMRLYPNGKLAAHVMGGASFGREGVHAAEVIGVAG 213

Query: 231 IEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +EK+ D++            ++  P+ L+LDL +Q    + L    K  NA+   +V+++
Sbjct: 214 VEKYFDVE-------LRDPARSGAPLALSLDLTVQAAAERVLYGGMKLMNAKGAASVLMD 266

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGIDS 344
           V TGE+IS+VS+PD+DP+       EG       FNR   G++E+GS +K+FT A  +D 
Sbjct: 267 VHTGEIISIVSLPDFDPNARPSPLIEGDASDSPLFNRAVQGVYELGSAYKIFTAAQAMDL 326

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
            L   + + DT   ++VG   I ++  +N  +L++ +I   SSN G  ++A  +G++  K
Sbjct: 327 NLVNHQTMIDTGKALRVGGFNIGEFKKKNYGVLSVADIIVKSSNRGTGRLALQIGVKRQK 386

Query: 404 EFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           EF+  +G +     E+ E +   P YP +W  + ++TIS+GHG+S +PL  A   AAL N
Sbjct: 387 EFMKLMGFMDYTPLEIVEAKGGKPLYPERWTDLSAVTISYGHGISNSPLHLAAGYAALAN 446

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKT 521
            G  I PT  I  R  + + +R V++++T +  R +LR+ VT G+     V G+ VGGKT
Sbjct: 447 GGTYIKPT--IVKRTGAPQGTR-VMREDTARYARQMLRKVVTEGTASFGEVQGYAVGGKT 503

Query: 522 GTAQKVIKKR---YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVA 576
           GTA K  K R   Y D +   +F ++FP  +P+Y+++  +D P     ++ + TAG    
Sbjct: 504 GTADKP-KPRGGYYKDKV-IATFASLFPAHNPKYVLVVTLDEPSETSGKKPRRTAGWTAV 561

Query: 577 PMVGNIIRRSASMLGVKP 594
           P+   +I R A +LG++P
Sbjct: 562 PVAAEMIGRVAPLLGLRP 579


>gi|91762840|ref|ZP_01264805.1| cell division protein FtsI [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718642|gb|EAS85292.1| cell division protein FtsI [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 560

 Score =  282 bits (721), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 180/571 (31%), Positives = 309/571 (54%), Gaps = 40/571 (7%)

Query: 47  QKGCHMEDGQDLFQKRRRKV-IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP 105
           +K   +E+ ++ F  ++ K  +    NRI     V LVI +I +I+++  G++  E    
Sbjct: 6   KKNIILEEYENEFSYKKSKTNLDIQFNRIAFIFFVFLVISVIYSIQLLHLGSLKEENSKE 65

Query: 106 SMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMI 165
              I++    R DI+DRNG  L   + +  + + P +VI   +++  LQ++ P+ + E I
Sbjct: 66  FSTINK--NYRADILDRNGNYLVKTVKSIDIGINPIEVIDKKKLLINLQLIFPDKNYEEI 123

Query: 166 RRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDN 225
            +KL  + KF +L +K+S    ++I+  G   +    + +R YP  +  SH++G +D DN
Sbjct: 124 TKKLE-KNKFFYLEKKISSDNYEKIMLLGDKSIKSEEKLTRIYPQKNLFSHIIGQIDDDN 182

Query: 226 RGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
           +GI+G+EK  +     ++  TN      +P++L +D  IQ ++ +ELV+ +  + ++   
Sbjct: 183 KGISGLEKSFN----EKLKQTN------EPLKLTVDTDIQFLIREELVKFQSIFRSKGST 232

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            +++NV+ GE+ISMVS PD+D ++        + NR + G++E+GS+FK FT+A G++ G
Sbjct: 233 AILMNVNNGEIISMVSYPDFDLNKRETIVDLNFINRATKGVYELGSVFKTFTVAAGLEEG 292

Query: 346 LF-TVKDLFDTRNPIKVGKHVIHDYHPQNRI---LTIPEIFRYSSNIGAAQIADAMGIQG 401
           L  T  +  +    ++ GK  I +Y   N+I   LT+ +I   S NIG+ +I   + I  
Sbjct: 293 LIDTDTEFLNLEKKLQCGKSSISEY--DNKIPSDLTVEQILIRSGNIGSVRIGQKLEIIK 350

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
            K FL ++G+LSK+  ++ E+  P  P +W +    T+SFGHG++TTPLQ A A A + N
Sbjct: 351 LKAFLEKIGILSKINFDIEEVGEP-IPFKWGKCKLATVSFGHGITTTPLQLAKAYAIISN 409

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV--PGFEVGG 519
            G  I P+ + +  ++ EK  RI+ K    + +  +LR+ V    G    V   G+EVGG
Sbjct: 410 GGFAIEPSLIKKELKDPEKERRII-KAGISEKINPILRKIVNTKEGTAGLVNIEGYEVGG 468

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE------RNQL---- 569
           KTGTAQK I   YS     N+F  +FPT+ P+Y+++  +D PK         +N+     
Sbjct: 469 KTGTAQKTIVGGYSKA-KVNTFAGIFPTSKPKYVLIVLLDEPKTSSDYVYEYKNKKGSYK 527

Query: 570 -----TAGINVAPMVGNIIRRSASMLGVKPV 595
                TAG     + G II +   +L  K +
Sbjct: 528 GTPFNTAGWTSVEVAGKIIEKIGPILATKHI 558


>gi|119383337|ref|YP_914393.1| peptidoglycan glycosyltransferase [Paracoccus denitrificans PD1222]
 gi|119373104|gb|ABL68697.1| Peptidoglycan glycosyltransferase [Paracoccus denitrificans PD1222]
          Length = 601

 Score =  281 bits (720), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 158/497 (31%), Positives = 266/497 (53%), Gaps = 26/497 (5%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI DR+G +LAT++ T SLY  P +++ P+    +L  + P+L+ E + +  + +  F
Sbjct: 91  RADITDRHGRVLATNLLTHSLYAHPQQMVEPERAARELVRIFPDLEVERLDKDFTGKRTF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W+++K+SP+Q + +   G PG+ F   + R YP    A+H++G        +   E  +
Sbjct: 151 VWIKKKISPEQMQAVHDIGEPGLLFGPREMRLYPNGHIAAHILGGATFGKEDVASAE-VV 209

Query: 236 DMQGLTRVFT------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            + G+ + F        N G     P+ L+LDL +Q  + + L    K  NA+    +++
Sbjct: 210 GVAGVEKAFDHWLRDPANDG----APLMLSLDLTVQAAMEEVLGNGMKVMNAKGATGILM 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEG------WFNRISYGIFEMGSIFKVFTIAMGID 343
            + TGE+++M S+PD+DP++  +   +G       FNR   G +E+GS FK+F +A  ID
Sbjct: 266 EIKTGEIVAMASLPDFDPNDRPRPLLKGDPSDSPLFNRAVQGQYELGSTFKIFPVAQAID 325

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGH 402
             L +   + + + P+K+GK++I+++   N   L++ +I   SSN+G  ++A  +G    
Sbjct: 326 LKLVSPTTMINAKAPMKIGKYLINEFRGHNYGTLSVTDIIVKSSNVGTVRVAQLLGPDRQ 385

Query: 403 KEFLYRLGLLSKLETELPEIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALI 460
           ++FL +LG       E+ E     P  P +W  + S T++FGHGL+ +PL  A A A + 
Sbjct: 386 RDFLQKLGFFDPTPIEMSEAPTGKPLVPKRWPAVTSATVAFGHGLAASPLHLATAYATVA 445

Query: 461 NEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGK 520
           N G+ + PT +    + S++    VL     +    +LR+ V  GSGR A V G+EV GK
Sbjct: 446 NGGKRVMPTLI---HDRSQRGGEQVLSPEAARIAVQMLRQVVVRGSGRSANVEGYEVAGK 502

Query: 521 TGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI--KERNQLTAGINVAP 577
           TGTA K      Y      ++F +VFP +DPQY+++  +D P          TAG   AP
Sbjct: 503 TGTADKPRPTGGYYGNKVVSTFASVFPASDPQYVLVLSLDEPSTIGAGGESRTAGATSAP 562

Query: 578 MVGNIIRRSASMLGVKP 594
           +   +IRR A +LG++P
Sbjct: 563 VAAEVIRRVAPLLGLRP 579


>gi|302383889|ref|YP_003819712.1| peptidoglycan glycosyltransferase [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194517|gb|ADL02089.1| Peptidoglycan glycosyltransferase [Brevundimonas subvibrioides ATCC
           15264]
          Length = 582

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 250/488 (51%), Gaps = 20/488 (4%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           + R D+ DRNG +LAT+I  + LY++P +V   D    +L+ VLP + +  +RR L  + 
Sbjct: 100 LQRGDLTDRNGALLATNIVHYGLYIDPSEVWDRDAAFTQLRRVLPRVPAARLRRVLDGDR 159

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE- 232
           +   L   L+P +++ + +  L G+ F  E  R YP  + A+H++G  D   +G++G E 
Sbjct: 160 RLIVLP-GLTPAERQAVHALALGGLSFEPEDRRVYPLNTSAAHLIGVADTGGQGVSGAEL 218

Query: 233 KFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
            F D              +  Q   L++DLR+Q ++  EL        A+    V+ +  
Sbjct: 219 AFND--------DIRAAGRQGQDFALSIDLRVQGVLENELNAVASAAGAKGAVGVVADAK 270

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++ M S P YD +       +   NR++ G +EMGS+FK FT+A  +D+G   +  +
Sbjct: 271 TGEILGMASWPTYDANRRGGATDDQALNRVTSGHYEMGSVFKTFTVAAALDTGQADMDTM 330

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            D      +G   I D+H  N++L++ E++ +SSNIG +++A  +G QG +++  RLGLL
Sbjct: 331 LDASQAYMIGNRRISDFHATNKVLSLEEVYLHSSNIGTSRLAVELGSQGMRDYFQRLGLL 390

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
           +    EL E   P  P  W      ++SFG+G+  TPLQ   A  AL+N G   P +   
Sbjct: 391 NAAPIELKESARPRLPRDWSDSTRASMSFGYGIMITPLQMTAATVALVNGGFYRPLSL-- 448

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
             R  +    R V++  T   +R L+R  V  GSG++A   G  VGGKTG+A K++  RY
Sbjct: 449 -RRGGTGVEGRRVIRPETSSEIRQLMRANVLRGSGKQADAAGLRVGGKTGSANKLVNGRY 507

Query: 533 SDTLNFNSFLAVFPTTDP----QYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
                  SF AVFP   P    +Y+V   +D P    R     G   AP+VG +  R A 
Sbjct: 508 DAGHGVGSFAAVFPADGPDDAQRYVVFVLIDEPSQGSR---LGGAIAAPVVGRVADRIAP 564

Query: 589 MLGVKPVF 596
            LG+   F
Sbjct: 565 FLGLARRF 572


>gi|94498179|ref|ZP_01304740.1| Peptidoglycan glycosyltransferase [Sphingomonas sp. SKA58]
 gi|94422309|gb|EAT07349.1| Peptidoglycan glycosyltransferase [Sphingomonas sp. SKA58]
          Length = 567

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 176/525 (33%), Positives = 275/525 (52%), Gaps = 26/525 (4%)

Query: 79  VVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYV 138
           +  ++I  +  + +  +G     P+ P      +  +R DI+DRNG  LA  +  +S+ V
Sbjct: 38  ITAILIGRLFWVGVFAHGTGGDGPLGP------FVPARADIVDRNGVPLARTMDAYSVSV 91

Query: 139 EPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPG 197
            P K+I  P E+  KL  + P+       +KL+ +  + +LRR+  P+Q   + + G  G
Sbjct: 92  RPSKLIGEPAELARKLHEIFPDEAEATFYKKLTGK-GWAYLRRRALPEQVAAVNALGEIG 150

Query: 198 VGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNL--QP 255
           + F  EK R YP  + A+HV+G+   +++G+ G+       G    F     +  L  +P
Sbjct: 151 IEFPREKERLYPQRTLAAHVLGFAP-NSKGVGGM-------GAEAAFNDRLIDPALRGKP 202

Query: 256 IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH--EAFKG 313
             L++D R+Q  +  EL     +  A+  G +IL+V+TGEVI+M SIP +DP+  + + G
Sbjct: 203 FALSIDSRVQGALESELYTQLVQTRAKGAGGIILDVNTGEVIAMASIPVFDPNKLQNYAG 262

Query: 314 KK---EGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRNPIKVGKHVIHDY 369
           K+       N +    +E+GS FK  +IA  +D+G+ T +   +D   P+ V    I D 
Sbjct: 263 KRCSESPLCNHMVQARYELGSAFKPLSIAAAMDAGVVTSMSKRYDATAPLAVAGFRIKDD 322

Query: 370 HPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS 429
           H   R + +PEI  +SSNIG A+IAD MG +  ++    L    +   E  E     +PS
Sbjct: 323 HSLGRWINVPEILVHSSNIGTARIADEMGAEPLQKLFRSLDFDQRAPIEFNERAGGLWPS 382

Query: 430 QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKN 489
            W RI S+T+S+GHG++ TPL  A A AAL+N G   P T   + R +     R V    
Sbjct: 383 SWGRITSMTVSYGHGIAVTPLHLATAYAALVNGGMWRPATVR-KLRPQDVPQGRRVFSAA 441

Query: 490 TVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD 549
           T   MR LLR  V+ G+GR A   GF VGGKTG+A+K  + RY+ T    +F + FP  +
Sbjct: 442 TSARMRQLLRMIVSAGTGRSADAKGFRVGGKTGSAEKPQEGRYNKTSLVTTFASAFPMDN 501

Query: 550 PQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           P+Y+V++ MD     +    TA    AP+V  +I R+  MLG+ P
Sbjct: 502 PRYVVVAIMDE-ATGQFGLRTAAWTAAPVVKRVIERTGPMLGIMP 545


>gi|148556854|ref|YP_001264436.1| peptidoglycan glycosyltransferase [Sphingomonas wittichii RW1]
 gi|148502044|gb|ABQ70298.1| Peptidoglycan glycosyltransferase [Sphingomonas wittichii RW1]
          Length = 579

 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 171/490 (34%), Positives = 265/490 (54%), Gaps = 19/490 (3%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISP-DEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           R DI DRNG +LA  I   SL + P +VI   D +  +L  + P    +  RR L    K
Sbjct: 69  RADITDRNGVVLAATIKGISLAIRPPRVIGDKDRLAVELARLFPGRSVDDYRRILHGRRK 128

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +L R  +P +   +   G P +    E  RFYP  + A+ V+GY+DI    ++G+E F
Sbjct: 129 FVYLERGATPAKIHAVRLLGEPAIEEVPEPKRFYPQGTMAAQVIGYMDIGGVPVSGMEAF 188

Query: 235 LDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
           LD     R+ +   G    QP+ L++D R+Q  +   +  + +KY A     V+L+V TG
Sbjct: 189 LD----KRLTSAANGG---QPVALSIDSRVQAALESAIRTSAEKYLAVGGAGVVLDVHTG 241

Query: 295 EVISMVSIPDYD-------PHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           EV++M S+P ++       P      + +  +NR    ++E+GS FKV T+A  I+ G+ 
Sbjct: 242 EVLAMASLPVFNSNAPGLVPVGNDPLRPDARYNRAVSSVYELGSTFKVVTMANAIEHGVI 301

Query: 348 T-VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T     +D   P++VG   I D HP+NR +++P+I  +SSNIG A+I++ +G +  + F 
Sbjct: 302 TDFGKRYDATAPLQVGAFRIKDDHPENRWMSVPDILIHSSNIGTARISEEIGPERTQAFF 361

Query: 407 YRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
            +LG    ++ EL     P +P  W R   +T+++GHG++ + +  A A AAL+N G L 
Sbjct: 362 RQLGFDRPVDLELGARGKPLWPGYWARTTVMTVAYGHGIAVSQMHLANAYAALVNGGILR 421

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQK 526
           P T +     ++ +  RIV ++ + + +R L+R  V  G+GR A +PG  VGGKTGTA+K
Sbjct: 422 PATMLKLPAGQAPQGKRIVSEQTSFR-IRQLMRLVVEEGTGRGANIPGLRVGGKTGTAEK 480

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK-IKERNQL-TAGINVAPMVGNIIR 584
            +  RY  +    +F A FP   P+Y+V+  MD PK I E     TA  N  P V N+I 
Sbjct: 481 NLNGRYIHSSLVTTFAAAFPMDAPRYVVVVTMDEPKGIPETYGFRTAAWNALPAVKNVIA 540

Query: 585 RSASMLGVKP 594
           R   +LGV P
Sbjct: 541 RIGPLLGVIP 550


>gi|103487371|ref|YP_616932.1| peptidoglycan glycosyltransferase [Sphingopyxis alaskensis RB2256]
 gi|98977448|gb|ABF53599.1| Peptidoglycan glycosyltransferase [Sphingopyxis alaskensis RB2256]
          Length = 562

 Score =  276 bits (707), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 170/538 (31%), Positives = 291/538 (54%), Gaps = 20/538 (3%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R++++  ++ R+ + +++    ++++++R++ +  +  +  A   +   +  +R DI+DR
Sbjct: 17  RQQILLTAQQRLMILMLLFAAAFLLVSMRLVYF--VLFDTSAGQRSAGAFIPARADIVDR 74

Query: 123 NGEILATDIPTFSLYVEPHKVISP-DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           NG  LA  I  +S+ V P K+++  + +  +L  + P++    +  KL+   +  ++RR+
Sbjct: 75  NGVPLARTIDGYSIRVVPSKLLNDRNYLAGELHRIFPDMSRADLLAKLTGP-RPTYIRRR 133

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
             P Q   + + G  G  F  EK R YP  + A+HV+G+ + +  G+TG+E   D + + 
Sbjct: 134 ALPDQVAAVNAIGDVGFDFPREKERLYPQLTLAAHVLGFTNAEGHGVTGVEGAFDQRLID 193

Query: 242 RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT--VILNVSTGEVISM 299
           +     +GE    P+ L++D R+Q ++  EL       N E++G   VIL+V TGEV +M
Sbjct: 194 KA---TRGE----PLALSIDARVQGVLESEL--GAAVANLEAIGGAGVILDVHTGEVAAM 244

Query: 300 VSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRNP 358
            S+P ++P++          N ++Y ++E+GS FK  +I   ID+G  T +   +D   P
Sbjct: 245 TSLPTFNPNKLTGSDPTTRRNAVTYNLYELGSTFKPLSIGAAIDNGTVTNMARRYDASAP 304

Query: 359 IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETE 418
           + +    I D HP  R   +PE    SSNI  A+IAD MG +  ++    L    + + E
Sbjct: 305 LPIAGFRIRDSHP-GRWYNVPETLIESSNIATARIADDMGREPLEKLFRALHFDQRPDIE 363

Query: 419 LPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           L E   P +P  W R+ ++T S+GHG++ TPL  A A AAL+N G +  P  +++  + +
Sbjct: 364 LKERAFPLWPKHWGRVTTMTTSYGHGIAVTPLHLASAYAALVNGG-IYRPATLLKLGDRA 422

Query: 479 EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNF 538
               R V K  T   MR LLR  V+ G+G++A  PGF VGGKTG+A+K     Y      
Sbjct: 423 PPQGRRVFKAATSARMRQLLRLIVSDGTGKQADAPGFRVGGKTGSAEKPGAGGYRRHSLV 482

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPK--IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           ++F A FP  +P+Y+V+  +D PK       Q TAG   AP+V  ++ R+  MLGV P
Sbjct: 483 STFAAAFPMDNPRYVVIVMIDEPKGNAYSSGQRTAGWTAAPVVRKVVTRAGPMLGVFP 540


>gi|307294502|ref|ZP_07574344.1| Peptidoglycan glycosyltransferase [Sphingobium chlorophenolicum
           L-1]
 gi|306878976|gb|EFN10194.1| Peptidoglycan glycosyltransferase [Sphingobium chlorophenolicum
           L-1]
          Length = 566

 Score =  276 bits (707), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 169/488 (34%), Positives = 259/488 (53%), Gaps = 18/488 (3%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           +R DI+DRNG  LA  +  +S+   P K+IS P ++  KL  + P+       +KL+ + 
Sbjct: 67  ARADIVDRNGVPLARTMDAYSIAARPSKLISDPADLARKLHEIFPDEPEAAFYKKLTGK- 125

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV-DIDNRGITGIE 232
            + +LRR+  P++   + + G  G+ F  EK R YP  + A+HV+G+  D D +G  G+E
Sbjct: 126 GWAYLRRRALPEEVAAVNALGEIGIEFPREKERLYPQRTLAAHVLGFAPDADGKGGMGVE 185

Query: 233 KFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
              + +       T+   +  QP  +++D R+Q  +  EL     +  A+    VIL+ +
Sbjct: 186 AAFNDR------LTDAALRG-QPFAMSIDSRVQGALESELYAQLVQTRAKGASGVILDAN 238

Query: 293 TGEVISMVSIPDYDPH--EAFKGK---KEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +GEVI+M SIP +DP+  + + GK   +    N +    +E+GS FK  +IA  +D G+ 
Sbjct: 239 SGEVIAMASIPVFDPNKLQNYAGKSCSESPLCNHMVQARYELGSAFKPLSIAAAMDRGVV 298

Query: 348 T-VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T +   +D   P+ +    I D HP  R + +PEI  +SSNIG A+IAD MG +  +   
Sbjct: 299 TSMSKTYDATAPLGIAGFRIKDDHPLGRWINVPEILVHSSNIGTARIADQMGAEPLQHLF 358

Query: 407 YRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
             L    +   EL E     +P+ W RI +LT+S+GHG++ TPL  A A AAL+N G   
Sbjct: 359 RELHFDQRAPIELNERAGTLWPANWGRITTLTVSYGHGIAVTPLHLASAYAALVNGGLWR 418

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQK 526
           P T      +E  +  R V    T   MR LLR  V  G+GR A   G+ VGGKTG+A+K
Sbjct: 419 PATLRKLKVDEVPE-GRRVFSAATSARMRQLLRMIVAAGTGRSADAKGYRVGGKTGSAEK 477

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
             + RY+ T    +F + FP  +P+Y+VL  MD     +    TA    AP+V  ++ R+
Sbjct: 478 PQEGRYNKTSLVTTFASAFPMDNPRYVVLVTMDE-ATGQYGLRTAAWTAAPVVKRVVERT 536

Query: 587 ASMLGVKP 594
             MLGV P
Sbjct: 537 GPMLGVLP 544


>gi|85707760|ref|ZP_01038826.1| penicillin-binding protein [Erythrobacter sp. NAP1]
 gi|85689294|gb|EAQ29297.1| penicillin-binding protein [Erythrobacter sp. NAP1]
          Length = 610

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 173/553 (31%), Positives = 287/553 (51%), Gaps = 33/553 (5%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDR 122
           R+ ++  ++ R+ + + +  V+ +I  +RI   G +   P   S+  +    SR +I DR
Sbjct: 51  RQSLLVTARLRLFIMVALLGVVAVISLLRIGYVGFVGAAPSQTSL-AEALLPSRGEITDR 109

Query: 123 NGEILATDIPTFSLYVEPHK--------VISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +G  LA   P ++L+  P          V  P ++   L  + P+LD +     L S  +
Sbjct: 110 HGTPLARTFPAYALWFNPRAMEDEGAPLVADPADVTASLMEIFPDLDEDRTLAILRS-AR 168

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
             +++R++ P+   R+   G   +    E  R YP  + A+H++GYV  ++      E+ 
Sbjct: 169 GGYIQRRILPEDANRVFGLGEIALEIPRESDRHYPQGALAAHILGYVQEND------ERR 222

Query: 235 LDMQ-GLTRVFTTNKGEKNL--QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           L+ Q G+ RV      +K L  +P+ L++DLR+Q  +  EL +     NA     ++L+V
Sbjct: 223 LEGQLGMERVLDEQLADKALRAEPVALSIDLRVQGALEDELSKGMLATNAIGAAGIVLDV 282

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGE+++M S+P ++P+ +   K    +NR +   +E+GS FK  T+A  ID+G+  V++
Sbjct: 283 DTGEIMAMASLPAFNPNLSDVHKSPNIYNRATNATYELGSTFKPITVAAAIDAGV--VRN 340

Query: 352 L---FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
           L   +D  +P+++  H   D  P+   LT+PE   YSSN    +IAD +G +  ++ +  
Sbjct: 341 LSAQWDA-SPVEMSGHTFRDLKPKGDTLTVPEALAYSSNTVTMRIADELGEERLRQTVID 399

Query: 409 LGLLSKLETELPEIQAPSYPSQ-----WKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           LG+  +   ELP    P +  +     W R+ ++ +S+GHGL+ TPL  A A AAL+N G
Sbjct: 400 LGMKERPVIELPARGKPQWAEERPNGTWSRLTNMVVSYGHGLAVTPLHLASAYAALVNGG 459

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
              P T   +    +    R V K +T   MR LLR     G+G+ A  PG+ VGGKTG+
Sbjct: 460 IWRPATLR-KIEPGAAPRGRRVFKASTSSRMRQLLRMISIYGTGQSADAPGYRVGGKTGS 518

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE--RNQLTAGINVAPMVGN 581
           A+K     Y  T   +SF A FP   P+Y+V++ +D PK  +  R Q TA    AP+V  
Sbjct: 519 AEKPGAGGYRQTALISSFAAAFPMDRPRYVVVTMLDEPKGTKAARGQRTAAFTAAPIVME 578

Query: 582 IIRRSASMLGVKP 594
           ++ R   MLGV+P
Sbjct: 579 LVPRIGPMLGVRP 591


>gi|77462650|ref|YP_352154.1| cell division protein FtsI/penicillin-binding protein 2
           [Rhodobacter sphaeroides 2.4.1]
 gi|126461543|ref|YP_001042657.1| peptidoglycan glycosyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332557532|ref|ZP_08411854.1| peptidoglycan glycosyltransferase [Rhodobacter sphaeroides WS8N]
 gi|77387068|gb|ABA78253.1| Cell division protein FtsI/penicillin-binding protein 2
           [Rhodobacter sphaeroides 2.4.1]
 gi|126103207|gb|ABN75885.1| Peptidoglycan glycosyltransferase [Rhodobacter sphaeroides ATCC
           17029]
 gi|332275244|gb|EGJ20559.1| peptidoglycan glycosyltransferase [Rhodobacter sphaeroides WS8N]
          Length = 597

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 162/508 (31%), Positives = 269/508 (52%), Gaps = 45/508 (8%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI DR+G ILAT++ T SLY  P  ++ P  +  +L  + P L  E + ++ +   +F
Sbjct: 91  RADITDRSGRILATNLLTHSLYAHPQDMVDPLRVARELAAIFPELKEEDLAKRFTDGRRF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI------- 228
            W+R+KLSP+Q +++   G PG+ F   + R YP    A+HV+G       G+       
Sbjct: 151 LWIRKKLSPEQMQQVHDIGDPGLLFGPREMRLYPNGRLAAHVLGGTSFGAEGVHSAEVIG 210

Query: 229 -TGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
             GIEK LD    TR+          +P++L++DL +Q  + + L    K  NA+    +
Sbjct: 211 TAGIEKALD----TRLRDPAAAG---EPLQLSIDLTVQAAITEVLGAGMKMMNAKGATAI 263

Query: 288 ILNVSTGEVISMVSIPDYDPHE---------AFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           ++   +GE++++ S+PD+DP++         A  G     FNR   G++E+GS FK+FT+
Sbjct: 264 LMEAHSGEILALASLPDFDPNDRPAPLVDRNADPGDSP-LFNRAVQGVYELGSTFKIFTV 322

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVI-----HDYHPQNRILTIPEIFRYSSNIGAAQI 393
           A  ++ GL   + + D   P++ G+ +I     H+Y P   +L++ ++   SSN+G A++
Sbjct: 323 AQAMELGLVNAQTIVDANAPMRWGRFLIKEFKNHNYGP---LLSVTDVIVKSSNVGVARL 379

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEI--QAPSYPSQWKRIHSLTISFGHGLSTTPLQ 451
           A  +G    + FL  LG       EL E     P  P++W  I ++T S+GHGL+ +PL 
Sbjct: 380 ALQIGGLRQQAFLKSLGFFDPTPVELVEAPYARPLVPAKWAEITTITTSYGHGLAASPLH 439

Query: 452 TAVAAAALINEGRLIPPTFM-IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
            A A   + N G  + PT +    R +  +  R  +  +++    ++LR+ VT G+    
Sbjct: 440 LAAAYGTIANGGITVKPTLLHGNDRPQGARAMRAEVAHDSL----AMLRQVVTRGTASYG 495

Query: 511 FVPGFEVGGKTGTAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
            V G+EV GKTGTA K   +   Y D +  N+F ++FP +DP+Y+++  +D P      Q
Sbjct: 496 DVEGYEVAGKTGTADKPNPRGGYYHDKV-VNTFASIFPASDPRYVLIVTLDEPVETSGPQ 554

Query: 569 --LTAGINVAPMVGNIIRRSASMLGVKP 594
              TAG    P+   IIRR+A +LG++P
Sbjct: 555 PRRTAGYTAVPVAAEIIRRTAPLLGLRP 582


>gi|329848186|ref|ZP_08263214.1| penicillin-binding protein 2 [Asticcacaulis biprosthecum C19]
 gi|328843249|gb|EGF92818.1| penicillin-binding protein 2 [Asticcacaulis biprosthecum C19]
          Length = 584

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 165/488 (33%), Positives = 250/488 (51%), Gaps = 20/488 (4%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDE--IIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  ++DRNG++LATD+  +SL+V+P  + S D   + + L  + PNL  E I +   S 
Sbjct: 83  ARAQLVDRNGQLLATDVNDYSLFVDPTDMTSEDRGMVRQALMQIFPNLPREDIAKVFGS- 141

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            K   L   L   +++RIL++GLPG+ F  +  R YP     +  +G       G++G E
Sbjct: 142 GKRMLLTNNLKAIERERILNYGLPGISFEAQLVRDYPLGETGAAYIGMTKRGGEGMSGAE 201

Query: 233 KFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
             L  +         +   N  P+ LA+DLR+Q  +  EL        AE    ++ NV 
Sbjct: 202 MALQDE-------IKQAALNNMPVALAMDLRVQGALENELRAVAIDQRAEDAIGIVTNVR 254

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE+I+M S P++D ++     ++   N  +   +E+GSIFK  ++ +G+D+G  ++  +
Sbjct: 255 TGEIIAMASWPEFDLNKPGAYTEQAKRNHAAVDRYELGSIFKAISVGIGLDTGTASMNSV 314

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           +D R P+ +    IHD H  N  + + ++F  SSNIG   +A   G      +   LGL 
Sbjct: 315 YDARQPLVISGRKIHDDHAVNAFIGLEDVFIKSSNIGTGHLAMTAGAGNFTRYYEALGLF 374

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
              +TEL E  AP YP +W  +  +  +FG G++ TPL  A A   L+N G   P T  I
Sbjct: 375 RSADTELTEPAAPLYPKKWTDLSLVQTAFGQGMAITPLSFAEAIGGLLNGGYRRPLT--I 432

Query: 473 RSREESEKVSRI-VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKR 531
           +  + +  ++   V    T +TM  L+R  V  G+G RA  PG  VGGKTGTAQK    R
Sbjct: 433 KKYDGTSPIAGTRVFSAATSRTMLDLMRANVIKGTGSRANAPGLRVGGKTGTAQKPENGR 492

Query: 532 YSDTLNFNSFLAVFPTTDP----QYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRR 585
           Y      +SF AVFPT  P    +Y+VL   DSP+    +    T G   AP+ G +I R
Sbjct: 493 YGSN-RISSFAAVFPTDGPLDGDRYLVLVIFDSPQGGPSSSGLKTGGFVAAPVAGRVIDR 551

Query: 586 SASMLGVK 593
            A  LGV+
Sbjct: 552 VAPFLGVQ 559


>gi|221638507|ref|YP_002524769.1| peptidoglycan glycosyltransferase [Rhodobacter sphaeroides KD131]
 gi|221159288|gb|ACM00268.1| Peptidoglycan glycosyltransferase [Rhodobacter sphaeroides KD131]
          Length = 597

 Score =  269 bits (688), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 162/508 (31%), Positives = 267/508 (52%), Gaps = 45/508 (8%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI DR+G ILAT++ T SLY  P  ++ P  +  +L  + P L  E + ++ +   +F
Sbjct: 91  RADITDRSGRILATNLLTHSLYAHPQDMVDPLRVARELAAIFPELKEEDLAKRFTDGRRF 150

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI------- 228
            W+R+KLSP+Q +++   G PG+ F   + R YP    A+HV+G       G+       
Sbjct: 151 LWIRKKLSPEQMQQVHDIGDPGLLFGPREMRLYPNGRLAAHVLGGTSFGAEGVHSAEVIG 210

Query: 229 -TGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
             GIEK LD    TR+          +P++L++DL +Q  + + L    K  NA+    +
Sbjct: 211 TAGIEKALD----TRLRDPAAAG---EPLQLSIDLTVQAAITEVLGAGMKMMNAKGATAI 263

Query: 288 ILNVSTGEVISMVSIPDYDPHE---------AFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           ++   +GE++++ S+PD+DP++         A  G     FNR   G++E+GS FK+FT+
Sbjct: 264 LMEAHSGEILALASLPDFDPNDRPAPLVDRNADPGDSP-LFNRAVQGVYELGSTFKIFTV 322

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVI-----HDYHPQNRILTIPEIFRYSSNIGAAQI 393
           A  ++ GL   + + D   P++ G+ +I     H+Y P   +L++ ++   SSN+G A++
Sbjct: 323 AQAMELGLVNPQTIVDADAPMRWGRFLIKEFKNHNYGP---LLSVTDVIVKSSNVGVARL 379

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEI--QAPSYPSQWKRIHSLTISFGHGLSTTPLQ 451
           A  +G    + FL  LG       EL E     P  P++W  I ++T S+GHGL+ +P+ 
Sbjct: 380 ALQIGGLRQQAFLRSLGFFDPTPVELVEAPYARPLVPAKWAEITTITTSYGHGLAASPMH 439

Query: 452 TAVAAAALINEGRLIPPTFM-IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
            A A   + N G  + PT +    R +  +  R  +  + +    S+LR+ VT G+    
Sbjct: 440 LAAAYGTIANGGITVKPTLLHGNERPQGTRAMRAEVAHDAL----SMLRQVVTRGTASYG 495

Query: 511 FVPGFEVGGKTGTAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
            V G+EV GKTGTA K   +   Y D +  N+F  +FP +DP+Y+++  +D P      Q
Sbjct: 496 DVEGYEVAGKTGTADKPNPRGGYYHDKV-VNTFATIFPASDPRYVLIVTLDEPVETSGPQ 554

Query: 569 --LTAGINVAPMVGNIIRRSASMLGVKP 594
              TAG    P+   IIRR+A +LG++P
Sbjct: 555 PRRTAGYTAVPVAAEIIRRTAPLLGLRP 582


>gi|225631336|ref|ZP_03788009.1| penicillin-binding protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590970|gb|EEH12179.1| penicillin-binding protein [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 614

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/343 (41%), Positives = 208/343 (60%), Gaps = 10/343 (2%)

Query: 254 QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKG 313
           Q ++L+LD R+Q+IVH+EL +   +Y A     ++LNV   EVISMVS+PD++P+   K 
Sbjct: 278 QYVQLSLDTRVQSIVHEELTKAVSRYQALGGVGIVLNVRNSEVISMVSLPDFNPNLQNKA 337

Query: 314 KKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQN 373
           +    FNR S G++EMGS+ K FTIA  +D+      DL+D   PI +GK+ I D+H ++
Sbjct: 338 EDVQKFNRASLGVYEMGSVLKYFTIAAALDANATKTSDLYDVSTPITIGKYKIQDFH-KS 396

Query: 374 RI--LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW 431
           +I  +T+ +IF  SSNIGAA+IA  +GI+   E+   + L S L+ E+PE   P  P +W
Sbjct: 397 KIPKITVQDIFVKSSNIGAAKIAVKLGIEKQVEYFKAMKLFSPLKIEIPEKSTPIIPDKW 456

Query: 432 KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTV 491
                +T S+G+G++ TP+  A  AAALIN G     T M+  R   E+    ++ + T 
Sbjct: 457 SENTLITASYGYGIAVTPIHLAQTAAALINNGIFHNATLMLNKRSIGEQ----IISRKTS 512

Query: 492 KTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ 551
           + MR LLR  VT G+GR+A +  + +GGKTG+A+KV+  +YS   N  SF+ V    DP+
Sbjct: 513 REMRKLLRAAVTDGTGRKAKIKAYSIGGKTGSAEKVVDGKYSKDANIASFIGVLTMLDPR 572

Query: 552 YIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           YIVL  +D P+       T G+  AP+V NII R A +L V P
Sbjct: 573 YIVLIAIDEPQGMHH---TGGVIAAPIVRNIINRVAPILNVTP 612



 Score =  115 bits (287), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 82/120 (68%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           +PDI+DRNG ++AT++PT SLY++  KV +P+ I  +L   L +L+ + + R L+SE KF
Sbjct: 52  QPDILDRNGVVIATNVPTTSLYIDATKVKNPESIAAQLCSTLHDLEYKNLYRVLTSEKKF 111

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R L+P++   I + G+PGV F  +  R YP ++  SHV+GY DID  GI G+E ++
Sbjct: 112 AWIKRHLTPKELLAIKNAGVPGVNFYDDIKRIYPHSNLFSHVLGYTDIDGNGIAGVEAYI 171


>gi|85373180|ref|YP_457242.1| penicillin-binding protein [Erythrobacter litoralis HTCC2594]
 gi|84786263|gb|ABC62445.1| penicillin-binding protein [Erythrobacter litoralis HTCC2594]
          Length = 585

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 169/506 (33%), Positives = 269/506 (53%), Gaps = 40/506 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHK--------VISPDEIIEKLQIVLPNLDSEMIRR 167
           R +I DRNG  LA + P  +L+  P          V SPD+++ +L  + P+L+ + +R+
Sbjct: 73  RGEITDRNGIALARNYPARALWFNPDALGEGEESLVKSPDKVVAELLAIFPDLEQDRVRK 132

Query: 168 KLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
            L+S T   +LRR++ P++  R+   G   +    E  R YP     +HV+GYVD D  G
Sbjct: 133 MLASGTA-GYLRRRVLPEEANRVFDIGEVALELPQETDRHYPQGMLGAHVLGYVDSDGGG 191

Query: 228 ITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
             G+E+ LD +    V    +GE +     L+LD+R+Q  +  EL +     NA     +
Sbjct: 192 KVGMEQVLDDRLSNPVL---RGEAS----SLSLDIRVQGALEDELRKGMLSVNAMGAAGI 244

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGK---------KEG----WFNRISYGIFEMGSIFK 334
           +L+V TGE++++ S+P++DP+ A KG+         K G     FNR++  ++E+GS FK
Sbjct: 245 VLDVDTGEILALASLPEFDPN-AVKGEDLIVSDAAYKRGEIPRAFNRVTNQVYELGSTFK 303

Query: 335 VFTIAMGIDSGLFTVKDL---FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
             T+A  ID+G  TV+D    +D    + +    I D H     L IP++  +SSN   A
Sbjct: 304 PLTVAAAIDAG--TVRDFGKRYDASG-VAIDGFTIRDSHDLGASLNIPQMLIHSSNTVTA 360

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY-PSQWKRIHSLTISFGHGLSTTPL 450
           +++D +G    ++    LG+  +   ELP    P +  S+W R+ ++ + FGHG++ TPL
Sbjct: 361 RVSDELGEAKLRQTFEDLGMHERPYIELPARGHPLWQTSKWGRLKTMNVGFGHGIAVTPL 420

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
             A A AA++N G   P T   R         R V K++T   MR LLR     G+G+ A
Sbjct: 421 HLASAYAAMVNGGIWRPATLH-RIEPGMAPKGRRVFKESTSSRMRQLLRMIALYGTGKNA 479

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN--Q 568
              G+ VGGKTG+A+K     Y      ++F AVFP  +P+++V++ +D PK    +  Q
Sbjct: 480 DAAGYRVGGKTGSAEKPGVGGYRRKSLVSTFAAVFPMDNPRFVVIAMLDEPKGTTASSFQ 539

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
            TA  N AP+VG ++ R   +LGV+P
Sbjct: 540 RTAAWNAAPIVGKLVPRIGPILGVRP 565


>gi|304321490|ref|YP_003855133.1| hypothetical protein PB2503_09694 [Parvularcula bermudensis
           HTCC2503]
 gi|303300392|gb|ADM09991.1| hypothetical protein PB2503_09694 [Parvularcula bermudensis
           HTCC2503]
          Length = 562

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/481 (32%), Positives = 248/481 (51%), Gaps = 17/481 (3%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I+DR G  LA +     L V+  +V  P+EI  +L  + P+LD+  +  +L+   ++  L
Sbjct: 60  IVDRVGRPLAMNTNLIGLAVDGREVTDPEEIAARLLPLFPDLDTARLTSRLA-RGRYVHL 118

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
              ++ ++++ +++ GLPGV F   + R YP  S A+H+VGY      G  G EK LD  
Sbjct: 119 FNAITDKERQAVIALGLPGVRFPESQGRAYPQKSLAAHIVGYRIPGEGGAVGAEKALDAG 178

Query: 239 GLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVIS 298
            L+            +P+ L++DL  Q I+ +EL    + ++ ++   V+L+V TG+V +
Sbjct: 179 SLS--------PGGREPVALSIDLVAQQILEEELARALETFSGKAAWGVLLDVHTGQVRA 230

Query: 299 MVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNP 358
           + ++P ++P+         W NR     +E+GS FK  T+A   D+G+    + FD   P
Sbjct: 231 LANLPTFNPNRPGAFPAASWRNRAMSDRYELGSAFKPLTVAAAFDAGVIAPSETFDVATP 290

Query: 359 IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETE 418
           +++G   I DY  +   +T  EI +YSSNIG  +I   +G     + L  L L S L TE
Sbjct: 291 LEIGGWEIDDYSRKKPFMTPAEIVQYSSNIGTIRIVQRLGTARFTQMLEALNLSSPLFTE 350

Query: 419 LPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           LPE + P+  ++W+     + S+GHG++ +PLQ   A AA++N G    PTF+     E+
Sbjct: 351 LPEARDPALSTEWRPSELASSSYGHGIAVSPLQLTAAFAAVVNGGVYRTPTFL----NEA 406

Query: 479 EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN- 537
               R + +  T K M+ +LR  VT G+ R A  PG+   GKT TA K +   Y D    
Sbjct: 407 TVPGRRIFRPETSKRMKLILRRTVTDGTARNARAPGYYPIGKTATADKPVAGGYRDEGGQ 466

Query: 538 -FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--LTAGINVAPMVGNIIRRSASMLGVKP 594
             +SF+  FP  DPQY++L  +D PK         TAG   AP    I+ R A  L + P
Sbjct: 467 LISSFIGAFPGYDPQYVLLVSVDEPKGTRETYGFATAGYVAAPAFSRIVERVAPTLDIMP 526

Query: 595 V 595
            
Sbjct: 527 A 527


>gi|114773349|ref|ZP_01450553.1| penicillin-binding protein [alpha proteobacterium HTCC2255]
 gi|114546283|gb|EAU49194.1| penicillin-binding protein [alpha proteobacterium HTCC2255]
          Length = 596

 Score =  263 bits (671), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 160/497 (32%), Positives = 267/497 (53%), Gaps = 22/497 (4%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS-ETK 174
           R +I+DRNG ILAT++ T +LY +P  +I+P +  + L  + P+L+ E + R  +S + K
Sbjct: 91  RANIVDRNGNILATNMSTQALYAQPPLMINPKKAADDLLRIFPDLNQERVVRNFTSGKRK 150

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F W+++ +SP+QQ+++   G PG+ F   + R YP    A+H++G       G+   E  
Sbjct: 151 FVWVKKSVSPEQQQQVHDLGEPGLLFGNREIRLYPNGKLAAHILGGTRFGEEGVKAAE-I 209

Query: 235 LDMQGLTRVFTTNKGEKNLQ--PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           + + G+ + F     +  L+  P+ L++DL  Q    Q L +  +  NA+    ++++V 
Sbjct: 210 VGVGGVEKYFDDMLRDPALEGKPLELSIDLTAQAATRQVLKDGMRYMNAKGASAILMDVH 269

Query: 293 TGEVISMVSIPDYDPH----EAFKGKKEG--WFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           TGE+IS+VS+PD+DP+    EA  G       FNR + G++E+GS FK+FT A  ++ GL
Sbjct: 270 TGEIISLVSLPDFDPNNRPREAVSGDPSDNPLFNRAAQGLYELGSTFKIFTAATSLEKGL 329

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
              K + DT  P +  K   +DY       ++ ++   SSN G  ++A A G    K+ L
Sbjct: 330 ANPKTIIDT-TPFRWNKKNYNDYRDYGLTNSVEDVIMKSSNTGTIRMALAAGSAAQKKTL 388

Query: 407 YRLGLLSKLETELPEI--QAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
             LG    L  EL E     P  P  W    ++TIS+GHG+S TP+  A A + + N G 
Sbjct: 389 KDLGFFKSLPIELVEASRSKPLIPKNWSDSSTITISYGHGISATPMHLASAYSIIANGGF 448

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTG 522
            + PT   +    ++K    V+   T + + S+LR  V+   G+     V G++V GKTG
Sbjct: 449 KVLPTLKKQIPTNAKKEQ--VISTKTSEQLTSMLRRVVSENDGTATMGNVYGYQVAGKTG 506

Query: 523 TAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK--ERNQLTAGINVAPM 578
           TA K+      Y D +   +F ++FP ++P+Y ++  +D P+I+   + + TAG    P+
Sbjct: 507 TADKIKPSGGYYKDKV-MTTFASIFPASNPKYTLIVTLDEPEIEVLGKRKRTAGFTAVPV 565

Query: 579 VGNIIRRSASMLGVKPV 595
              II R A +L ++P+
Sbjct: 566 AAEIISRVAPILNLRPI 582


>gi|258404868|ref|YP_003197610.1| Peptidoglycan glycosyltransferase [Desulfohalobium retbaense DSM
           5692]
 gi|257797095|gb|ACV68032.1| Peptidoglycan glycosyltransferase [Desulfohalobium retbaense DSM
           5692]
          Length = 645

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 171/562 (30%), Positives = 274/562 (48%), Gaps = 52/562 (9%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQ--YGNIHPEPIAPSMNIDEYGMS---- 115
           +RRK    +K RI   ++V +V ++ L     +  +  I+  P   +   D+Y       
Sbjct: 3   QRRKQRDWTKVRI---VLVGIVFFLALGALWARAFWVQIYKGPALAAQARDQYWTEQTVR 59

Query: 116 --RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
             R +I+DR G +LA  +   S++  P K+  P E+   L  +L  +D+  + R L S +
Sbjct: 60  GLRGEIVDREGRLLAQSVAAQSVFARPQKIAKPKEVAAHLAPIL-RVDTAKLERSLRSTS 118

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F WL RK+     K +    LPG+    E+ R+YP    A  ++G+  +DN G+ G+EK
Sbjct: 119 SFVWLARKIGDPMAKAVAEAQLPGIFLTEEQDRYYPQGHLAGQMLGFTGVDNNGLEGVEK 178

Query: 234 ----------------------FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQE 271
                                  LD QGL       KG    Q +RL LD  +Q +V + 
Sbjct: 179 TFEDRLKGRSLKIRMQRDATGRLLDGQGLDPALA--KG----QDVRLTLDTWLQGVVEES 232

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG-WFNRISYGIFEMG 330
           L +  KKY      ++ ++V TGE+++    P ++P+E F+G +   W NR +  +FE G
Sbjct: 233 LSKVVKKYEGRYGTSLAIHVPTGEILAWAQYPFFNPNE-FQGSRAAVWRNRPALDVFEPG 291

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           S  K   +A  ++ G+    D F   N   +   H   D H     LT+ EI +YSSNIG
Sbjct: 292 STIKPLLVAAALEEGVCAPADTFSCENGRWRRWGHTFKDTHAYKE-LTVSEIVKYSSNIG 350

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLST 447
           AA+I   +G+  +  +L RLG        LP   +     P +W+++   T SFG G+  
Sbjct: 351 AAKIGLDLGVARYYRYLRRLGFGEPTGLPLPGEGSGILPEPGKWRQVRLATSSFGQGIGV 410

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGS 506
           T LQ A A   L N+G  I P  ++ S E S   SR V  ++T +T++ ++R+ V + G+
Sbjct: 411 TMLQLAQAYLCLANDGVRI-PLRLVHSPETSSTASRQVFSRSTARTVQEMMRQVVESNGT 469

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G RA V G  VGGKTGT+QK   +         +F+  FP   P+Y++++ +D P+   R
Sbjct: 470 GTRARVSGLTVGGKTGTSQKASPQGGYGNTYVAAFVGFFPAISPEYMIVTLVDEPR---R 526

Query: 567 NQLTAGINVAPMVGNIIRRSAS 588
           N    G+  AP+V  + ++ A+
Sbjct: 527 NHY-GGVVAAPVVREVAQKMAA 547


>gi|330813727|ref|YP_004357966.1| cell division protein FtsI [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486822|gb|AEA81227.1| cell division protein FtsI [Candidatus Pelagibacter sp. IMCC9063]
          Length = 560

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 160/523 (30%), Positives = 280/523 (53%), Gaps = 29/523 (5%)

Query: 89  AIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDE 148
            +R++  G    +  A + N +     R DI+D  G ILA +I TF L +  +KV + D 
Sbjct: 42  CLRLVFLG-FERKAFAGTKNYEGLFYERRDIVDNQGSILAKNINTFDLVLRKNKVKNFDN 100

Query: 149 IIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFY 208
           ++ K+++  P ++ + I+     +     L++ LSP    +I++ G P +     + R Y
Sbjct: 101 VLLKVKLNFPEVNIKYIKSNYKEKNTLV-LKKNLSPSDYNKIINLGEPSLELFKREIRIY 159

Query: 209 PAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIV 268
           P  +  +H++G  D DN GI+GIE  +D +        +K + N+ P+ L+L+  IQ  +
Sbjct: 160 PHKNLFAHILGKTDSDNYGISGIEMHMDER------LRDKSKVNV-PVELSLNANIQYSI 212

Query: 269 HQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFE 328
           H+EL +    ++A     ++++ +TG++IS+VS+PD D +     + +   +R + G++E
Sbjct: 213 HEELTKGVNNFSAIGAAAILMDANTGKIISIVSLPDADNNLRNSNELKNNLSRATKGLYE 272

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLF-DTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYS 385
           +GS+FK F IA  +++       +F + RN +  GK  I +Y      + LT+ +I   S
Sbjct: 273 LGSVFKTFAIASALENKAIGKDTIFLNLRNRVYCGKFPIDEYRWDKSKKELTVQQILVKS 332

Query: 386 SNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGL 445
           SNIG  +I    G++  + FL  L +      E+PE+ + S  ++W + ++LT ++GHG+
Sbjct: 333 SNIGTIEIVKKNGLENQQNFLENLEIFDMPRLEIPEL-SKSNKNRWGKCNTLTSAYGHGV 391

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV--- 502
           STT LQ   A AA++N G L+  + ++ S+   ++    V+ K T   M  +LR  V   
Sbjct: 392 STTLLQLTRAYAAIVNGGVLLDSSILLNSKLNKKR----VISKETSVIMNQMLRANVDRK 447

Query: 503 --TGGSGRRAFVPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFM 558
             T GSGR+A + G++V GKTGTAQK  KK   YS  +  N F + FP+  P+Y++   +
Sbjct: 448 NKTSGSGRKADIVGYDVLGKTGTAQKPSKKEKGYSKEI-LNVFASAFPSKKPKYVLTVLI 506

Query: 559 DSPK----IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           D PK    I + ++  AG N   + G II++    L +  + L
Sbjct: 507 DEPKGAPQIWKHSRREAGWNAVYIAGKIIQKIGPSLAINDLDL 549


>gi|292490618|ref|YP_003526057.1| peptidoglycan glycosyltransferase [Nitrosococcus halophilus Nc4]
 gi|291579213|gb|ADE13670.1| Peptidoglycan glycosyltransferase [Nitrosococcus halophilus Nc4]
          Length = 567

 Score =  244 bits (622), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 177/539 (32%), Positives = 281/539 (52%), Gaps = 34/539 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R+G+  +V  V  + LA R+++        +  E  A  + + E    R  I DR+GE L
Sbjct: 12  RLGVVGLVFAVAAVGLAWRLVELQVFNRDFLRGEGEARHLRVVEVPAHRGMITDRHGEPL 71

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRR-KLSSETKFQWLRRKLSPQQ 186
           A   P  S++  P  +    E    L   +    + + RR K   E +F +L+R + P  
Sbjct: 72  AVSTPVASVWFNPQLLREARERWPALAKAVGVSTAYLSRRIKEGGEREFVYLKRWVEPNV 131

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--MQGL---T 241
            +++ +  +PGV  + E  R+YPA S A+HVVG+ +ID+RG  G+E   D  +QG+    
Sbjct: 132 ARQVQALDIPGVNLQSEYRRYYPAGSVAAHVVGFTNIDDRGQEGLELAFDKTLQGVPGKK 191

Query: 242 RVFTTNKGE-----KNL------QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           RV   ++G      +NL      Q +RL++DLR+Q + ++EL    + +NA +   VIL+
Sbjct: 192 RVIRDSRGRVVEDVENLRVPRPGQDLRLSIDLRLQYLAYRELKAAVRTHNARAGSLVILD 251

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
           V TGEV++MV+ P Y+P++  + K   + NR    +FE GS  K FTI + ++SG +   
Sbjct: 252 VDTGEVLAMVNRPSYNPNDRSQLKSHLYRNRAVTDLFEPGSTIKPFTIGVALESGKYHPH 311

Query: 351 DLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
              DT     +VG+HVI D     R+  +  + + SSN+GA++IA ++  Q   +   + 
Sbjct: 312 TPIDTTPGYFRVGRHVIRDIRNYGRV-DVSTVIKKSSNVGASKIALSLDSQRLWQGFAQA 370

Query: 410 GLLSKLETELP---EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
           GL +   +  P   E   P  P  +++I   T++FG+GLS T LQ A A AAL   G L 
Sbjct: 371 GLGASTASGFPGEAEGHLPD-PFSFRQIEQATLAFGYGLSVTTLQLARAYAALGAGGELK 429

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQ 525
           P +F+ R   E     R V  ++TV  + S+L E V+ GG+G RA VP + V GKTGT +
Sbjct: 430 PVSFLHR---EQAAGGRQVWSESTVSALLSMLEEVVSEGGTGERAHVPSYRVAGKTGTVK 486

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLTAGINVAPMVGNI 582
           K I+  Y+D    + F  + P + P+   +  +D P  KI    Q+ A +    MVG +
Sbjct: 487 KAIRGGYADERYVSLFAGLIPASRPRLAAVVLIDEPQGKIYYGGQVAAPVFSRVMVGAM 545


>gi|218659352|ref|ZP_03515282.1| cell division penicillin-binding protein [Rhizobium etli IE4771]
          Length = 228

 Score =  243 bits (621), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/194 (56%), Positives = 145/194 (74%)

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
           G  +++V TGEV+ M S PD+DP+   +G KEGW NR++ G FEMGS FK F++AM +DS
Sbjct: 1   GAAVIDVHTGEVLGMASAPDFDPNNPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDS 60

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G   + D FD    I +G   IHD+H Q R LT+PEIF+YSSNIG A+I D +GI   K+
Sbjct: 61  GKVKMTDTFDASKSIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARIIDIVGIDSQKD 120

Query: 405 FLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
           +L +LGLL+K++TELPE++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+
Sbjct: 121 YLTKLGLLTKMQTELPEVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGK 180

Query: 465 LIPPTFMIRSREES 478
           LI PTF+ R+RE S
Sbjct: 181 LIEPTFLPRTRETS 194


>gi|254524907|ref|ZP_05136962.1| penicillin-binding protein 3 [Stenotrophomonas sp. SKA14]
 gi|219722498|gb|EED41023.1| penicillin-binding protein 3 [Stenotrophomonas sp. SKA14]
          Length = 614

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 159/499 (31%), Positives = 260/499 (52%), Gaps = 30/499 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P  ++ SP+ I E  Q V  ++D    R    S+ 
Sbjct: 65  SRGMITDRNGEPLAVSTPVASIWVNPQDLLRSPERIPELAQAVGMSVDELSSRLSQKSDK 124

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +LRR+++P + +++++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 125 EFMYLRRRINPDEAEKVVALKIPGVAAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 184

Query: 234 FLD-----MQGLTRVFTTNKGE-------KNLQP---IRLALDLRIQNIVHQELVENKKK 278
             D       G  RV    KGE       +  +P   + L++D RIQ +  +EL      
Sbjct: 185 AFDEWLRGKAGAKRVIRNRKGETVESDLLRAAEPGKDLTLSIDRRIQYLAFKELRNALVA 244

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A     VI++V+TGE+++MV++P Y+P+       +   NR    + E GS  K  TI
Sbjct: 245 NKAAGGSMVIMDVTTGEILAMVNLPTYNPNSLTGALPDARRNRAVTDLVEPGSTMKPLTI 304

Query: 339 AMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           A  + +G  T   + DT NP  + +G+  I D    N +L +  +   SSN+GAA++A  
Sbjct: 305 ATALQAGAVTKDTIIDT-NPGYMTLGRFTIRDVPRNNGVLNVTGVITRSSNVGAAKVAAK 363

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAV 454
           M  Q   + + R G  S   +  P         P++W      T+S+G+GL+ TPLQ A 
Sbjct: 364 MPDQVFYDGVRRFGYGSVPHSGFPGESGGVVLRPARWSGTTKTTMSYGYGLNVTPLQIAT 423

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           A +AL N GRLI PTF+   R E ++    ++ +N  K + +++   VT G  ++A V G
Sbjct: 424 AYSALANGGRLIAPTFVKGQRNEGQQ----IIDENVAKQVVAMMETVVTQGGAKQAAVLG 479

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           + V GKTGTA+K     Y +  ++N+ F  V P T+P++  +  ++ P+     +   G+
Sbjct: 480 YRVAGKTGTARKAGPGGY-ERGHYNALFAGVVPATNPRFATVIVINDPQA---GKFYGGL 535

Query: 574 NVAPMVGNIIRRSASMLGV 592
             AP+  N++  +  ++ V
Sbjct: 536 VSAPVYHNVMEGTLRLMDV 554


>gi|190572796|ref|YP_001970641.1| putative penicillin-binding protein 3 [Stenotrophomonas maltophilia
           K279a]
 gi|190010718|emb|CAQ44327.1| putative penicillin-binding protein 3 precursor [Stenotrophomonas
           maltophilia K279a]
          Length = 614

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 158/499 (31%), Positives = 260/499 (52%), Gaps = 30/499 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P  ++ SP+ I E  Q V  ++D    R    S+ 
Sbjct: 65  SRGMITDRNGEPLAVSTPVASIWVNPQDLLRSPERIPELAQAVGMSVDELSSRLSQKSDK 124

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +LRR+++P + +++++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 125 EFMYLRRRINPDEAEKVVALKIPGVAAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 184

Query: 234 FLD-----MQGLTRVFTTNKGE-------KNLQP---IRLALDLRIQNIVHQELVENKKK 278
             D       G  RV    KGE       +  +P   + L++D RIQ +  +EL      
Sbjct: 185 AFDEWLRGKAGAKRVIRNRKGETVESDLLRAAEPGKDLTLSIDRRIQYLAFKELRNALVA 244

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A     VI++V+TGE+++MV++P Y+P+       +   NR    + E GS  K  TI
Sbjct: 245 NKAAGGSMVIMDVTTGEILAMVNLPTYNPNSLTGALPDARRNRAVTDLVEPGSTMKPLTI 304

Query: 339 AMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           A  + +G  T   + DT NP  + +G+  I D    N +L +  +   SSN+GAA++A  
Sbjct: 305 ATALQAGAVTKDTIIDT-NPGYMTLGRFTIRDVPRNNGVLNVTGVITRSSNVGAAKVAAK 363

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAV 454
           M  Q   + + R G  S   +  P         P++W      T+S+G+GL+ TPLQ A 
Sbjct: 364 MPDQVFYDGVRRFGYGSVPHSGFPGESGGVVLRPARWSGTTKTTMSYGYGLNVTPLQIAT 423

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           A +AL N GRLI PTF+   R E ++    ++ +N  + + +++   VT G  ++A V G
Sbjct: 424 AYSALANGGRLIAPTFVKGQRNEGQQ----IIDENVARQVVAMMETVVTQGGAKQAAVLG 479

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           + V GKTGTA+K     Y +  ++N+ F  V P T+P++  +  ++ P+     +   G+
Sbjct: 480 YRVAGKTGTARKAGPGGY-ERGHYNALFAGVVPATNPRFATVIVINDPQA---GKFYGGL 535

Query: 574 NVAPMVGNIIRRSASMLGV 592
             AP+  N++  +  ++ V
Sbjct: 536 VSAPVYHNVMEGTLRLMDV 554


>gi|319639030|ref|ZP_07993788.1| PenA protein [Neisseria mucosa C102]
 gi|317399934|gb|EFV80597.1| PenA protein [Neisseria mucosa C102]
          Length = 582

 Score =  240 bits (612), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 162/505 (32%), Positives = 261/505 (51%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SLY  P  +  +  DE +EKL  +  ++  E+++ KLS +
Sbjct: 74  SRGMITDRNGATLALSAPTESLYAMPSGMEEMPTDEQLEKLSAIA-DVPVEVLKNKLSKK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 DKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + ++EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+   P+   ++  S ++LGV P 
Sbjct: 545 GGVVAGPVFKEVMSGSLNILGVSPT 569


>gi|95930737|ref|ZP_01313470.1| Peptidoglycan glycosyltransferase [Desulfuromonas acetoxidans DSM
           684]
 gi|95133217|gb|EAT14883.1| Peptidoglycan glycosyltransferase [Desulfuromonas acetoxidans DSM
           684]
          Length = 700

 Score =  239 bits (611), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 170/532 (31%), Positives = 261/532 (49%), Gaps = 65/532 (12%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVI---------------------SPDEIIEKLQ 154
           R  I DRNGE LA  +   S+YV P +                       S D I +KL 
Sbjct: 78  RGAIYDRNGEPLAISLEADSVYVNPTETTKLFKEQRQRLAENPDSDETPYSYDVIAKKLA 137

Query: 155 IVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHA 214
            +L  L   +IR KL  + KF W++R++S ++ + +    LPG+    E  R YP    A
Sbjct: 138 EILA-LKPAVIRGKLERDKKFIWIKRRISARESQLLDEVSLPGIHTIKEHVRSYPQGRVA 196

Query: 215 SHVVGYVDIDNRGITGIEK-----------FLDMQGL---------TRVFTTNKGEKNLQ 254
             V+G+   DN G+ GIE+           +L +Q            +VF   +G+    
Sbjct: 197 GQVLGFSGTDNEGLEGIERRYNGLVAGDGSYLTVQADGGRRGIGSGQQVFKGRQGKD--- 253

Query: 255 PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGK 314
            + L +D ++Q IV +EL    K+ NA +   ++++  +GE+++M S+PDYDP+     +
Sbjct: 254 -LYLTIDTQLQFIVEKELQAAVKEANARAGSAIMMDPHSGEILAMSSVPDYDPNHFRHSR 312

Query: 315 KEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQN 373
                NR+    FE GS FK+F +A  +D+G  + KD+ D      +VG  VIHD+    
Sbjct: 313 PAARRNRVVCDTFEPGSTFKLFLLASALDTGTISTKDVIDCGPGAYRVGGKVIHDHRAMG 372

Query: 374 RILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQW 431
             LT+ ++ +YSSNIG A+IA  +G +   ++L   G   +   +     +     P +W
Sbjct: 373 H-LTVSDVLKYSSNIGCAKIAQRLGKETFYDYLRSFGFGERTGIDFDGEGSGILRSPQRW 431

Query: 432 KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR--------SREESEKVSR 483
             I    ISFG G++ T LQ   AA+A++N G L+ P  + R        S E+   V R
Sbjct: 432 FEIDLAAISFGQGVTATALQLVTAASAIVNGGELMHPYLVRRIRDARNDISEEQKPTVVR 491

Query: 484 IVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNS 540
            V+ ++    MR+++     + G+G RA VPGFEVGGKTGTAQKV  +   YS     +S
Sbjct: 492 RVIGRDVALAMRNMMITVTDSDGTGSRAQVPGFEVGGKTGTAQKVDPVTGTYSVDKRVSS 551

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGV 592
           F+   P  +PQ +VL  +D P+ K    L A    AP+   I+ +S   L V
Sbjct: 552 FIGFAPARNPQIVVLVALDEPEGKAYGGLLA----APVFSRIVEQSMQYLHV 599


>gi|261379349|ref|ZP_05983922.1| peptidoglycan synthetase FtsI [Neisseria subflava NJ9703]
 gi|284797789|gb|EFC53136.1| peptidoglycan synthetase FtsI [Neisseria subflava NJ9703]
          Length = 582

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 162/505 (32%), Positives = 260/505 (51%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SLY  P  +  +  DE +EKL  +  ++  E+++ KLS +
Sbjct: 74  SRGMITDRNGATLALSAPTESLYAMPSGMEEMPTDEQLEKLSAIA-DVPVEVLKNKLSKK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 DKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+   P+   ++  S ++LGV P 
Sbjct: 545 GGVVAGPVFKEVMSGSLNILGVSPT 569


>gi|262276875|ref|ZP_06054668.1| cell division protein FtsI [alpha proteobacterium HIMB114]
 gi|262223978|gb|EEY74437.1| cell division protein FtsI [alpha proteobacterium HIMB114]
          Length = 556

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 156/498 (31%), Positives = 269/498 (54%), Gaps = 37/498 (7%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           + R  I+D+N  +LA  I T  L +   K+ + + +  KL+I  P +D + I+    ++ 
Sbjct: 67  LKRRSIVDQNNNLLAYSIKTHDLLIRTKKIKNFNNLNLKLRIKFPEVDLKKIKN--FNKR 124

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F  +++ LSP +    LS G P +     ++R YP  +  SH++G +DID +GI+GIE 
Sbjct: 125 SFHVIKKNLSPAEYNNALSLGEPSLELVENETRIYPDKNLFSHILGNIDIDQQGISGIEL 184

Query: 234 FLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           FL+ + L      +K + N+ PI L++D  +Q I+ + L+++   ++A+    V++   +
Sbjct: 185 FLNDEIL------DKKKINI-PIVLSVDQSVQFIIRETLLDSINIFSAKGASAVLMEAGS 237

Query: 294 GEVISMVSIPDYDPHEAFKGK-KEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           G+++SMVS+PDY+P++  + K KE  FN+ S G++E+GS+FK F IA  ++    T   +
Sbjct: 238 GKILSMVSLPDYNPNDRSELKNKENLFNKNSKGLYELGSVFKTFVIANALELKKVTRDKV 297

Query: 353 F-DTRNPIKVGKHVI--HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
           + +  + +  GK  I  + Y    + L++ +I   SSNIG  +I    G++ ++ FL +L
Sbjct: 298 YKNLPSQVTCGKFFIKEYKYSKDKKNLSVNDILVESSNIGTIRIIQDSGLETYQNFLEKL 357

Query: 410 GLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
            +      ELPE+ A S   +W    +LT  +GHG++TTPLQ   A A++IN G L+ PT
Sbjct: 358 EIFDYSGIELPEVSA-STKKRWGMCRTLTAGYGHGINTTPLQLTRAYASIINGGNLLEPT 416

Query: 470 FM---------IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGK 520
            +             +E+ K+ + +L+ N            + GGSGR+A + G+ V GK
Sbjct: 417 LLKNKKTKIKNKIISKENSKIIKKILRTNVDNNY-------IRGGSGRKADINGYNVMGK 469

Query: 521 TGTAQK--VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK----IKERNQLTAGIN 574
           TGTA+K   I K YS+ +  N F++ F      Y++   MD PK    +   N+  +G N
Sbjct: 470 TGTAEKPSKIDKGYSNEI-MNVFVSAFDVDKNLYVLTVIMDEPKGAPELWGHNRRESGWN 528

Query: 575 VAPMVGNIIRRSASMLGV 592
              + G II++   +L  
Sbjct: 529 AGFINGQIIKKIGPILNT 546


>gi|194364375|ref|YP_002026985.1| peptidoglycan glycosyltransferase [Stenotrophomonas maltophilia
           R551-3]
 gi|194347179|gb|ACF50302.1| Peptidoglycan glycosyltransferase [Stenotrophomonas maltophilia
           R551-3]
          Length = 614

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 159/499 (31%), Positives = 257/499 (51%), Gaps = 30/499 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P  ++ SP+ I E  Q V  ++D    R    S+ 
Sbjct: 65  SRGMITDRNGEPLAVSTPVASIWVNPQDLLRSPERIPELAQAVGMSVDELSSRLSQKSDK 124

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +LRR+++P + +++++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 125 EFMYLRRRINPDEAEKVVALKIPGVAAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 184

Query: 234 FLD-----MQGLTRVFTTNKGE-------KNLQP---IRLALDLRIQNIVHQELVENKKK 278
             D       G  RV    KGE       +  +P   + L++D RIQ +  +EL      
Sbjct: 185 AFDEWLRGKAGAKRVIRNRKGETVESDLLRAAEPGKDLTLSIDRRIQYLAFKELRNALVA 244

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A     VI++V+TGE+++MV++P Y+P+       +   NR    + E GS  K  TI
Sbjct: 245 NKAAGGSMVIMDVTTGEILAMVNLPTYNPNSVGGAAPDTRRNRAVTDLVEPGSTMKPLTI 304

Query: 339 AMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           A  + +G  T   + DT NP  ++V +  I D    N +L +  +   SSNIGAA++A  
Sbjct: 305 ATALQAGAVTKDTVIDT-NPGYMQVARFTIRDVPRNNGVLNVTGVITRSSNIGAAKVAAK 363

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAV 454
           M  Q   + + R G  S   +  P         P+ W      T+S+G+GL+ TPLQ A 
Sbjct: 364 MPDQVFYDGVRRFGYGSVPHSGFPGESGGVVRRPANWDGATKTTMSYGYGLNVTPLQIAT 423

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           A +AL N G+LI PTF+   R E+ ++    + +  V  M ++    VT G  ++A V G
Sbjct: 424 AYSALANGGKLIAPTFVKGQRNEAHQIIDESVARQVVAMMETV----VTQGGAKQAAVLG 479

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           + V GKTGTA+K     Y +  ++N+ F  V P T+P++  +  ++ P+     +   G+
Sbjct: 480 YRVAGKTGTARKTGPGGY-ERGHYNALFAGVVPATNPRFATVIVINDPQA---GKFYGGL 535

Query: 574 NVAPMVGNIIRRSASMLGV 592
             AP+  N++  +  ++ V
Sbjct: 536 VSAPVYHNVMEGTLRLMDV 554


>gi|241760210|ref|ZP_04758306.1| peptidoglycan synthetase FtsI [Neisseria flavescens SK114]
 gi|241319321|gb|EER55786.1| peptidoglycan synthetase FtsI [Neisseria flavescens SK114]
          Length = 572

 Score =  236 bits (603), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 163/506 (32%), Positives = 260/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SLY  P  +  +   E +EKL     ++  E+++ KLS +
Sbjct: 64  SRGMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQLEKLS-AFADVPVEVLKNKLSKK 122

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 123 DKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 182

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 183 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 242

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 243 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 302

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 303 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 360

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 361 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 420

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + V+K +T K +R L+   VT  GG+G  
Sbjct: 421 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVS-VTEAGGTGTA 476

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 477 GAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGY 533

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P+   ++  S ++LGV P 
Sbjct: 534 YGGVVAGPVFKEVMSGSLNILGVSPT 559


>gi|225077132|ref|ZP_03720331.1| hypothetical protein NEIFLAOT_02187 [Neisseria flavescens
           NRL30031/H210]
 gi|224951543|gb|EEG32752.1| hypothetical protein NEIFLAOT_02187 [Neisseria flavescens
           NRL30031/H210]
          Length = 582

 Score =  235 bits (599), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 161/505 (31%), Positives = 259/505 (51%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SLY  P  +  +   E +EKL  +  ++  E+++ KLS +
Sbjct: 74  SRGMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQLEKLSAI-ADVPVEVLKNKLSKK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 DKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDPTDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGIAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+   P+   ++  S ++LGV P 
Sbjct: 545 GGVVAGPVFKEVMSGSLNILGVSPT 569


>gi|307320017|ref|ZP_07599439.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83]
 gi|306894394|gb|EFN25158.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83]
          Length = 293

 Score =  234 bits (598), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 118/270 (43%), Positives = 169/270 (62%), Gaps = 3/270 (1%)

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNI 388
           MGS FK  T AM ++SG F ++ + D   P+  G+  IHDY  + R LT+PE F +SSNI
Sbjct: 1   MGSTFKALTTAMALESGRFDLESVVDASRPLSFGRQRIHDYRGKYRPLTVPEAFIHSSNI 60

Query: 389 GAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTT 448
             A++A  +G +  + FL R G+LS+L TELPE  AP  PS W  + + T+SFGHG++ T
Sbjct: 61  VMAKMAMTLGPEALRTFLGRFGVLSQLATELPESAAPLRPSSWSEVTTATVSFGHGIAVT 120

Query: 449 PLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR 508
           PLQ ++A AAL N GRLI PTF+  S      ++  +L  NT + +R LLR     GS  
Sbjct: 121 PLQASMAVAALANGGRLIRPTFIKDSSVSERTIAESLLSANTSEAIRHLLRLNAAVGSAT 180

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK--IKER 566
           +A VPG+ +GGKTGTA+KV++ RYS  LN  SF+ + P  +P+Y++L+ +D P+   +  
Sbjct: 181 KADVPGYVIGGKTGTAEKVVQGRYSKVLNVTSFMGIVPADNPRYLLLTLLDEPRGLAETY 240

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPVF 596
              T+G N  P+ G ++ R   ML +KPVF
Sbjct: 241 GNRTSGWNAVPLGGALLHRILPML-LKPVF 269


>gi|74316131|ref|YP_313871.1| peptidoglycan synthetase FtsI [Thiobacillus denitrificans ATCC
           25259]
 gi|74055626|gb|AAZ96066.1| peptidoglycan glycosyltransferase [Thiobacillus denitrificans ATCC
           25259]
          Length = 577

 Score =  234 bits (597), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 144/467 (30%), Positives = 249/467 (53%), Gaps = 26/467 (5%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  + DR+G++LA   P  SL+  P ++   D    +L  VL  +  + + + L  +T+ 
Sbjct: 65  RGQVADRHGQLLAISTPVESLWARPTELRLDDAQRAQLARVL-GVSPQALAKTLGRKTRG 123

Query: 176 QW-LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK- 233
           ++ +RR ++P+Q  +I + G+PG+  R E  R+YPA   A+HVVG+ ++D+ G  G+E+ 
Sbjct: 124 EFSVRRPVTPEQAVKIAAMGIPGLHLRREFRRYYPAGEVAAHVVGFTNVDDLGQEGVERA 183

Query: 234 ----FLDMQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKK 278
                   +G   +    +G   ++L PI+         LALDL+IQ + H+EL    + 
Sbjct: 184 YQDWLAGREGKREILRDRRGNTIRDLAPIKTAQMGGNLALALDLKIQYLAHRELAAAIEA 243

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A+    V+L+  TGE++++ + P ++P+           NR     FE GS  K F  
Sbjct: 244 HKAKGGSVVVLDAKTGEILALANQPIFNPNNRHDYAPGPMRNRAVIDTFEPGSTIKPFVA 303

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  ++ GL+    + DT    +VG+ ++ D HP  + +T+ EI + SSN+GA ++A ++ 
Sbjct: 304 AAVLERGLYDPDSVIDTPETWRVGRKLVRDVHPHPQ-MTVSEIIQKSSNVGAVKLAMSLT 362

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAA 456
            Q + E L+R G   +  +  P   A      + WK +   T+++G+GLS + LQ   A 
Sbjct: 363 PQQYWEVLHRAGFGERPGSGFPGETAGRLRDAANWKPVEHATMAYGYGLSVSLLQLTRAY 422

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPG 514
            A  N+G ++P +F+   RE  E V   V      + +R+++ E VT  GG+G R  VPG
Sbjct: 423 MAFANDGEVMPLSFL--KREPQEIVGVRVFSPTVAREVRAMM-EAVTQEGGTGLRTRVPG 479

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
           + V GKTGTA K++  RY+     +SF+ + P ++P+ I+   +D P
Sbjct: 480 YRVAGKTGTAHKLVDGRYAPDRYLSSFVGMAPASNPRLIIGVVIDEP 526


>gi|32345902|gb|AAM97245.1| PenA [Neisseria meningitidis]
 gi|32345904|gb|AAM97246.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  233 bits (595), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 161/505 (31%), Positives = 262/505 (51%), Gaps = 35/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +   E +EKL  +  ++  E+++ KLS +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPTVEQLEKLSAIA-DVPVEVLKNKLSKK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 DKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + V+K +T K +R L+   VT  GG+G  
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 487 GAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G+   P+   ++  S ++LGV P
Sbjct: 544 YGGVVTGPVFKQVMGGSLNILGVSP 568


>gi|254455385|ref|ZP_05068814.1| cell division protein FtsI [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082387|gb|EDZ59813.1| cell division protein FtsI [Candidatus Pelagibacter sp. HTCC7211]
          Length = 563

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 165/521 (31%), Positives = 280/521 (53%), Gaps = 30/521 (5%)

Query: 52  MEDGQDLFQ-KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG--NIHPEPIAPSMN 108
           +ED Q  F  K++   +    NR+     V  +IY+I  I +I  G  N   E I  ++N
Sbjct: 10  IEDYQSDFTFKKKENGLNIEFNRVAFIFFVFFIIYLIYTIHLIHLGSQNNKSENIN-NLN 68

Query: 109 IDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRK 168
             +  + R DIID NG  LA  + +  + ++   VI+  +++  L I+ P+       +K
Sbjct: 69  TFQNPLYRADIIDINGNYLAKTVKSIDIGLKTSDVINKKKLLLSLNIIFPD-KKFNEIKK 127

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
                KF +L +K+S +  ++I+  G   +    +  R YP  +  SHV+G +D DN GI
Sbjct: 128 KIENKKFFYLEKKISEENYEKIMKLGDKSLIPEEKVLRLYPQKNLFSHVLGQIDDDNNGI 187

Query: 229 TGIEKFLDMQGLTRVFTTNKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           +G+EK L           N+  +N + PIRL LD  IQ ++ +EL++ ++ + ++    +
Sbjct: 188 SGLEKSL-----------NEELRNSEDPIRLTLDKDIQFLIRKELMKYQEIFKSKGSAAI 236

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           ++NV+ G ++S+VS+PD++P+E        + NR++ G +E+GS+FK FT A  ++  + 
Sbjct: 237 LMNVNNGNILSLVSLPDFNPNERQNITDVNYINRVTKGTYELGSVFKAFTFASALNENVI 296

Query: 348 TVK-DLFDTRNPIKVGKHVIHDYH---PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
             + +  D    IK  K+ I +Y    P N  LT  +IF  S NIG+ +IA  +G +  K
Sbjct: 297 EPETEFLDLPKSIKCDKYRIGEYDNKIPSN--LTAEQIFVRSGNIGSVRIAQKVGSEKFK 354

Query: 404 EFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
            FL  LG+L+ +E ++ E+ AP     + +    T SFGHG++TT LQ A   A L N G
Sbjct: 355 LFLENLGVLNNIEFDIDEV-APQKNYNFGKCRLATASFGHGIATTILQLAKGYAILSNGG 413

Query: 464 RLIPPTFMIRSREESEKVSRIV---LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGK 520
             I PT + +  E ++K  RI+   + K  V  +R ++      G+ + A V  +E+GGK
Sbjct: 414 YEIKPTLIYKKNEINKKNKRILNEGISKKVVNALRKIVN--TEEGTAKFADVQSYEIGGK 471

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
           TGTA +     YS+    N+F ++FPT++PQ++ +  +D+P
Sbjct: 472 TGTADQAESGTYSEA-KINTFASIFPTSNPQFVFVVMLDTP 511


>gi|319778489|ref|YP_004129402.1| Cell division protein FtsI [Taylorella equigenitalis MCE9]
 gi|317108513|gb|ADU91259.1| Cell division protein FtsI [Taylorella equigenitalis MCE9]
          Length = 555

 Score =  231 bits (589), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 160/510 (31%), Positives = 260/510 (50%), Gaps = 44/510 (8%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           R  I DRNGE LAT +P  S++V P ++ ++P E I +L   L NL+ + +  KL+    
Sbjct: 41  RGRITDRNGEFLATSVPASSIWVVPEQLLVAPAEKISELTKAL-NLNEKELIAKLNKHKN 99

Query: 175 --FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F +LRR++  Q  + + +  + GV    E  R+YP  S  +HVVG+ +I++ GI G+E
Sbjct: 100 RHFLFLRRQVDLQVSEAVRTLKIKGVNIDSESKRYYPQGSLMAHVVGFTNIEDNGIEGLE 159

Query: 233 ----KFLDMQGLTRVFTTNK-GE-------------KNLQPIRLALDLRIQNIVHQELVE 274
               K L+ Q  +RV   N+ GE             K+ + I L +D R+Q I    L +
Sbjct: 160 RQFNKKLEGQDGSRVVIRNRLGEVIEDVNSTDSLPAKHGENIDLTIDTRVQYIAATALQK 219

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             KK+NAES   ++ ++ TGE+++M+SIP YDP++    K     NR+   IFE GSI K
Sbjct: 220 AIKKHNAESGAAIVADIDTGEILAMISIPTYDPNDKKARKGSALRNRVVTDIFEPGSIIK 279

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
            F + + +D+ + T K +F T N   K     I D   +N  L +  + R SSNIG A +
Sbjct: 280 PFVVGLALDAKVATKKTIFPTGNGTWKYHGATITDVSKRNGNLDLTGLLRRSSNIGMAML 339

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS-------QWKRIHSLTISFGHGLS 446
           +D +  +        LG       + P I  P   S        WK I   T+S+G+GLS
Sbjct: 340 SDKLNAEQMWTVFTALGF-----GQSPSISFPGVSSGRVRPWKTWKPIEKATMSYGYGLS 394

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
            + +Q A A  A   +G ++P + +   +  + K S  V      + +R +L E  +G  
Sbjct: 395 VSLVQIAQAYTAFARDGDMVPLSLI---KNSNNKHSVQVYSPQVARDVRHMLEE-ASGSQ 450

Query: 507 GRR--AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK 564
           G +  + V G+ +GGK+GTA++++K RYS  L+  S++++ P ++P+ +V   +D PK  
Sbjct: 451 GTKIQSQVNGYRIGGKSGTARQIVKGRYSTDLHRGSYVSIAPISNPKIVVAVTIDKPK-- 508

Query: 565 ERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            +      +   P+   I   +   LG+ P
Sbjct: 509 -KEGYYGTVTAGPVNAEITENTLRYLGIPP 537


>gi|300112937|ref|YP_003759512.1| peptidoglycan glycosyltransferase [Nitrosococcus watsonii C-113]
 gi|299538874|gb|ADJ27191.1| Peptidoglycan glycosyltransferase [Nitrosococcus watsonii C-113]
          Length = 570

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 162/547 (29%), Positives = 271/547 (49%), Gaps = 37/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           +   + V  + + ++ ++++    +  E  A  + + E    R  I DR+GE LA   P 
Sbjct: 20  LAFAVAVAGLAWRLVELQVLDCDFLRGEGEARHLRVVEMPAHRGIITDRHGEPLAVSTPV 79

Query: 134 FSLYVEPHKVISPDE----IIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
            S++  P  +    E    + E   + + +L+  M   K     +F +L R + P   +R
Sbjct: 80  ASIWFNPRLLGEAREQWRALAEAAGVSMAHLEKRM---KEGGRREFVYLNRWVEPDVAQR 136

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVF 244
           + +  +PGV  + E  R+YP    A+HVVG+ +ID+RG  G+E  LD     + G  RV 
Sbjct: 137 VQALEVPGVNLQSEYRRYYPTGPVAAHVVGFTNIDDRGQEGLELALDETLRGIPGKKRVI 196

Query: 245 TTNKGE-----KNL------QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
             ++G      +NL      Q +RL++DLR+Q + ++EL    + +NA +   VIL+V T
Sbjct: 197 QDSRGRVVEDVENLRVPRPGQDLRLSIDLRLQYLAYRELKTAVQDHNARAGSLVILDVGT 256

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GEV++MV+ P Y+P++  + K   + NR    +FE GS  K FTI + ++SG +      
Sbjct: 257 GEVLAMVNQPSYNPNDRAQLKSHLYRNRAVTDLFEPGSTIKPFTIGVALESGKYYPHTPI 316

Query: 354 DTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           DT     +VG++ I D     RI  +  + + SSN+GA++IA ++      +  Y+ GL 
Sbjct: 317 DTAPGYFRVGRYTIRDSRDYGRI-DVSTVIKKSSNVGASKIALSLDPMRLWQGFYQAGLG 375

Query: 413 SKLETELPEIQAPSYPSQ----WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +   +  P       P      ++ I   T++FG+GLS TPLQ A A AAL   G L P 
Sbjct: 376 TSTASGFPGEAEGHLPRSRTFPFREIEQATLAFGYGLSVTPLQLARAYAALGAGGELKPV 435

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKV 527
           +F+ R +   E     V  +    T+ S+L E V+ GG+G RA+VP + V GKTGT +K 
Sbjct: 436 SFLYREQAVREHQ---VWSEGIAPTVLSMLEEVVSDGGTGERAYVPSYRVAGKTGTVKKA 492

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
            +  Y+       F  + P + P+   +  +D P+ K       G   AP+   ++  + 
Sbjct: 493 TRGGYAKERYLAVFAGLIPASHPRLAAVVLIDEPQGK----YYGGQVAAPVFSKVMIGAM 548

Query: 588 SMLGVKP 594
            +L + P
Sbjct: 549 RLLNIAP 555


>gi|285019579|ref|YP_003377290.1| cell division protein ftsi [Xanthomonas albilineans GPE PC73]
 gi|283474797|emb|CBA17296.1| probable cell division protein ftsi [Xanthomonas albilineans]
          Length = 621

 Score =  231 bits (588), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 262/508 (51%), Gaps = 43/508 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSS-- 171
           SR  I DRNGE LA   P  S++V P +++ +PD I +  Q +  +L  + +  KLS   
Sbjct: 65  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPQLAQAL--DLPVDELTAKLSQKV 122

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
           + +F +L+R+++P +   +++ G+PGV  + E  RFYP     +HV+G+ +ID+RG  G+
Sbjct: 123 DKEFMYLKRRINPDKAHAVIALGIPGVFAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGL 182

Query: 232 EKFLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQE---- 271
           E   D       G  RV    KG         K  QP   + L++D RIQ + ++E    
Sbjct: 183 ELAFDEWLRGKPGAERVIRDRKGAIVESIDLVKPTQPGKDLTLSIDRRIQFLAYKELRNA 242

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           LVENK    A     VI++V TGE+++MV++P Y+P+       +   NR    + E GS
Sbjct: 243 LVENK----AAGGSIVIMDVVTGEILAMVNLPTYNPNAVTGVNSDARRNRAVTDLVEPGS 298

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
             K  TI+  + +G+ T   L DT NP  + VG+  I D    N +LT+  +   SSNIG
Sbjct: 299 TMKPLTISTALKAGVVTKDTLIDT-NPGYMAVGRFTIKDVPHNNGVLTVTGVITRSSNIG 357

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA---PSYPSQWKRIHSLTISFGHGLS 446
           AA+IA  +  Q   + ++  G  S   +  P   A   PS P++W      T+++G+GLS
Sbjct: 358 AAKIAAKLPDQTFYDQIHSYGYGSAPHSGFPGESAGVLPS-PARWSGSSKTTMAYGYGLS 416

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
            TPLQ A A  AL N G+L+ PTF+    EE+++V    + K  V  M ++    VT G 
Sbjct: 417 VTPLQIARAYCALGNGGKLVTPTFVKGQHEETKQVLDPAIAKEVVAMMETV----VTQGG 472

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
            + A + G+ V GKTGTA+K     Y        F  + P + P++  +  ++ P   + 
Sbjct: 473 AKGAAILGYHVAGKTGTARKTGPGGYEHGHYNALFAGLVPASHPRFATVIVINDP---QG 529

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
            +   G+  AP+  N++  +  ++ V P
Sbjct: 530 TKYYGGLVSAPVFHNVMEGALRLMDVPP 557


>gi|114330279|ref|YP_746501.1| peptidoglycan glycosyltransferase [Nitrosomonas eutropha C91]
 gi|114307293|gb|ABI58536.1| peptidoglycan synthetase FtsI [Nitrosomonas eutropha C91]
          Length = 579

 Score =  230 bits (587), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 157/504 (31%), Positives = 259/504 (51%), Gaps = 30/504 (5%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS 170
           E  M R +I DRNGEILA   P  S+++EP +V +  E I +L   L  ++  +I++++ 
Sbjct: 62  EQNMQRGNIKDRNGEILAVSAPVRSVWIEPQRVNATPEQIRQL-ASLTGVEEAVIQQRIR 120

Query: 171 SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITG 230
           S  KF +LRR+L P+  +++    + GV  + E  R+YPA   A+H++G+ DID RG  G
Sbjct: 121 SGKKFVYLRRQLPPELAEKVAELNIKGVNLKHEFYRYYPARELAAHILGFTDIDGRGQEG 180

Query: 231 IE-KFLDM----QGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVE 274
           +E  + DM     G  RV     G            K  Q + L++D +IQ + ++EL  
Sbjct: 181 MELAWQDMLTGEDGKRRVIKDRIGRIVEDVEQIQSPKPGQDVVLSIDSKIQYLAYRELAR 240

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             K+ +A++   V L+V TGEV++M + P ++P++      E   NR+    FE GS  K
Sbjct: 241 AVKEQHAKAGSIVALDVQTGEVLAMANYPAFNPNQRASMNNEVIRNRVLVDTFEPGSTLK 300

Query: 335 VFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
            F +A+ +++G      L +T    +K+G+ VIHD   +   LT+ ++ + SSN+GAA+I
Sbjct: 301 PFVVAVAMETGRIKPDTLMETAGGKLKIGRAVIHDVRDKGN-LTVSQVIQASSNVGAAKI 359

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           A  +  +   E L R G  ++     P   +    +   W+ I   T+S+GHG+S + +Q
Sbjct: 360 ALLLPPKTFWEMLNRSGFGTETGIGFPGEASGRLRAYNTWRPIEQATMSYGHGISASLMQ 419

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRA 510
            A A      +G L P T + R   +   V + V+   T +++R +L   V   G+G  A
Sbjct: 420 LARAYTLFATDGELKPVTLLKR---DMPAVGQKVISHETAQSVRKMLELAVQPEGTGNSA 476

Query: 511 FVPGFEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
            + G+ V GKTGTA K +K  K Y+     +SF+   P +DP+ I+   +D P       
Sbjct: 477 RISGYRVAGKTGTAHKRLKGQKGYAKDRYISSFVGFAPASDPRVIIAIMIDEPS---SGN 533

Query: 569 LTAGINVAPMVGNIIRRSASMLGV 592
              G   AP+   ++  +  +L V
Sbjct: 534 YYGGTVAAPVFSRVMEGTLRILNV 557


>gi|288576013|ref|ZP_05978001.2| peptidoglycan glycolsyltranferase FtsI [Neisseria mucosa ATCC
           25996]
 gi|288566550|gb|EFC88110.1| peptidoglycan glycolsyltransferase FtsI [Neisseria mucosa ATCC
           25996]
          Length = 597

 Score =  230 bits (587), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 162/506 (32%), Positives = 259/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SLY  P  +  +   E + KL  ++ +L  E ++ KL+ +
Sbjct: 89  SRGMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQLTKLAAIV-DLPVETLQDKLAKK 147

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 148 DKDFIYLKRQLSQEKAEEIKALGIKGLAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 207

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 208 ELSREDSLHGADGAKVVLRDNKGNIVDSLDSPRNSDPKNGQDMVLSLDQRIQTLAYDELN 267

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++      E   NR    + E GS  
Sbjct: 268 KAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGSADSEQRRNRAVTDMIEPGSAM 327

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG   V D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 328 KPFTIAKALDSGKVGVADRFNTM-PYKIGPATVRDTHVYP-TLDVRGIMQKSSNVGTSKL 385

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W+ I   T+SFG+GL  + LQ
Sbjct: 386 SAKFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQPIEQATMSFGYGLQLSLLQ 445

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + V+K +T + +R L+   VT  GG+G  
Sbjct: 446 LARAYTMLTHDGELLPVSF---EKQAVAPKGKRVIKASTAREVRDLMVS-VTEPGGTGTA 501

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 502 GAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 558

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P+   ++  S ++LGV P 
Sbjct: 559 YGGVVAGPVFKQVMGGSLNILGVSPT 584


>gi|255068192|ref|ZP_05320047.1| peptidoglycan synthetase FtsI [Neisseria sicca ATCC 29256]
 gi|255047534|gb|EET42998.1| peptidoglycan synthetase FtsI [Neisseria sicca ATCC 29256]
          Length = 582

 Score =  230 bits (587), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 162/506 (32%), Positives = 259/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SLY  P  +  +   E + KL  ++ +L  E ++ KL+ +
Sbjct: 74  SRGMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQMAKLAAIV-DLPVEALQEKLAKK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 DKDFIYLKRQLSQEKAEEIKALGIKGLAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLHGADGAKVVLRDNKGNIVDSLDSPRNSDPKNGQDMVLSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++      E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGSADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG   V D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVGVADRFNTM-PYKIGPATVRDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W+ I   T+SFG+GL  + LQ
Sbjct: 371 SAKFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQPIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + V+K +T + +R L+   VT  GG+G  
Sbjct: 431 LARAYTMLTHDGELLPVSF---EKQAVAPKGKRVIKASTAREVRDLMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 487 GAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P+   ++  S ++LGV P 
Sbjct: 544 YGGVVAGPVFKQVMGGSLNILGVSPT 569


>gi|78221627|ref|YP_383374.1| penicillin-binding protein, transpeptidase [Geobacter
           metallireducens GS-15]
 gi|78192882|gb|ABB30649.1| peptidoglycan synthetase FtsI [Geobacter metallireducens GS-15]
          Length = 657

 Score =  229 bits (585), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 166/512 (32%), Positives = 247/512 (48%), Gaps = 41/512 (8%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  I D NG  LA  +   S Y EP  +    E   +L  VL  +  E I +KL     F
Sbjct: 60  RGTIYDANGAALAVSVEMDSCYAEPKSMEDLGEASAQLAPVL-GMPKESILKKLQGNKNF 118

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            WL+R+L+P   KRI    L G+GF  E  RFYP +  A+HV+G+  +D  G+ G+E+  
Sbjct: 119 VWLQRRLTPDVVKRIRDLDLEGIGFVKETKRFYPNSEVAAHVIGFTGLDPEGLEGVERRY 178

Query: 236 D--MQGLTRVFTTNKGE--KNL-------------QPIRLALDLRIQNIVHQELVENKKK 278
           D  + G T    T +    +N+               + L LD  IQ I  +EL +  +K
Sbjct: 179 DSTILGGTGYLVTERDALGRNVALKGTVIQNGAMGHDVTLTLDKNIQYIAEKELAQAVEK 238

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A +   ++++  TG+V++M + P ++ +       + W NR     +E GS FK F +
Sbjct: 239 SGARAGTALVMDPHTGKVLAMANYPTFNLNSHASYSPQVWRNRAVADSYEPGSTFKTFLV 298

Query: 339 AMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  ++  +    D  +       +G   IHD H   R L+I E+ +YSSNIGAA+I   +
Sbjct: 299 AAALEEKVIRPGDGINCEGGSYAIGGRTIHDTHKYGR-LSIAEVLKYSSNIGAAKIGSRL 357

Query: 398 GIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTAVA 455
           G      +L   G+  +   +LP E+     P SQW  I   TISFG G++T+ LQ A A
Sbjct: 358 GPSRLYTYLKNFGIGDRSGVDLPGEVGGSLRPWSQWYGIDLATISFGQGVTTSSLQLASA 417

Query: 456 AAALINEGRLIPPTFMIRSREESE---------KVSRIVLKKNTVKTMRSLLREGVT--G 504
            +A+ N G L+ P +++    +SE         +V R V+   T KT+  ++ EGV   G
Sbjct: 418 VSAIANGGVLMKP-YLVEKITDSEGNVVTSFEPQVRRRVISPETAKTVSRMM-EGVAAEG 475

Query: 505 GSGRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
           G+G  A V G+ V GKTGTAQKV  +   YS T    SF+   P   P+  +L  +D PK
Sbjct: 476 GTGTNASVEGYRVAGKTGTAQKVDPVTHGYSATKRTASFIGFVPADRPRITILVVIDEPK 535

Query: 563 IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
                    G+  AP   +I  ++   L V P
Sbjct: 536 TSPY----GGVVAAPAFSSIALQTLCYLKVPP 563


>gi|283379442|dbj|BAI66127.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
          Length = 582

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 275/545 (50%), Gaps = 33/545 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV+  +D P     N   +G+   P+   ++  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVVVTIDEPTA---NGYYSGVVTGPVFKQVMGGSLNI 563

Query: 590 LGVKP 594
           LGV P
Sbjct: 564 LGVSP 568


>gi|254485487|ref|ZP_05098692.1| penicillin-binding protein [Roseobacter sp. GAI101]
 gi|214042356|gb|EEB82994.1| penicillin-binding protein [Roseobacter sp. GAI101]
          Length = 471

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 219/405 (54%), Gaps = 20/405 (4%)

Query: 206 RFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT---NKGEKNLQPIRLALDL 262
           R YP  + A+H++G       G+ G E  + + G  + F     N    N +P+ L++D+
Sbjct: 57  RLYPNGALAAHIMGGASFGKEGVHGAE-VIGVAGAEKYFDDYLRNPANGN-KPLELSIDM 114

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDP----HEAFKGKKEG- 317
            +Q    + L    K  NA+   +V+++V TGEVIS VS+P +DP    H A  G     
Sbjct: 115 TVQAASERILYGGMKLMNAKGATSVLMDVHTGEVISAVSLPSFDPNDRPHVAVSGDASDS 174

Query: 318 -WFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNR-I 375
             FNR   G++E+GS+FK+F  A  ID GL T   + DT  P+KVG   I ++H +N   
Sbjct: 175 PLFNRSVQGVYELGSVFKIFAAAQAIDLGLVTADTVIDTSGPMKVGGFRIGEFHNKNYGK 234

Query: 376 LTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA--PSYPSQWKR 433
            T+  I  +SSN G+ ++A  +G +  +EFL  LG       E+ E     P  P +W+ 
Sbjct: 235 QTVTGIIVHSSNRGSGRLALQIGAERQQEFLKSLGFFEPTPFEIVEASGGKPLLPKRWEE 294

Query: 434 IHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKT 493
           + S+TIS+GHGLS++P+  A   + + N G+ I PT +   ++   K+   V+ ++T   
Sbjct: 295 LSSVTISYGHGLSSSPMHLAAGYSTIANGGKKIVPTLL---KQYGPKMGERVMSESTASD 351

Query: 494 MRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQY 552
            R +LR  VT G+   A VPG++V GKTGTA K   +  Y +    N+F ++FP  DP+Y
Sbjct: 352 ARKMLRAVVTEGTASFAEVPGYQVAGKTGTADKPGPRGGYLEDKVINTFASMFPAHDPKY 411

Query: 553 IVLSFMDSP--KIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           +++  +D P     E+ + TAG    P+   +IRR A +LG++P 
Sbjct: 412 VLILTLDEPVETSGEKPRRTAGWTAVPIAAEMIRRIAPLLGLRPT 456


>gi|77919802|ref|YP_357617.1| peptidoglycan synthetase [Pelobacter carbinolicus DSM 2380]
 gi|77545885|gb|ABA89447.1| peptidoglycan synthetase FtsI [Pelobacter carbinolicus DSM 2380]
          Length = 656

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 162/511 (31%), Positives = 246/511 (48%), Gaps = 39/511 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  I DRNG  LA      S++ EP +V   D     L   L  +    +R+KL+S+ +F
Sbjct: 60  RGAIYDRNGAALARSTSVDSIFAEPFRVSDVDASARVLAKPL-GMTRAALRKKLASKRRF 118

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            WL+RK+ P Q   +    L G+ F  E  RFYP    A+ ++G+  +D +G+ G+EK+ 
Sbjct: 119 VWLQRKVQPDQSAMVRKLKLRGIAFTKEHQRFYPNGQLAAQLLGFTGLDPKGLEGLEKYY 178

Query: 236 DMQ-----------------GLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKK 278
           D Q                 GL       +G  +   + L +D  +Q +  +EL    K 
Sbjct: 179 DSQLLGQEGFLVAAKDGRRKGLGASDKVIQGGSHGNSLYLTIDRNLQYLAEKELAVALKD 238

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A +   V+L+  TGE+++M + P Y+P+   +       NR     FE GS  KVF  
Sbjct: 239 AKARAGSVVMLDPVTGEILAMANQPTYNPNAYGRFPAAYRRNRAVCDEFEPGSTLKVFLT 298

Query: 339 AMGIDSGLFTVKDLFDT-RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  ++  L   + L D  +   +VG   IHD+HP  + LT+ E+   SSNIG+A+I   +
Sbjct: 299 AAALNENLVQPQRLVDCEKGAFRVGGMTIHDHHPYEQ-LTVTEVLSKSSNIGSAKIGKIL 357

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVA 455
             Q + ++L   G   K   + P   +     P+QW       ISFG G++ T LQ A A
Sbjct: 358 ERQRYFDYLTHFGFGEKTGLDFPGEASGQLRRPNQWFEGDLAAISFGQGMTVTALQLARA 417

Query: 456 AAALINEGRLIPPTF---MIRSREE-----SEKVSRIVLKKNTVKTMRSLLREGVT--GG 505
            AA+ N G L+       ++  R E     S KV+R V+ +     +R+++ E VT  GG
Sbjct: 418 TAAIANGGVLMEADLVKQVVDDRGEIVERRSPKVARRVVSQKAAAQVRAMM-ELVTQEGG 476

Query: 506 SGRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           +G  A VPG+ VGGKTGTAQKV  +   YS      SF+   P   P+ ++L  +D PK 
Sbjct: 477 TGTLAAVPGYRVGGKTGTAQKVDPVTGGYSADKRVASFVGFAPANHPRIVILVVIDEPK- 535

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               Q+  G+  AP+   +  ++   LGV P
Sbjct: 536 ---TQVYGGLVAAPVFSRLAGQALLYLGVPP 563


>gi|239999613|ref|ZP_04719537.1| penicillin-binding protein 2 [Neisseria gonorrhoeae 35/02]
 gi|268595424|ref|ZP_06129591.1| penicillin binding protein 2 [Neisseria gonorrhoeae 35/02]
 gi|24559775|gb|AAN61107.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
 gi|24559777|gb|AAN61108.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
 gi|24559779|gb|AAN61109.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
 gi|24559781|gb|AAN61110.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
 gi|268548813|gb|EEZ44231.1| penicillin binding protein 2 [Neisseria gonorrhoeae 35/02]
 gi|312983308|gb|ADR30450.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|317164865|gb|ADV08406.1| penicillin-binding protein 2 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 582

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 274/545 (50%), Gaps = 33/545 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+   P+   ++  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVTGPVFKQVMGGSLNI 563

Query: 590 LGVKP 594
           LGV P
Sbjct: 564 LGVSP 568


>gi|32345906|gb|AAM97247.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 257/505 (50%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  S  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  +N + I L+LD RIQ + + EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTMLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+   P    I+  S ++LGV P 
Sbjct: 545 GGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|509159|emb|CAA42186.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 259/505 (51%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTALTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+   P+   ++  S ++LGV P 
Sbjct: 545 GGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|257092214|ref|YP_003165855.1| peptidoglycan glycosyltransferase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044738|gb|ACV33926.1| Peptidoglycan glycosyltransferase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 583

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 151/509 (29%), Positives = 252/509 (49%), Gaps = 38/509 (7%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS 170
           E   SR  I DR+G++LA   P  S++  P       E  ++L  +L   D + + RKL 
Sbjct: 69  EISASRGRIADRHGDVLAISTPMKSIWAIPPATTLTSEQSKQLAALL-ETDPKQLSRKLD 127

Query: 171 SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITG 230
           +E  F +LRR++ P   +++ +  LPG+G   E  RFYP     +H+VG+  +D++G+ G
Sbjct: 128 TEKTFVFLRRQIPPPVAEQVAALKLPGIGQNKEYRRFYPTGEMTAHMVGFTGVDDKGLEG 187

Query: 231 IE-----KFLDMQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVE 274
           +E     + L   G   V    +G+           ++ + IRLALD +IQ + + +L +
Sbjct: 188 VELAFHGQLLGEPGSRSVIKDRRGQIVEDVGSIKPPQDGKDIRLALDSKIQYLAYSQLKQ 247

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
                NA++ G V+L+V TGE++++ + P Y+P+           NR     FE GS  K
Sbjct: 248 AIADNNAKAGGVVVLDVRTGEILALANWPTYNPNNRENLSGSQLRNRAVTDTFEPGSTLK 307

Query: 335 VFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
            FTIA+G+++G      + +     + +G   I D HP    L++ E+ + SSN+GAA+I
Sbjct: 308 PFTIALGLENGKVRSDTIINCAPGRLTIGNATISDAHPHG-ALSVAEVIQKSSNVGAAKI 366

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS-------QWKRIHSLTISFGHGLS 446
           A  +  Q   E    +G       +LP +  P   S        W+ I   T+++GHG+S
Sbjct: 367 AAMLPYQKMWEMFDDVGF-----GQLPRLGFPGEVSGRLRPWKNWRPIEQATMAYGHGIS 421

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGG 505
            + +Q A A +    +G L+P    +   + S      V    T + +R++L   V  GG
Sbjct: 422 VSLIQLARAYSVFARDGDLVP--LSLTRADSSLPHGASVFSPKTAREVRAMLEMAVLPGG 479

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +  +A +PG+ V GKTGTA K+   RY++    +SF+   P +DP+ IV   +D P   +
Sbjct: 480 TAPKAQIPGYRVAGKTGTAHKLAGGRYANKY-VSSFVGFAPASDPRLIVAVMIDEPSAGK 538

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
                 G   AP+  +++  S   LG+ P
Sbjct: 539 H---YGGDVAAPVFASVMGSSLRTLGIAP 564


>gi|84657452|gb|ABC60054.1| penicillin-binding-protein 2 [Neisseria gonorrhoeae]
          Length = 581

 Score =  227 bits (579), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 159/546 (29%), Positives = 273/546 (50%), Gaps = 33/546 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQXGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+   P    I+  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVAGPPFKKIMGGSLNI 563

Query: 590 LGVKPV 595
           LG+ P 
Sbjct: 564 LGISPT 569


>gi|292385866|gb|ADE22248.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983286|gb|ADR30439.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983288|gb|ADR30440.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983290|gb|ADR30441.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983292|gb|ADR30442.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983294|gb|ADR30443.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983296|gb|ADR30444.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983298|gb|ADR30445.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983300|gb|ADR30446.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983302|gb|ADR30447.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 581

 Score =  227 bits (579), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 159/546 (29%), Positives = 273/546 (50%), Gaps = 33/546 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+   P    I+  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVAGPPFKKIMGGSLNI 563

Query: 590 LGVKPV 595
           LG+ P 
Sbjct: 564 LGISPT 569


>gi|283379440|dbj|BAI66126.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
          Length = 582

 Score =  226 bits (577), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 273/545 (50%), Gaps = 33/545 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGT +K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTVRKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+   P+   ++  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVTGPVFKQVMGGSLNI 563

Query: 590 LGVKP 594
           LGV P
Sbjct: 564 LGVSP 568


>gi|31296623|gb|AAP46604.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  226 bits (577), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 258/504 (51%), Gaps = 33/504 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
            G+   P+   ++  S ++LGV P
Sbjct: 545 GGVVTGPVFKQVMGGSLNILGVSP 568


>gi|509118|emb|CAA42193.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  226 bits (576), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 260/505 (51%), Gaps = 35/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + V+K +T K +R L+   VT  GG+G  
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 487 GAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G+   P+   ++  S ++LGV P
Sbjct: 544 YGGVVTGPVFKQVMGGSLNILGVSP 568


>gi|38422637|emb|CAD70592.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  226 bits (575), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 254/504 (50%), Gaps = 33/504 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVVPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
            G+   P    I+  S ++LGV P
Sbjct: 545 GGVVTGPPFKKIMGGSLNILGVSP 568


>gi|509043|emb|CAA42187.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 156/504 (30%), Positives = 254/504 (50%), Gaps = 33/504 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVVPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
            G+   P    I+  S ++LGV P
Sbjct: 545 GGVVTGPPFKKIMGGSLNILGVSP 568


>gi|77166318|ref|YP_344843.1| peptidoglycan glycosyltransferase [Nitrosococcus oceani ATCC 19707]
 gi|254435357|ref|ZP_05048864.1| Penicillin-binding Protein dimerisation domain family
           [Nitrosococcus oceani AFC27]
 gi|76884632|gb|ABA59313.1| peptidoglycan synthetase FtsI [Nitrosococcus oceani ATCC 19707]
 gi|207088468|gb|EDZ65740.1| Penicillin-binding Protein dimerisation domain family
           [Nitrosococcus oceani AFC27]
          Length = 570

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 167/561 (29%), Positives = 275/561 (49%), Gaps = 45/561 (8%)

Query: 68  AHSKNRIGMTIVVCLVIYIILA--------IRIIQYGNIHPEPIAPSMNIDEYGMSRPDI 119
            H K+  G   VV LV  + +A        ++++    +  E  A  + + +    R  I
Sbjct: 6   GHDKDYPGRLGVVGLVFAVAVAGLAWRLIELQVLDCDFLRGEGEARHLRVVKMPAHRGII 65

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQ----IVLPNLDSEMIRRKLSSETKF 175
            DR+GE LA   P  S++  P  +    E    L     + + +L+    R K   E +F
Sbjct: 66  TDRHGEPLAVSTPVASIWFNPQLLGKAREQWRALAKAAGVSMAHLEK---RIKEGGEREF 122

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +L R + P   +R+ +  +PGV  + E  R+YPA   A+HVVG+ +ID+RG  G+E   
Sbjct: 123 VYLNRWVEPDVAQRVQALDIPGVNLQSEYRRYYPAGPVAAHVVGFTNIDDRGQEGLELAF 182

Query: 236 D-----MQGLTRVFTTNKGE-----KNLQ------PIRLALDLRIQNIVHQELVENKKKY 279
           D     + G  RV   ++G      +NL+       +RL++DLR+Q + ++EL    + +
Sbjct: 183 DETLRGIPGKKRVIQDSRGRVVEDVENLRVPRPGRDLRLSIDLRLQYLAYRELKTAVQAH 242

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
           NA +   VIL+V TGEV++MV+ P Y+P++  + K   + NR    +FE GS  K FTI 
Sbjct: 243 NARAGSLVILDVGTGEVLAMVNQPSYNPNDRSQLKSHLYRNRAVTDLFEPGSTIKPFTIG 302

Query: 340 MGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           + ++SG +      DT     +VG++ I D     RI  +  + + SSN+GA++IA ++ 
Sbjct: 303 IALESGKYYPHTPIDTAPGYFRVGRYTIRDIRNYGRI-DVSTVIKKSSNVGASKIALSLD 361

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPS----QWKRIHSLTISFGHGLSTTPLQTAV 454
            Q   +   + GL +   +  P       P+     ++ I   T++FG+GLS TPLQ A 
Sbjct: 362 PQRLWQGFSQAGLGASTASGFPGEAEGHLPNPRFFPFREIEQATLAFGYGLSVTPLQLAR 421

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVP 513
           A AAL   G L P +F+ R   E     R V  +     + S+L E ++ GG+G RA+VP
Sbjct: 422 AYAALGAGGELKPVSFLYR---EQAIKGRQVWSEGIAPAVLSMLEEVISDGGTGERAYVP 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
            + V GKTGT +K  +  Y+       F  + P + P+   +  +D P+ K       G 
Sbjct: 479 SYRVAGKTGTVKKATRGGYAKERYLAVFAGLIPASHPRLAAVVLIDEPQGK----YYGGQ 534

Query: 574 NVAPMVGNIIRRSASMLGVKP 594
             AP+   ++  +  +L + P
Sbjct: 535 VAAPVFSQVMIGAMRLLNIAP 555


>gi|150283|gb|AAA25465.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 157/504 (31%), Positives = 258/504 (51%), Gaps = 33/504 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTALTHDGVLLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
            G+ V P+   ++  S ++LGV P
Sbjct: 545 GGVVVGPVFKEVMSGSLNILGVSP 568


>gi|298369644|ref|ZP_06980961.1| penicillin binding protein transpeptidase domain-containing protein
           [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282201|gb|EFI23689.1| penicillin binding protein transpeptidase domain-containing protein
           [Neisseria sp. oral taxon 014 str. F0314]
          Length = 581

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 161/508 (31%), Positives = 255/508 (50%), Gaps = 40/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVIS-PDEI-IEKLQIVLPNLDSEMIRRKLSSE 172
           SR  I DRNG  LA   PT SL+  P ++   P E  +EKL  ++ ++    I+ KL  +
Sbjct: 74  SRGMITDRNGATLALSAPTESLFAMPSEMDEMPTEAQLEKLSSII-DVPVASIKEKLGKK 132

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F +L+R+LS ++   I + G+ G GF+ E  R YP  +  +HV+G+ +ID +G  G+E
Sbjct: 133 KDFIYLKRQLSKEKADEIAALGIKGFGFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGLE 192

Query: 233 K-----FLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELVE 274
                      G   V   NKG              KN + + L+LD RIQ + ++EL +
Sbjct: 193 LSREDILRGSDGAKVVLRDNKGNIVDSLDSPRNNAPKNGRDMVLSLDQRIQTLAYEELNK 252

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
               + A++   V+L+  TGE++++V+ P YDP++      E   NR    + E GS  K
Sbjct: 253 AVDYHQAKAGTVVVLDAQTGEILALVNSPAYDPNQPGSAGSEQRRNRAVTDMIEPGSAMK 312

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQ 392
            FTIA  +DSG       F+T NP K+G   + D H  P    L +  I + SSN+G ++
Sbjct: 313 PFTIAKALDSGKVNTSQRFNT-NPYKIGPATVRDTHVYPS---LDLRGIMQKSSNVGTSK 368

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKR---IHSLTISFGHGLSTTP 449
           ++     +   +F + LG+  ++ +  P  ++      WKR   I   T+SFG+GL  + 
Sbjct: 369 LSAMFKPKEMYDFYHDLGVGVRMHSGFPG-ESAGLLRNWKRWRPIEQATMSFGYGLQLSL 427

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L + G L+P +F    ++      + V+K  T + +R ++   VT  GG+G
Sbjct: 428 LQLARAYTMLTHNGELLPVSF---EKQAVAPEGKRVIKAETARQIREMM-VAVTEPGGTG 483

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K+I  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 484 TAGAVDGFDVGAKTGTARKLINGRYVDNKHVATFVGFAPAQNPRVIVAVTVDEPTA---N 540

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G    P+   ++  S ++LGV P 
Sbjct: 541 GYYGGTVAGPVFKQVMSGSLNILGVSPT 568


>gi|110833453|ref|YP_692312.1| penicillin-binding protein 3 [Alcanivorax borkumensis SK2]
 gi|110646564|emb|CAL16040.1| penicillin-binding protein 3 [Alcanivorax borkumensis SK2]
          Length = 573

 Score =  225 bits (574), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 159/541 (29%), Positives = 265/541 (48%), Gaps = 32/541 (5%)

Query: 77  TIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSL 136
           ++  CL++   + +++IQ+  +  +    ++ ++     R  I DR G+ LA   P  +L
Sbjct: 25  SVCACLLLIRAVDLQVIQHDFLAHQGDIRNLRVEPLAAHRGVIRDRAGKPLAVSTPVVTL 84

Query: 137 YVEPHKVISPDEIIEKL---QIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
           +V P + +   +   +L    ++     +  +RR  S E  F +L R L+P+  K +LS 
Sbjct: 85  WVNPREAMEHQDQWGRLAGNSVIDQKAFARKVRRHKSRE--FIYLERGLAPETAKTVLSL 142

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--MQG-----------L 240
            +PGV    E  R+YPA   ASHVVG+ +ID++G  GIE  L+  + G           L
Sbjct: 143 NVPGVYALTEYRRYYPAGEVASHVVGFTNIDDQGQEGIELALEDHLSGHSGRKKVVRDLL 202

Query: 241 TRVFTTNKGEKNLQP---IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
            RV    +  +  +P   + L++DLR+Q + ++EL+   +K+NA+    V+L+V TGEV+
Sbjct: 203 GRVIQDIEVLEPAEPGEDVTLSIDLRLQYLAYRELLGAVQKFNAKGGSAVVLDVRTGEVL 262

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +MV+ P Y+P+           NR    +FE GS  K FT+A  ++ G+ T     +T  
Sbjct: 263 AMVNQPAYNPNNRGNLDTGALRNRAVTDLFEPGSTMKPFTVAAALEMGMVTPSTTINTHP 322

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             ++VG   I D H    ++ I  +   SSN+G +++A AM  Q    +L R G      
Sbjct: 323 GTLRVGSKTIRD-HRDYGVIDITTVLTKSSNVGTSKLALAMDSQALPGYLERFGFGQSTH 381

Query: 417 TELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              P       P  S+W+ +    +S+G+GLS + +Q A A A + N+G  +P T     
Sbjct: 382 IAFPGESDGLLPLRSKWRDVERAALSYGYGLSVSAVQLAQAYAVIANDGVKVPLTL---K 438

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + +       V+ K T + +  +L   V+  G+ RRA VPG++V GKTGT  KV+   Y+
Sbjct: 439 KVDQPPQGEQVIGKATARQLVQMLETVVSRVGTARRAQVPGYQVAGKTGTVHKVVNGGYA 498

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
           D      F  + P TDP+ + +  +D P     +    G+  AP    I+      L V 
Sbjct: 499 DDNYIGLFAGLAPATDPRIVTVVVIDDPA---GDAYYGGLVAAPAFSRIMSGVLRSLHVP 555

Query: 594 P 594
           P
Sbjct: 556 P 556


>gi|270288688|dbj|BAI52921.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 581

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 158/546 (28%), Positives = 272/546 (49%), Gaps = 33/546 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   + +   P    I+  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSSVVAGPPFKKIMGGSLNI 563

Query: 590 LGVKPV 595
           LG+ P 
Sbjct: 564 LGISPT 569


>gi|329025417|dbj|BAK19153.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
          Length = 582

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 154/504 (30%), Positives = 259/504 (51%), Gaps = 33/504 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  S  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS+ 
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSVM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K F IA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFPIAKALDSGKVDTTDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGESAGVLRNWRKWRPIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GGSG   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGSGIAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
           +G+   P+   ++  S ++LGV P
Sbjct: 545 SGVVTGPVFKQVMGGSLNILGVSP 568


>gi|19911238|dbj|BAB86942.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 582

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 273/545 (50%), Gaps = 33/545 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRN  +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNVAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+   P+   ++  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVTGPVFKQVMGGSLNI 563

Query: 590 LGVKP 594
           LGV P
Sbjct: 564 LGVSP 568


>gi|319786247|ref|YP_004145722.1| peptidoglycan glycosyltransferase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464759|gb|ADV26491.1| Peptidoglycan glycosyltransferase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 607

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 156/501 (31%), Positives = 253/501 (50%), Gaps = 30/501 (5%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++  P +++  PD + E  + +   LD    R    ++ 
Sbjct: 67  SRGMITDRNGEPLAVSTPVESIWANPQELLRYPDRLPELAKALDVPLDQLSTRLSQRADK 126

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P Q K IL+  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 127 EFVYLKRRINPDQAKAILAHNVPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 186

Query: 234 FLD-----MQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKK 277
             D       G  RV     G   +N+  +R         L++D RIQ + ++EL    +
Sbjct: 187 AFDEWLRGKPGAKRVIRDRHGRIVENIDLVRPAEPGKDLVLSIDRRIQFLAYRELRAALE 246

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           K NA S   V+L+V TGEV++MV++P Y+P+    G  +   NR+   + E GS  K  T
Sbjct: 247 KNNAASGSAVVLDVPTGEVLAMVNLPSYNPNAVSGGNPDSRRNRVVTDLIEPGSTMKPIT 306

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G       FDT +P  + +G+  I D H    +L +  I   SSN+GA  +A 
Sbjct: 307 VAAALSAGKVRPTTRFDT-SPGYMGLGRFTIRD-HRNYGVLDVTGIITKSSNLGAVMLAQ 364

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            M  Q   +F+   G  S   +  P   A     P++W  +   T+S+G+GLS TPLQ A
Sbjct: 365 GMDDQYFYDFVRGFGYGSPPRSGFPGEAAGVLRPPARWDGLTKATMSYGYGLSATPLQIA 424

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A AAL N GRL  PTF+     ES +V    +    ++ M+++      GG+  +A + 
Sbjct: 425 QAYAALGNHGRLTTPTFVKGQINESRQVVAPEIADEVLRMMQTVTE---PGGTATQAAIL 481

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           G+ V GKTGTA++     Y+      +F  + P ++P++  +  ++ P+        AG+
Sbjct: 482 GYHVAGKTGTARQASAGGYARRYT-TTFAGLVPASNPRFATVVVINDPQA---GSYYAGL 537

Query: 574 NVAPMVGNIIRRSASMLGVKP 594
              P+   ++  +  ++ V P
Sbjct: 538 VSGPVFRAVMEDALRVMDVPP 558


>gi|32345908|gb|AAM97248.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 157/505 (31%), Positives = 257/505 (50%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+   P    I+  S ++LGV P 
Sbjct: 545 GGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|30248988|ref|NP_841058.1| penicillin binding protein transpeptidase domain-containing protein
           [Nitrosomonas europaea ATCC 19718]
 gi|30138605|emb|CAD84896.1| Penicillin binding protein transpeptidase domain [Nitrosomonas
           europaea ATCC 19718]
          Length = 580

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 152/509 (29%), Positives = 267/509 (52%), Gaps = 32/509 (6%)

Query: 107 MNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIR 166
           + + E    R  I DRNGEILA   P  S++V+P +V +  E I +L  +L +++   ++
Sbjct: 59  LRVIEQNSQRGSIKDRNGEILAISAPVKSVWVDPKRVSATSEQIGQLADLL-DMNKATVQ 117

Query: 167 RKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR 226
            +LSS+ +F +L+R+L P++  +I    + G+  + E  R+YP+   A+H++G+ D+D R
Sbjct: 118 ERLSSDKRFVYLKRQLPPERANKIAELNIKGLYLKHEFYRYYPSRELAAHILGFTDVDGR 177

Query: 227 GITGIE-KFLDM----QGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQ 270
           G  G+E  + D+     G  RV     G            K+ Q + L++D +IQ + ++
Sbjct: 178 GQEGVELAWQDVLTGEDGKRRVIKDRIGRVVEDVGQIRSPKSGQDVVLSIDSKIQYLAYR 237

Query: 271 ELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG 330
           EL    K+ +A++   V L+V TGEV++M + P ++P++      E   NR+    FE G
Sbjct: 238 ELARAVKEQHAKAGSIVALDVKTGEVLAMANYPAFNPNQRASMNNEVIRNRVLVDTFEPG 297

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           S  K F IA+ +++G      L +T    +++G+ VI D   +   LT+ ++ + SSN+G
Sbjct: 298 STLKPFAIAVALETGRVKANTLMETSGGMMRIGRAVIRDVRDKGN-LTVSQVIQTSSNVG 356

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELP---EIQAPSYPSQWKRIHSLTISFGHGLS 446
           AA+IA  +  +   E L R G  ++     P     Q  +Y ++W+ I   T+S+GHG+S
Sbjct: 357 AAKIALLLPPKTFWEMLNRSGFGTETGIGFPGEASGQLRAY-NKWRPIEQATMSYGHGIS 415

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GG 505
            + +Q   A      +G L P T + R   ++  V + V+ + T +++R +L   V   G
Sbjct: 416 VSLMQLVRAYTLFATDGELKPITLLKR---DTPAVGQKVISRETAQSVRKMLELAVQPEG 472

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKR--YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           +G  A + G+ V GKTGTA K ++KR  Y+     +SF+   P +DP+ I+   +D P  
Sbjct: 473 TGSGARINGYRVAGKTGTAHKRLEKRKGYASDRYISSFVGFAPASDPRVIMAIMIDEP-- 530

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGV 592
               +   G   AP+   ++  +  +L V
Sbjct: 531 -SDGRYYGGTVAAPVFSRVMEGTLRILNV 558


>gi|283379448|dbj|BAI66131.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 583

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 157/545 (28%), Positives = 272/545 (49%), Gaps = 32/545 (5%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   +         L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQXDTHVYPTLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 451 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 507

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+   P+   ++  S ++
Sbjct: 508 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVTGPVFKQVMGGSLNI 564

Query: 590 LGVKP 594
           LGV P
Sbjct: 565 LGVSP 569


>gi|39998165|ref|NP_954116.1| penicillin-binding protein [Geobacter sulfurreducens PCA]
 gi|39985111|gb|AAR36466.1| penicillin-binding protein [Geobacter sulfurreducens PCA]
 gi|298507103|gb|ADI85826.1| peptidoglycan transglycosylase and transpeptidase FtsI [Geobacter
           sulfurreducens KN400]
          Length = 657

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 168/554 (30%), Positives = 256/554 (46%), Gaps = 51/554 (9%)

Query: 77  TIVVCLVIYIILAIR--IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTF 134
           ++VVC   Y+ +  R  +++  +   + I P         +R  I D NG  LA  +   
Sbjct: 25  SLVVCRAFYLQVVKRDHLLKLADRQHQKIVPLTP------ARGTIYDANGSALAVSVEMD 78

Query: 135 SLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFG 194
           S + EP  +   D+   +L  VL     E + RKL     F WL+R+L+P   KRI +  
Sbjct: 79  SCFAEPKSIADLDDAAARLSPVL-GFPKETLLRKLQGNKNFVWLQRRLTPDVVKRIRALN 137

Query: 195 LPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--MQGLTRVFTTNKGEKN 252
           + G+GF  E  RFYP +  A+HV+G+  +D  G+ GIE   D  + G T    T +    
Sbjct: 138 IDGIGFVKETKRFYPNSEVAAHVIGFTGVDPEGLEGIELRYDSTILGGTGYLVTERDALG 197

Query: 253 L---------------QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
                             + L LD  IQ I  +EL +      A +   ++++  TG V+
Sbjct: 198 RDVALKGTVIQDGAMGHNVVLTLDKNIQYIAEKELAKAVDGSGARAGTAIVMDPHTGRVL 257

Query: 298 SMVSIPDY--DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +M + P +  + H A+   +  W NR     +E GS FKVF IA  ++  +    D  + 
Sbjct: 258 AMANYPTFNLNAHGAY--HQSLWRNRAVADSYEPGSTFKVFLIASALEEKVIRPGDRINC 315

Query: 356 R-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
                 +G   IHD H     L+IPEI +YSSNIG+A+I   +G      +L   G  ++
Sbjct: 316 EGGSFSIGGRTIHDTHKYGS-LSIPEILKYSSNIGSAKIGSRLGASRLYSYLRNFGFGAR 374

Query: 415 LETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
              +LP     +    +QW  I   T+SFG G++ + +Q A A +A+ N G L+ P  + 
Sbjct: 375 TGIDLPGEAGGTLRDWNQWYGIDLATVSFGQGVTASSIQLAAAFSAIANGGTLMKPYLVE 434

Query: 473 RS--------REESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTG 522
           R         +  S +  R V+ + T K +  ++ EGV   GG+G  A V GF V GKTG
Sbjct: 435 RVVDSEGNVIKSSSPQPLRRVVSETTAKNVARMM-EGVAVEGGTGTNAAVEGFRVAGKTG 493

Query: 523 TAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           TAQKV  + + YS T    SF+   P   P+  +L  +D PK         G+  AP   
Sbjct: 494 TAQKVDPVTRGYSLTKRTASFIGFVPADRPRLTILVMVDEPKTSP----YGGVVAAPAFS 549

Query: 581 NIIRRSASMLGVKP 594
           +I  +S   L V P
Sbjct: 550 SIALQSLCYLKVPP 563


>gi|118581695|ref|YP_902945.1| peptidoglycan glycosyltransferase [Pelobacter propionicus DSM 2379]
 gi|118504405|gb|ABL00888.1| peptidoglycan synthetase FtsI [Pelobacter propionicus DSM 2379]
          Length = 657

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 158/510 (30%), Positives = 238/510 (46%), Gaps = 37/510 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  I+DRNG  LA  +  +S Y E   +   +     L   L     E++R K+ +   F
Sbjct: 60  RGAIMDRNGNNLAVSVEMYSCYGEARHIQDVEATATALAPFLEVPRQEIVR-KIRNSRNF 118

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            WL R++ P++  RI +  L G+GF  E  RFYP +  A+HV+G+  ID  G+ G+E   
Sbjct: 119 VWLERRIPPERATRIRNLKLRGIGFAPETKRFYPNSEVAAHVIGFTGIDPNGLDGVEFKY 178

Query: 236 D--MQGLTRVFTTNKGE--KNLQP-------------IRLALDLRIQNIVHQELVENKKK 278
           D  + G T +  T +    +++ P             + L LD  IQ I  +EL +    
Sbjct: 179 DSVILGNTGLLVTERDALGRDIAPRAELVKSSSPGKNVVLTLDKNIQYITEKELAQAVTS 238

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A+    ++L   +G V++M + P ++P+  F+       NR     FE GS FKVF I
Sbjct: 239 SGAKGGMALVLEPDSGRVLAMANYPTFNPNSYFRYSHAELRNRAVADSFEPGSTFKVFLI 298

Query: 339 AMGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  ++  L    D F   N    +  H +HD H   R L++ +I +YSSNIGAA+I   +
Sbjct: 299 AAALNERLVRPTDAFHCENGSYTIATHTVHDTHSYGR-LSVSDILKYSSNIGAAKIGFKL 357

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVA 455
           G      +L+  G   +   +LP     +  S  +W  I   TISFG G+S + +Q A A
Sbjct: 358 GSDRLSRYLHNFGFGERSGIDLPGESPGNMRSRQRWYGIDLATISFGQGISASSIQLATA 417

Query: 456 AAALINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGS 506
            +A+ N G L+ P  + R  ++S         + V R++      K  R +      GG+
Sbjct: 418 ISAVANGGNLMKPYVVERILDDSGNELQRFTPQVVRRVISADTAAKVTRMMETVTAEGGT 477

Query: 507 GRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK 564
           G  A V GF V GKTGTAQK   + +RYS +    SF+   P   P+  +L  +D P   
Sbjct: 478 GTNAAVEGFRVAGKTGTAQKADPVTRRYSASKRTASFIGFIPADRPRLTILVVIDEP--- 534

Query: 565 ERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            R     G+  AP    I   S + L V P
Sbjct: 535 -RTSSYGGVVAAPAFRGIALNSLAYLKVLP 563


>gi|31296567|gb|AAP46576.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296589|gb|AAP46587.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 260/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAEEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + V+K +T K +R L+   VT  GG+G  
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 487 GAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P    I+  S ++LGV P 
Sbjct: 544 YGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|32345910|gb|AAM97249.1| PenA [Neisseria meningitidis]
 gi|32345912|gb|AAM97250.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 154/504 (30%), Positives = 254/504 (50%), Gaps = 33/504 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRA 510
            A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G   
Sbjct: 431 LARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAG 487

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N   
Sbjct: 488 AVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYY 544

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
            G+    +   ++  S ++LGV P
Sbjct: 545 GGVVAGSVFKQVMGGSLNILGVSP 568


>gi|224368378|ref|YP_002602541.1| FtsI [Desulfobacterium autotrophicum HRM2]
 gi|223691094|gb|ACN14377.1| FtsI [Desulfobacterium autotrophicum HRM2]
          Length = 581

 Score =  223 bits (569), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 157/510 (30%), Positives = 253/510 (49%), Gaps = 38/510 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R +I+DRN + L T I   S+ V P ++ +P +    +  VL  +D   +  K+SS   F
Sbjct: 60  RGEILDRNLKRLCTTIDALSVAVFPKRLGNPAKDARSIAAVL-GMDPVKLAGKISSSKNF 118

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++RK+SP + + +    L G+ F+ +  RFYP  + A+ V+G+   D++G+ G+E   
Sbjct: 119 VWVKRKISPAEVEALKGLNLTGLSFQKDVVRFYPNRTLAAQVIGFTGSDSKGLEGLEYGY 178

Query: 236 D--MQGLTRVFTTNK--------GEKNLQPIR------LALDLRIQNIVHQELVENKKKY 279
           +  ++G    FT  K         +KNL  +       L +D  IQ I    L     ++
Sbjct: 179 EDVLKGKQSKFTITKDAAGRRLDADKNLSEVLSGGGLVLTIDRNIQYITEGALKNVVTRF 238

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
            A+S   + +   TGE++SM   P+++P+   +  +E W NR     FE GS+ KVF  A
Sbjct: 239 KAKSAMAIAMRPKTGEILSMALYPEFNPNAFSEFTRERWRNRSVTDPFEPGSVMKVFLAA 298

Query: 340 MGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
             +D G  T K +F   N   +VG + +HD H ++  LT+ +I +YSSNIGA +I++  G
Sbjct: 299 SAMDKGYCTPKSIFFCENGSYRVGSYTVHDTH-EHGWLTLAQIIKYSSNIGAVKISETTG 357

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAP---SYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
            Q   E L   G  S+     P  + P   S+  +W  I +  ISFG G+S + +Q   A
Sbjct: 358 EQALYEGLSGFGFGSRTGVSSPG-ETPGSLSFYQRWSAIDAAAISFGQGMSVSAVQLVAA 416

Query: 456 AAALINEGRLIPPTFMIRSREESEKVS--------RIVLKKNTVKTMRSLLREGVT-GGS 506
            AA+ N+G L+ P  + ++   + +V         R V+   T +T+R ++R  VT  G+
Sbjct: 417 IAAIANDGVLMRPLLVQKTLFNTGEVDQTFEPQRVRRVISARTAQTVRQMMRSVVTEDGT 476

Query: 507 GRRAFVPGFEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK 564
           G  A + G+ V GKTGTAQKV +  + Y+       F    P   P+  V+  +D P   
Sbjct: 477 GTNAAIEGYSVCGKTGTAQKVAQNGRGYAKNRYTAVFAGFAPENSPEIAVVVVVDEP--- 533

Query: 565 ERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            R     G+  AP   +I+  S   L + P
Sbjct: 534 -RGNHYGGVVAAPAFKSIVAESFHYLNIPP 562


>gi|302036126|ref|YP_003796448.1| peptidoglycan glycosyltransferase [Candidatus Nitrospira defluvii]
 gi|300604190|emb|CBK40522.1| Peptidoglycan glycosyltransferase [Candidatus Nitrospira defluvii]
          Length = 572

 Score =  223 bits (569), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 165/562 (29%), Positives = 264/562 (46%), Gaps = 41/562 (7%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           + RR V+A      G+ +   LVI  ++ ++++Q   +  +             +R  I 
Sbjct: 7   RSRRIVVA-----CGLVVAFVLVIVRLVNLQVMQSAELTVKADRQHQKNVTLEGARGTIY 61

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRN ++LA ++   S++  P  + +P      L  +L ++ +  + +KL  E  F WL R
Sbjct: 62  DRNSKVLAMNMDVPSVFGVPASLGNPGVTARNLSPIL-HVKATELEKKLKQEKHFVWLAR 120

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-------- 232
           KL P+Q +R+    L GVG  +E  RFYP     SHV+G+  +D+RG+ G+E        
Sbjct: 121 KLEPEQGRRLERLALDGVGVVMEGRRFYPKGPLLSHVLGFAGMDDRGLEGVELRYEQYLR 180

Query: 233 -----KFLDMQGLTR-VF---TTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                  L    L R VF      +G      + L +D  IQ I  +EL E   + NA+S
Sbjct: 181 GEKRAVVLQRDALGRAVFPKGLNEEGAAAGHSLTLTVDEVIQYIAEKELDEAVSRSNAKS 240

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              ++++  TG V++M   P +DP+       + W NR     +E GS  K    A  ++
Sbjct: 241 GTIIVMDPKTGAVLAMAVSPRFDPNTVGALAPDRWRNRALTDTYEPGSTMKAVIAAAALE 300

Query: 344 SGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGH 402
             + T   +    N    +   VIHD H ++  +T  ++ + SSNIGAA++  A+G    
Sbjct: 301 EKVMTPGSMIYGENGQFSIANTVIHD-HEKSGWITFAQMIQKSSNIGAAKVGMALGEWRV 359

Query: 403 KEFLYRLGLLSKLETELP--EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALI 460
            ++L   G   K   +LP   +     P QW +    +IS G  +  TPLQ   A +A+ 
Sbjct: 360 FDYLKEFGFGDKTGIDLPGEAVGLLRGPRQWGKRSLASISMGQEVGVTPLQMVTAVSAIA 419

Query: 461 NEGRLIPPTFMIRSR--------EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           N G L+ P  +   R        +   +  R V+  +T +T+ +LL   VT G+G +A +
Sbjct: 420 NGGVLMKPFVVSEIRNAKGQLVAQTMPQAKRRVISSDTARTLTTLLEGVVTNGTGGKAAI 479

Query: 513 PGFEVGGKTGTAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           PGF V GKTGTAQKV  +   YS TL   SFL   P  DP+  ++  +D P    R +  
Sbjct: 480 PGFRVAGKTGTAQKVDPRTGAYSSTLLVGSFLGYVPAEDPRLAMIVVIDEP----RGEGW 535

Query: 571 AGINVAPMVGNIIRRSASMLGV 592
            G+  AP+   +  +  + LGV
Sbjct: 536 GGVVAAPVFRRVGEQVLNYLGV 557


>gi|253699151|ref|YP_003020340.1| peptidoglycan glycosyltransferase [Geobacter sp. M21]
 gi|251774001|gb|ACT16582.1| Peptidoglycan glycosyltransferase [Geobacter sp. M21]
          Length = 654

 Score =  223 bits (569), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 160/513 (31%), Positives = 244/513 (47%), Gaps = 42/513 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLD--SEMIRRKLSSE 172
           +R  I DR     A  I   S Y E   +   D I ++   + P L   ++ +  KL   
Sbjct: 59  ARGAIYDRTNAPFAVSIEMDSCYAETRNM---DNIPQEAAQLAPLLGYGAQELEAKLKGA 115

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F WL R++ P+Q +++ + GL GVGF  E  RFYP +  A+HVVG+  ID  G+ G+E
Sbjct: 116 KNFVWLARRIPPEQARKVKALGLEGVGFVKESKRFYPNSQVAAHVVGFTGIDPGGLEGVE 175

Query: 233 KFLDM-------------QGLTRVFTTNKGEKNLQP-----IRLALDLRIQNIVHQELVE 274
           K  D                L R     KG +         + L LD  +Q I  +EL  
Sbjct: 176 KKYDATILGNTGFLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLDKNVQYIAEKELAN 235

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
              K  A++   +++   TG V++M + P ++P+     ++    NR     FE GS FK
Sbjct: 236 AVVKNGAKAGIAIVMEPDTGRVLAMANYPSFNPNSFADYEQAALRNRAIADSFEPGSTFK 295

Query: 335 VFTIAMGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           +F +A  +++G+    D+F+  N   ++    IHD H +   L++P+I +YSSNIGAA+I
Sbjct: 296 IFLVASALEAGVIRPGDMFNCENGSYRMFGRTIHDTH-KYGALSVPQILKYSSNIGAAKI 354

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQ 451
              +G +     L   G   K   +LP E      P S+W  I   TISFG G++TT LQ
Sbjct: 355 GSRLGPERLYAALTGFGFGEKSSIDLPGEASGMLRPQSKWYGIDLATISFGQGVTTTALQ 414

Query: 452 TAVAAAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGVT 503
              A + + N G L+ P  + R  ++        + +V R ++   T KT+  +L EGV 
Sbjct: 415 ITNAVSVVANGGNLMKPYLVDRIVDDNGVVLQQFAPQVKRRIISPETAKTVARML-EGVV 473

Query: 504 --GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
             GG+G  A V G+ V GKTGTAQKV  + YS +    SF+   P   P+  ++  +D P
Sbjct: 474 VEGGTGTGAAVEGYRVAGKTGTAQKVEGRGYSASKRTASFVGFVPLNKPRLAIMVVIDEP 533

Query: 562 KIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
                     G+  AP    I +++   L V P
Sbjct: 534 TTSS----YGGVVAAPAFSAIAQQTLCYLNVPP 562


>gi|297539598|ref|YP_003675367.1| peptidoglycan glycosyltransferase [Methylotenera sp. 301]
 gi|297258945|gb|ADI30790.1| Peptidoglycan glycosyltransferase [Methylotenera sp. 301]
          Length = 586

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 159/516 (30%), Positives = 257/516 (49%), Gaps = 61/516 (11%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQI----VLPNLDSEMIRRKLSS 171
           R  I DR+GE+LA   P  S++  P     PD +I+  Q      L NL  + +++KL++
Sbjct: 71  RGKITDRHGELLAISTPVESVWASP-----PDVVIDAAQTKQIAALLNLKPDEVKKKLAN 125

Query: 172 -ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDID-----N 225
            E +F +L+R++SP+   +++  G+PG+  + E  R+YPA    +H+VG+   D     +
Sbjct: 126 DEREFVYLKRRISPELAAKVMKLGIPGIELQREYKRYYPAGDVTAHMVGFTGPDDKGTGD 185

Query: 226 RGITGIEKFLD-----MQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVH 269
           RG+ G E  ++     + G  RV     G   ++LQ ++         LALDLRIQ I H
Sbjct: 186 RGLEGYELAMNGPLSGVDGSRRVIKDRSGHIIEDLQAVKVPQDGRDVSLALDLRIQYIAH 245

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEA--FKGKKEGWFNRISYGIF 327
           +ELV+  ++  A +   ++L+  TGEV++M ++P Y+P+     KGK     NR     F
Sbjct: 246 RELVKAVEENKAAAGAAIVLDAKTGEVLAMTNVPTYNPNNPVNIKGKTR---NRAIVDTF 302

Query: 328 EMGSIFKVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           E GS  K  T A  ++SG +T      T    + +G   IHD HPQ  ILT+ ++ + SS
Sbjct: 303 EPGSTLKPVTAAAALESGQYTPDTKIQTSPGSLTIGPATIHDSHPQG-ILTVAQVIQKSS 361

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ----------WKRIHS 436
           N+GA++IA  +     K+F++ +      E  L  ++   +P +          W+ I  
Sbjct: 362 NVGASKIALTL----DKQFMWNV----YNELGLGHVEGVGFPGEATGRLRPYKTWRPIEM 413

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRS 496
            T+SFGHG+S T LQ A       NEG L P + +  +     +        N+VK M  
Sbjct: 414 ATMSFGHGISLTLLQLARLYTVFANEGELRPVSLLKINEVPIGQQVFSAATANSVKDMLE 473

Query: 497 LLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLS 556
           L+ +   GG+  +A V G+ VGGKTGTA K     Y +     SF+ + P ++P++I+  
Sbjct: 474 LVVQ--PGGTAVKAQVLGYRVGGKTGTAHKPGIHGYEENKYVASFVGMAPASNPRFIIAV 531

Query: 557 FMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGV 592
            +D P          G   AP+   I+  +  +  V
Sbjct: 532 MIDEPN---NGAYYGGTVAAPVFSTIMADTLRLFAV 564


>gi|31296637|gb|AAP46611.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  223 bits (568), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 157/506 (31%), Positives = 259/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    S  +W++I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G  
Sbjct: 431 LARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 487 GAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P    I+  S ++LG+ P 
Sbjct: 544 YGGVVTGPPFKKIMGGSLNILGISPT 569


>gi|283379444|dbj|BAI66128.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
          Length = 581

 Score =  223 bits (568), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 158/546 (28%), Positives = 272/546 (49%), Gaps = 33/546 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
            + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+      +G   V  
Sbjct: 152 KALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHAGEGAEVVLR 211

Query: 246 T-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
                         NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTIA  +DSG     D 
Sbjct: 272 TGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTIAKALDSGKVDATDT 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           F+T  P K+G   + D H     L +  I + SSN+G ++++     +   +F + LG+ 
Sbjct: 332 FNTL-PYKIGSATVQDTHVYP-TLDVRGIMQKSSNVGTSKLSAMFTPKEMYDFYHDLGVG 389

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    S  +W++I   T+SFG+GL  + LQ A A   L ++G L+P +F
Sbjct: 390 VRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAYTVLTHDGELLPVSF 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
               ++      + V+K +T K +R L+      GG+G    V GF+VG KTGTA+K++ 
Sbjct: 450 ---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGFDVGAKTGTARKLVN 506

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY D  +  +F+   P  +P+ IV   +D P     N   +G+        I+  S ++
Sbjct: 507 GRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYSGVVAGLPFKKIMGGSLNI 563

Query: 590 LGVKPV 595
           LG+ P 
Sbjct: 564 LGISPT 569


>gi|119505126|ref|ZP_01627202.1| Peptidoglycan glycosyltransferase [marine gamma proteobacterium
           HTCC2080]
 gi|119459108|gb|EAW40207.1| Peptidoglycan glycosyltransferase [marine gamma proteobacterium
           HTCC2080]
          Length = 566

 Score =  223 bits (567), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 150/487 (30%), Positives = 241/487 (49%), Gaps = 31/487 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRR-KLSSETKFQW 177
           + DR GE LA   P  +L+ +P  ++     +  L   L   + ++ +R  L S+ +F +
Sbjct: 59  VTDRRGEPLAISTPVITLWADPL-ILRDSNRLGVLASALNQSEEQLQQRLDLYSDKRFMY 117

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL-- 235
           L R  +P   +R+L   + GVG + E  RFYPA   AS ++G  ++D +GI G+EK    
Sbjct: 118 LARHQTPDLARRVLGLKISGVGGKREYRRFYPAGEVASQIIGLTNVDGKGIAGLEKAYEE 177

Query: 236 -------------DMQG-LTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
                        D+ G   R     +  +  Q + LA+DLR+Q + H+EL     +  A
Sbjct: 178 VLHGRVGKKRYIKDLHGDAIRDVGVVREARPGQAVELAIDLRLQYLQHRELQRAMVETGA 237

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
           E+   V ++  TGE+++M + P ++P+           NR+    FE GS  K  T+   
Sbjct: 238 EAGAAVTVDAWTGEILAMTNHPVFNPNSRAAFDYAATRNRVVTDAFEPGSTMKPLTLVAA 297

Query: 342 IDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGI 399
           +++G FT+  + DT    I+VG+ V+ D  P N   +T+  +   SS +G  ++A A+G 
Sbjct: 298 LETGAFTLDSVIDTSPGRIRVGRKVLPD--PLNYGAITVSRVIEKSSQVGVTKMAQAIGH 355

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +       R GL        P  ++ S P++  W  I  +T++FG+GL+ TPLQ A A A
Sbjct: 356 EPVLSVYRRFGLGEPSSIGFPGERSGSLPNRERWSEIEKVTLAFGYGLTATPLQLAQAYA 415

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGF 515
              NEGR +P T + R+ +E   V R++ K+   + +  L R  VTG  G+ ++A VPGF
Sbjct: 416 IFANEGRRVPLTLLKRADDEQPPVERVISKEVAQQVLTVLHR--VTGNEGTAKKARVPGF 473

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            VGGKTGT  KV    Y        F+ V P  +P+Y+    +D P   + +    G   
Sbjct: 474 SVGGKTGTVHKVGPSGYLPDQYLALFVGVAPIDNPRYVTAVVIDQP---QGDSYGGGAAA 530

Query: 576 APMVGNI 582
           AP+   I
Sbjct: 531 APVYARI 537


>gi|220933943|ref|YP_002512842.1| Peptidoglycan glycosyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995253|gb|ACL71855.1| Peptidoglycan glycosyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 570

 Score =  223 bits (567), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 166/567 (29%), Positives = 278/567 (49%), Gaps = 39/567 (6%)

Query: 52  MEDGQDLFQKRRRKVIAHSKNRIGMTIV-VCLVIYIILAIRIIQYGNIHPEPIAPSMNID 110
           M D  D     RR V+      +G+ ++   +V+   L +++ +   +  E  A  + + 
Sbjct: 1   MSDSPDKLSAVRRNVV------LGLFVLGFAVVLGRGLDLQVFKQDFLRGEGDARHLRVV 54

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS 170
                R  ++DRNGE LA   P  S++  P + +   E + +L  VL ++D   ++R+L+
Sbjct: 55  SIPAHRGMVLDRNGEPLAVSTPVDSVWANPQETLQAPERLAELARVL-DMDRGDLQRRLA 113

Query: 171 SET--KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
                +F +LRR ++P    R+   G+PGV  + E  R+YP    A+HV+G+ +ID+RG 
Sbjct: 114 ERAGREFVYLRRHVNPDVAARVQQLGVPGVALQREFRRYYPMGEVAAHVLGFTNIDDRGQ 173

Query: 229 TGIEKFLD-----MQGLTRVFTTNKGE-----KNLQPIR------LALDLRIQNIVHQEL 272
            G+E  L+       G  RV     G      +N++P R      L LD R+Q + ++EL
Sbjct: 174 EGLELALNELLTGQPGAKRVVRDRLGRVIRDVENIRPARPGKDITLTLDQRVQYLAYREL 233

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               + + A S   VI++V TG++++MV+ P ++P+     +++   NR    +FE GS 
Sbjct: 234 KAAVQAHGARSGSAVIMDVHTGDILAMVNQPSHNPNNRGSLRRDASRNRAVTDLFEPGST 293

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
            K FT+A  ++SG        DT     +VG H I D     R+  +  +   SSNIGA+
Sbjct: 294 IKPFTVAAALESGSANPHMTLDTAPGFFRVGNHTIRDIRNYGRV-DLTTMLAKSSNIGAS 352

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ---WKRIHSLTISFGHGLSTT 448
           ++A +M  +     L++ GL     +  P  +A         W+ +   T++FG+GLS T
Sbjct: 353 KLALSMESEHLWRTLHQAGLGRSTGSGFPG-EASGLLRDFYFWRDVDRATLAFGYGLSVT 411

Query: 449 PLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS-G 507
           PLQ A A AAL N+G +  P F+     +       V+  +  + +R++L   VT  S G
Sbjct: 412 PLQLARAYAALANDGVMPAPRFLA---HQPVLPGEPVISPSVARELRAMLEASVTADSTG 468

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
            RA V G+ V GKTGTA+K     YS+      F    P + P+ +++  +D P  +   
Sbjct: 469 HRARVEGYRVAGKTGTARKSGAGGYSEERFVAMFAGFAPASQPRLVMVVVIDEPAGE--- 525

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
           Q   G   AP+   I++ +  +L V P
Sbjct: 526 QYYGGQVAAPVFSKIMQGALRLLDVPP 552


>gi|294670601|ref|ZP_06735480.1| hypothetical protein NEIELOOT_02326 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307726|gb|EFE48969.1| hypothetical protein NEIELOOT_02326 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 665

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 150/500 (30%), Positives = 250/500 (50%), Gaps = 45/500 (9%)

Query: 130 DIPTFSLYVEPHKV--ISPDEIIEKLQIVL-PNLDSEMIRRKLS-------SETKFQWLR 179
           D  T+ LYV+P ++  +  DE +++L  VL P + S++ ++ +S        +  F +L+
Sbjct: 166 DSGTYELYVKPSELENLPSDEKLQQLADVLNPAIQSKLDKKSVSVLKEDMGKKIDFVFLK 225

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-----KF 234
           R++ P+  K+I   G+ G+ F+ E  R YP  S  + ++G+ +ID +G  G+E     + 
Sbjct: 226 RQMKPELAKQIADMGIKGLAFQKEPQRHYPMGSLFAQIIGFTNIDGQGQEGLELSREKEL 285

Query: 235 LDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
               G + V   NKG+             +N   I LALD RIQ + + EL +    + A
Sbjct: 286 HGKDGQSNVLRDNKGQIVENIDSENNRPSENGSNIVLALDQRIQTLAYDELTKAVAYHQA 345

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
           +S   V+L+  TGE++++V+ P YDP+E  +   +   NR    ++E GS+ K F IA  
Sbjct: 346 KSGSAVVLDARTGEILALVNGPSYDPNEPAEADSDHRRNRAVTDMYEFGSVLKPFPIAKA 405

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           +D G  + +  FDTR P  VG H + D H  P    L +  I + SSN+G ++I+     
Sbjct: 406 LDDGKISTRSHFDTR-PYNVGGHPVRDTHLYPS---LDVRGIMQKSSNVGTSKISLMYSP 461

Query: 400 QGHKEFLYRLGLLSKLETELP--EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +    +   +G   K +   P     A     +W +    T+SFG+G+  + LQ A A  
Sbjct: 462 EEMHSYYRSIGFGKKSDIRFPGESTGALRDWKKWGKFEQATMSFGYGMQLSLLQLARAYT 521

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGF 515
               +G+L+P +     +++S      +LK  T K MR ++   VT  GG+G+   V GF
Sbjct: 522 IFTADGKLMPVSL---EKQDSVPAGERILKPETAKAMRQIMVS-VTEKGGTGQNGAVEGF 577

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V  KTGTAQKV+  RY+   +  +F+   P  +P+ IV   +D P++   N    G+  
Sbjct: 578 NVAAKTGTAQKVLNGRYAKDKHIGTFIGFAPAENPRVIVAVAIDEPRV---NGYYGGVVA 634

Query: 576 APMVGNIIRRSASMLGVKPV 595
            P    I+  + ++LGV P 
Sbjct: 635 GPAFKGIMAGTLNILGVHPT 654



 Score = 52.0 bits (123), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 1/92 (1%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SR  I DRNG  LA   P  SLY  P +    DE IE+L  ++ +L SE+IR +L  ++ 
Sbjct: 74  SRGVISDRNGATLALSAPAESLYAIPSEANLTDEQIEELSGLI-DLPSEIIRERLDRKST 132

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSR 206
              + R+L+    + + + G+ G+ FR  K++
Sbjct: 133 VSIIARRLNENTIQAVQALGIEGLKFRKGKAK 164


>gi|509065|emb|CAA42192.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  222 bits (566), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 155/507 (30%), Positives = 259/507 (51%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTALTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|189423745|ref|YP_001950922.1| peptidoglycan glycosyltransferase [Geobacter lovleyi SZ]
 gi|189420004|gb|ACD94402.1| Peptidoglycan glycosyltransferase [Geobacter lovleyi SZ]
          Length = 662

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 157/480 (32%), Positives = 231/480 (48%), Gaps = 37/480 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R  I DR G  LA  +   SLY EP ++  P  +   L  ++  +    ++RKL SE  
Sbjct: 59  ARGGIFDRTGAALAVSLEMDSLYAEPKRITDPAGMAAALAPLI-QIPQHELQRKLDSEKS 117

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL R+L P+   +I    LPG+GF  E  RFYP    ASHV+G+  +D  G+ G+E+ 
Sbjct: 118 FAWLARQLPPETASKIKQLKLPGIGFVKENKRFYPNFEMASHVLGFTGMDPGGLEGLERR 177

Query: 235 LDMQGLTR--------------VFTTNKGEKNLQP---IRLALDLRIQNIVHQELVENKK 277
            D   L +              V   N   ++  P   + L LD  IQ    +EL +  +
Sbjct: 178 YDTTILGKTGYLLTERDALGRDVAIRNAVVQDAAPGKNLYLTLDKNIQYFTEKELAKAVE 237

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
              A+S   ++++  TG+V++M + P ++P+   +       NR     FE GS FKVF 
Sbjct: 238 GSRAKSGMALVMDPWTGKVLAMANYPTFNPNSFRQYPSLNLRNRCVSDSFEPGSTFKVFL 297

Query: 338 IAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           ++  ++  L   +D  +  N     G  +I D HP  R+ ++ E+ +YSSNIG+A+I   
Sbjct: 298 LSAALEEKLVRPQDGINCENGRYSFGGRIIRDDHPHGRV-SVAEVLKYSSNIGSAKIGLK 356

Query: 397 MGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTAV 454
           +G      +L   G   K   +LP E      P S+W      TISFG G+S T LQ   
Sbjct: 357 LGDDRLHRYLKAFGFGDKSGIDLPGEASGGLRPVSRWYGTDIATISFGQGVSATALQLVA 416

Query: 455 AAAALINEGRLIPPTFMIR---------SREESEKVSRIVLKKNTVKTMRSLLREGVT-- 503
           A +A+ N G L+ P  + R          R E + V R V+   T  TM  ++ EGVT  
Sbjct: 417 ATSAVANGGLLMKPYLVERVTDNAGLELQRFEPQTVRR-VISTQTAATMTQMM-EGVTQK 474

Query: 504 GGSGRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
           GG+   A + GF V GKTGTAQKV  + + YS T    SF+   P   P   +L  +D P
Sbjct: 475 GGTATNAAIDGFRVAGKTGTAQKVDPVSRGYSATKRTASFVGFVPAEKPLLTILVVIDEP 534


>gi|31296577|gb|AAP46581.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 155/507 (30%), Positives = 259/507 (51%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVIIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|254428418|ref|ZP_05042125.1| Penicillin-binding Protein dimerisation domain family [Alcanivorax
           sp. DG881]
 gi|196194587|gb|EDX89546.1| Penicillin-binding Protein dimerisation domain family [Alcanivorax
           sp. DG881]
          Length = 573

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 158/541 (29%), Positives = 264/541 (48%), Gaps = 32/541 (5%)

Query: 77  TIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSL 136
            +  CL++   + +++IQ+  +  +    ++ ++     R  I DR G+ LA   P  +L
Sbjct: 25  AVCACLLLVRAVDLQVIQHDYLAHQGDIRNLRVEPLAAHRGVIRDRAGKPLAVSTPVVTL 84

Query: 137 YVEPHKVISPDEIIEKLQ---IVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
           +V P + +   +   +L    ++ P   +  +RR  S E  F +L R L+P+  K +L+ 
Sbjct: 85  WVNPREAMEHQDQWGRLAGNPVIDPKAFARKVRRHESRE--FIYLERGLAPEAAKTVLNL 142

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--MQG-----------L 240
            +PGV    E  R+YPA   ASHVVG+ +ID++G  GIE  ++  + G           L
Sbjct: 143 NVPGVYSLTEYRRYYPAGEVASHVVGFTNIDDQGQEGIELSMEDHLSGHSGRKKVVRDLL 202

Query: 241 TRVFTTNKGEKNLQP---IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
            RV    +  +  +P   + L++DLR+Q + ++EL+   +K+ A+    V+L+V TGEV+
Sbjct: 203 GRVIQDIEVLEPAEPGEDVTLSIDLRLQYLAYRELLGAVQKFKAKGGSAVVLDVRTGEVL 262

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +MV+ P Y+P+           NR    +FE GS  K FT+A  ++ G+ T     +T  
Sbjct: 263 AMVNQPAYNPNNRGNLDTGALRNRAVTDLFEPGSTMKPFTVAAALEMGMVTPSTTINTHP 322

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             ++VG   I D H    ++ I  +   SSN+G +++A AM       +L R G      
Sbjct: 323 GTLRVGSKTIRD-HRDYGVIDITTVLTKSSNVGTSKLALAMEPLALPGYLERFGFGQSTH 381

Query: 417 TELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              P       P  S+W+ +    +S+G+GLS + +Q A A A + N+G  +P T     
Sbjct: 382 IAFPGESNGLLPLRSKWRDVERAALSYGYGLSVSAVQLAQAYAVIANDGVKVPLTL---K 438

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + +       V+ K T + +  +L   V+  G+ RRA VPG++V GKTGT  KV+   Y+
Sbjct: 439 KVDGVPQGEQVIGKATARQLVQMLETVVSRVGTARRAQVPGYQVAGKTGTVHKVMAGGYA 498

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
           D      F  + P TDP+ + +  +D P  K       G+  AP   NI+      L V 
Sbjct: 499 DDNYIGLFAGLAPATDPRIVTVVVIDDPGGKA---YYGGLVAAPAFSNIMSGVLRSLHVP 555

Query: 594 P 594
           P
Sbjct: 556 P 556


>gi|32345880|gb|AAM97234.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  221 bits (563), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|32345914|gb|AAM97251.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  221 bits (563), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 154/506 (30%), Positives = 257/506 (50%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ +ID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELV 273
           E           G   V   NKG              KN Q + L+LD RIQ + + EL 
Sbjct: 193 ELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  
Sbjct: 253 KAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G  
Sbjct: 431 LARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +  
Sbjct: 487 GAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P    I+  S ++LG+ P 
Sbjct: 544 YGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|509190|emb|CAA42188.1| penicillin-binding protein 2 [Neisseria meningitidis]
 gi|31296569|gb|AAP46577.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345768|gb|AAM97178.1| PenA [Neisseria meningitidis]
 gi|32345770|gb|AAM97179.1| PenA [Neisseria meningitidis]
 gi|37651048|emb|CAD70591.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 155/507 (30%), Positives = 259/507 (51%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|56964126|ref|YP_175857.1| stage V sporulation protein D [Bacillus clausii KSM-K16]
 gi|56910369|dbj|BAD64896.1| stage V sporulation protein D [Bacillus clausii KSM-K16]
          Length = 644

 Score =  221 bits (562), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 173/579 (29%), Positives = 274/579 (47%), Gaps = 77/579 (13%)

Query: 71  KNRIGMTIVVCLVIYIILAIRI--IQYGNIHPEPIAPSMNIDEYGMSRP------DIIDR 122
           + R+ +   + + ++ I+A+R+  +Q+G             D +G + P      DI DR
Sbjct: 9   RKRLLLAFFIGVAVFAIIAVRLGYVQFGQ---GVWLTEQAEDSWGRNIPFEPKRGDITDR 65

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR--- 179
           NG  LAT+I   S+ V P +V  P +  EKL  VL  +D +     L+      WLR   
Sbjct: 66  NGVELATNISAPSVIVFPRQVTDPVDAAEKLAAVL-EMDQQKAYESLTKSASSVWLRPEG 124

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--- 236
           +KLS ++ + + S  LPGV    +  R YP  S+ SHV+G+  IDN+G+TG+E + D   
Sbjct: 125 QKLSQEKAQEVRSLNLPGVYIAEDSKRHYPFGSYLSHVLGFAGIDNQGLTGLEHYYDGKL 184

Query: 237 --MQGLTRVFTTNKGEK--NLQ-----PIR-----LALDLRIQNIVHQELVENKKKYNAE 282
              +G    F+T KG K  NL      PI      L +D RIQ I+ +EL + + KY  +
Sbjct: 185 KGEKGYVSFFSTAKGTKMPNLADEYEPPINGLNLTLTIDSRIQTIMERELDQAEAKYEPD 244

Query: 283 SVGTVILNVSTGEVISMVSIPDYDPH-------EAFKGKKEGWFNRISYGIFEMGSIFKV 335
               + ++ +TGEV++M S PD++P        E +   K  W        +E GS FK+
Sbjct: 245 GAMAIAMDPNTGEVLAMSSRPDFNPEHYREVPAEVYNQNKPVWMQ------YEPGSTFKL 298

Query: 336 FTIAMGIDSGLFTVK-DLFDTRNPIKVGKHVIHDY----HPQNRILTIPEIFRYSSNIGA 390
            T+A  ++ G+  ++ D F     I V    +  +    H     L   E+ + S N G 
Sbjct: 299 ITLAAALEEGVVDLENDTFHDPGYINVAGTKLRCWKKGGHGHQTFL---EVVQNSCNPGF 355

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKR-----IHSLTISFGHGL 445
            ++   +G     +++   G   K   +L   Q       + R     +   T +FG G+
Sbjct: 356 VELGQRLGKDRLFDYIEEFGFGQKTGIDL---QGEGTGILFNRDRVGPLEQATTAFGQGV 412

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEK----------VSRIVLKKNTVKTMR 495
           + TPLQ  VA +A +N G L  P ++ +   + E           + R V+ + T + +R
Sbjct: 413 AVTPLQQVVAVSAAVNGGYLYEP-YLAKEWTDGETGEVVESISPVMKRQVISEKTSEQVR 471

Query: 496 SLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVL 555
             +   V  GSG+ AF+ G+ VGGKTGTAQK    +Y +     SF+ V P  DPQ +V 
Sbjct: 472 YAMENVVAKGSGKNAFIDGYRVGGKTGTAQKAKNGKYLENNYILSFIGVAPMDDPQIVVY 531

Query: 556 SFMDSPKIKERNQLT-AGINVAPMVGNIIRRSASMLGVK 593
             +D+PK    N +   G+  AP+ G II  S   +GV+
Sbjct: 532 VAIDNPK----NTIQYGGVVAAPIAGAIIGDSLEAMGVE 566


>gi|312983312|gb|ADR30452.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 581

 Score =  221 bits (562), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 155/506 (30%), Positives = 260/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIA  +DSG     D F+T  P K+G   + D H     L +  I + SSN+G +++
Sbjct: 313 KPFTIAKALDSGKVDATDTFNTL-PYKIGPATVQDTHVYP-TLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ
Sbjct: 371 SAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G  
Sbjct: 431 LARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +  
Sbjct: 487 GAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P    I+  S ++LG+ P 
Sbjct: 544 YGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|222053875|ref|YP_002536237.1| Peptidoglycan glycosyltransferase [Geobacter sp. FRC-32]
 gi|221563164|gb|ACM19136.1| Peptidoglycan glycosyltransferase [Geobacter sp. FRC-32]
          Length = 657

 Score =  221 bits (562), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 161/509 (31%), Positives = 243/509 (47%), Gaps = 39/509 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  I D N   LA  I   S + EP  V +  +   KL  +L ++ +E + +KL     F
Sbjct: 60  RGAIFDSNNAPLALSIEMDSCFAEPRNVENIPDAAAKLAPLL-SMPAEQVEKKLKGSRNF 118

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            WL+R+++P Q   I +  L G+GF  E  RFYP +  A+HVVG+  +D  G+ GIE   
Sbjct: 119 VWLQRRMAPDQAAAIKALALEGIGFVKESKRFYPNSEIAAHVVGFTGMDPEGLEGIELKY 178

Query: 236 D--MQGLTRVFTTN---------------KGEKNLQPIRLALDLRIQNIVHQELVENKKK 278
           D  + G T    T                K     Q + L LD  IQ I  +EL++  + 
Sbjct: 179 DSTILGSTGYLVTERDALGREVYSKGTVVKNPAKGQNVTLTLDKNIQYIAEKELIKAVET 238

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A++   +++  +TG +++M + P+++P+   K  ++   NR     FE GS FK+F  
Sbjct: 239 NGAKAGIALVMEPATGRILAMANYPNFNPNTFSKYAQQALRNRSIADSFEPGSTFKIFLA 298

Query: 339 AMGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  ++       D F+  N    +G   IHD H +   L+I +I +YSSNIGAA+I   +
Sbjct: 299 ATALEQKAIRPGDGFNCENGSYSIGGRTIHDTH-KYGYLSIAQILKYSSNIGAAKIGARL 357

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           G       L   G   K   +LP   + +    SQW  +   TISFG G++ TPLQ A  
Sbjct: 358 GNDKLYAGLTGFGFGEKTGVDLPGESSGTLRNKSQWFGVDLATISFGQGVTATPLQIATG 417

Query: 456 AAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGVT--GG 505
            +A+ N G L+ P  + +  ++        + +V R V+ + T KT+  +L EGV   GG
Sbjct: 418 VSAVANGGLLMKPYLVEKISDDNGNVVRSFAPEVKRRVISEETAKTVARML-EGVVAEGG 476

Query: 506 SGRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           +G  A V G+   GKTGTAQKV  + + YS      S++   P   P+  +L  +D PK 
Sbjct: 477 TGVNAAVDGYRSAGKTGTAQKVDHLTRGYSADKRTASYVGFVPLEKPRLTILVVVDEPKT 536

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGV 592
                   GI  AP    I  +S   L V
Sbjct: 537 SSY----GGIVAAPAFSAIAEQSLCYLKV 561


>gi|261401197|ref|ZP_05987322.1| peptidoglycan synthetase FtsI [Neisseria lactamica ATCC 23970]
 gi|269208878|gb|EEZ75333.1| peptidoglycan synthetase FtsI [Neisseria lactamica ATCC 23970]
          Length = 581

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 163/558 (29%), Positives = 278/558 (49%), Gaps = 44/558 (7%)

Query: 70  SKNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           S  RIG  ++   V++  L +R      + Y  +  +     +       +R  I DRNG
Sbjct: 24  SDGRIGFVLLAMAVLFAGLIVRGLYLQTVTYNFLKNQGDNQIVRTQSLPAARGTISDRNG 83

Query: 125 EILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
            +LA   PT SLY  P  +  +     +E+L  ++ ++  +++R KL  + K F W++R+
Sbjct: 84  AVLALSAPTESLYAVPKDMEEMPTGAQLEQLSGLV-DVPVDVLRNKLEQKGKSFIWIKRQ 142

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL------ 235
           L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L      
Sbjct: 143 LDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHG 202

Query: 236 ---------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                    D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++
Sbjct: 203 EDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKA 262

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  K F IA  +D
Sbjct: 263 GTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAIKPFVIAKALD 322

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +G   V +  +T+ P K+G   + D H  P    L +  I + SSN+G ++++     + 
Sbjct: 323 AGKTDVNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTSKLSARFSSEE 378

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + LQ A A  AL
Sbjct: 379 MYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAYTAL 438

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEV 517
            ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G    V GF+V
Sbjct: 439 THDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDV 494

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           G KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     N    G+   P
Sbjct: 495 GAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVAGP 551

Query: 578 MVGNIIRRSASMLGVKPV 595
               I+  S ++LGV P 
Sbjct: 552 PFKKIMGGSLNILGVSPT 569


>gi|31296641|gb|AAP46613.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 258/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLENSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|329118762|ref|ZP_08247460.1| cell division protein FtsI/penicillin-binding protein [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327465109|gb|EGF11396.1| cell division protein FtsI/penicillin-binding protein [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 666

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 152/491 (30%), Positives = 246/491 (50%), Gaps = 40/491 (8%)

Query: 135 SLYVEPHK--VISPDEIIEKLQIVL-PNLDS-------EMIRRKLSSETKFQWLRRKLSP 184
           +LYV+P +  V+  D  +++L  VL P + S       E ++  +  +  F +L+R+L P
Sbjct: 172 ALYVKPSEMAVLPDDGKLQQLADVLNPAIPSKLDKKTVETLKADMGKKIDFVYLKRQLKP 231

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----G 239
           +  +RI +  +PG+ F+ E  R YP  S  +  +G+ +ID +G  G+E+  + +     G
Sbjct: 232 ELAERIAAMNIPGLAFQKEPQRHYPTGSLFAQTIGFTNIDGQGQEGLERSRESELHGRDG 291

Query: 240 LTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
              V   NKG+            +N + I LA+D RIQ +   EL +    + A S   V
Sbjct: 292 EKVVLRDNKGQIVDSADSGSRASQNGRDIVLAMDQRIQTLAADELAKAVAYHKAHSGSAV 351

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +L+  TGE++++V+ P YDP+E  +   +   NR    IFE GS+ K F IA  +D G  
Sbjct: 352 VLDARTGEILALVNGPSYDPNEPGEADPDQRRNRAITDIFEFGSVMKPFPIAKALDDGKI 411

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
           + +  FDTR P  VG H + D H     L +  I + SSN+G ++I+     +    +  
Sbjct: 412 STRSSFDTR-PYSVGGHPVRDTHVYP-ALDVRGIVQKSSNVGTSKISLMYRPEEMYGYYR 469

Query: 408 RLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
            LG  SK     P     +  +   W +    T+SFG+G+  + LQ A A   L  +GRL
Sbjct: 470 SLGFGSKTGVGFPGEAGGTLRNWKHWGKFDQATMSFGYGMQLSLLQLARAYTVLTTDGRL 529

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGT 523
           +P +     + ++      +LK  T + MR ++   VT  GG+GR   V GF V  KTGT
Sbjct: 530 MPVSL---EKLDAAPAGERILKPETAQAMRKIMVS-VTEQGGTGRSGAVEGFNVAAKTGT 585

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           AQKV+ + Y+   +  +F+   P  +P+ IV   +D P+    N    G+   P+  NI+
Sbjct: 586 AQKVVGRGYARDKHIGTFVGFAPAENPRVIVAVTIDEPRA---NGYYGGVVAGPVFKNIM 642

Query: 584 RRSASMLGVKP 594
             S ++LGV+P
Sbjct: 643 SGSLNILGVRP 653



 Score = 45.1 bits (105), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 1/103 (0%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SR  I DRNG  LA   P  SLY  P      +  IE+L  +L ++ ++ IR +L  ++ 
Sbjct: 74  SRGLISDRNGATLALSAPAESLYAVPSAANLSNGQIEELAALL-DMPADTIRDRLDRKSS 132

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHV 217
             ++ R+L       + +  + G+ +R E     P    A +V
Sbjct: 133 ISYIARRLDADTAAAVKALNIHGLRWRDETENGKPTGRQALYV 175


>gi|31296583|gb|AAP46584.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296667|gb|AAP46626.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345760|gb|AAM97174.1| PenA [Neisseria meningitidis]
 gi|32345762|gb|AAM97175.1| PenA [Neisseria meningitidis]
 gi|32345764|gb|AAM97176.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  220 bits (560), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 258/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|32345862|gb|AAM97225.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 263/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSLRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|509120|emb|CAA42189.1| penicillin-binding protein 2 [Neisseria meningitidis]
 gi|31296619|gb|AAP46602.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296621|gb|AAP46603.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345846|gb|AAM97217.1| PenA [Neisseria meningitidis]
 gi|32345848|gb|AAM97218.1| PenA [Neisseria meningitidis]
 gi|32345850|gb|AAM97219.1| PenA [Neisseria meningitidis]
 gi|32345852|gb|AAM97220.1| PenA [Neisseria meningitidis]
 gi|32345854|gb|AAM97221.1| PenA [Neisseria meningitidis]
 gi|32345856|gb|AAM97222.1| PenA [Neisseria meningitidis]
 gi|32345858|gb|AAM97223.1| PenA [Neisseria meningitidis]
 gi|32345860|gb|AAM97224.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 263/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|239826517|ref|YP_002949141.1| stage V sporulation protein D [Geobacillus sp. WCH70]
 gi|239806810|gb|ACS23875.1| stage V sporulation protein D [Geobacillus sp. WCH70]
          Length = 646

 Score =  219 bits (559), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 172/565 (30%), Positives = 286/565 (50%), Gaps = 48/565 (8%)

Query: 71  KNRIGMTIVVCLVIYIILAIRI--IQY--GNIHPEPIAPSMNID-EYGMSRPDIIDRNGE 125
           + R+ +  +V + I+ I+ IR+  +Q+  G++  E    S + +  +   R +I+DRNG 
Sbjct: 9   RKRLMIVFLVGVFIFAIIDIRLGYVQFILGDMLTERAKDSWSRNIPFEPKRGEILDRNGV 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRKLS 183
            LAT++   ++YV P ++ +P E  EKL  VL N+  E   + ++ +T  + +   RK+S
Sbjct: 69  PLATNMSAPTVYVIPRQIENPAETAEKLAKVL-NMPVEKAYKHITKKTSIERIPEGRKIS 127

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
            ++ K I + GL GV    +  R+YP  S+ SHV+G+  IDN+G+TG+E + D +     
Sbjct: 128 NEKAKEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYDKELSGQR 187

Query: 239 GLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G  + ++  KG++      +  P      + L +D RIQ IV +EL   + KYN + +  
Sbjct: 188 GSVQFYSDAKGKRMPNMADDYTPPTDGLNLVLTIDSRIQTIVERELDIAEAKYNPDGIIA 247

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIFKVFTIAMGIDS 344
           + +N +TGE+++M S P +DP   ++      +NR    +  +E GS FK+ T+A  ++ 
Sbjct: 248 IAMNPNTGEILAMASRPTFDPAN-YRTVPPEIYNRNLPIWSTYEPGSTFKIITLAAALEE 306

Query: 345 GLFTV-KDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGH 402
               + KD F     +KV    +  +        T  E+ + S N G  ++ + +G +  
Sbjct: 307 KKVNLLKDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGERLGKERL 366

Query: 403 KEFLYRLGLLSKLETELPEIQAPSYPSQWKRI---HSLTISFGHGLSTTPLQTAVAAAAL 459
            E++ + G   K   +L + +        KR+      T +FG G+S TP+Q   A +A 
Sbjct: 367 FEYIKKFGFGEKTGIDL-QGEGTGILFDLKRVGPVEQATTAFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLI----------PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
           +N G L           P T  + SR  + K  R V+ + T K +R  L   V  G+G+ 
Sbjct: 426 VNGGILYTPYIAKQWVDPETGKVVSRN-TLKAKRRVISEETSKQIRYALESVVAQGTGKG 484

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A+V G+ VGGKTGTAQK    RY    +  SF+   P  DPQ +V   +D+PK   +   
Sbjct: 485 AYVEGYRVGGKTGTAQKAKGGRYLKDNHIVSFIGFAPADDPQLVVYVAVDNPKGTVQ--- 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G+  AP+VG I+  S   LGVKP
Sbjct: 542 FGGVVSAPIVGKIMEDSLRTLGVKP 566


>gi|197116883|ref|YP_002137310.1| bifunctional peptidoglycan transglycosylase/transpeptidase FtsI
           [Geobacter bemidjiensis Bem]
 gi|197086243|gb|ACH37514.1| peptidoglycan transglycosylase and transpeptidase FtsI [Geobacter
           bemidjiensis Bem]
          Length = 660

 Score =  219 bits (559), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 158/511 (30%), Positives = 240/511 (46%), Gaps = 38/511 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +R  I DR     A  I   S Y E   + +  +   +L  +L    ++ +  KL     
Sbjct: 59  ARGAIYDRTNAPFAVSIEMDSCYAETRNMENIPQEAAQLAPLL-GYGAQELESKLKGAKN 117

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL R++ P+Q  ++ + GL GVGF  E  RFYP +  A+HVVG+  +D  G+ G+EK 
Sbjct: 118 FVWLARRIPPEQAGKVKALGLEGVGFVKESKRFYPNSQVAAHVVGFTGVDPGGLEGVEKK 177

Query: 235 LDM-------------QGLTRVFTTNKGEKNLQPIR-----LALDLRIQNIVHQELVENK 276
            D                L R     KG +     +     L LD  +Q I  +EL    
Sbjct: 178 YDATILGNTGFLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLDKNVQYIAEKELTNAV 237

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
            K  A++   +++   TG V++M + P ++P+   +  +    NR     FE GS FK+F
Sbjct: 238 VKNGAKAGIAIVMEPDTGRVLAMANYPSFNPNSFAEYGQAALRNRAIADSFEPGSTFKIF 297

Query: 337 TIAMGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
            +A  +++G+    D+F+  N    V    IHD H +   L++P+I +YSSNIGAA+I  
Sbjct: 298 LVASALEAGVIRPGDMFNCENGSYSVYGRTIHDTH-KYGALSVPQILKYSSNIGAAKIGS 356

Query: 396 AMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTA 453
            +G +     L   G   K   +LP E      P S+W  I   TISFG G++ T LQ  
Sbjct: 357 RLGPERLYAALTGFGFGEKSSIDLPGEASGMLRPQSKWYGIDLATISFGQGVTATALQIT 416

Query: 454 VAAAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGVT-- 503
            A +A+ N G L+ P  + R  ++        + +V R ++   T KT+  +L EGV   
Sbjct: 417 NAVSAVANGGNLMKPYLVDRIVDDNGVVLQQFAPQVKRRIISPETAKTVARML-EGVVVE 475

Query: 504 GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           GG+G  A V G+ V GKTGTAQKV    YS +    SF+   P   P+  ++  +D P  
Sbjct: 476 GGTGTGAAVEGYRVAGKTGTAQKVEGHGYSASKRTASFVGFVPLDKPRLAIMVVVDEPTT 535

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
                   G+  AP    I +++   L V P
Sbjct: 536 SS----YGGVVAAPAFSAIAQQTLCYLNVAP 562


>gi|32345844|gb|AAM97216.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  219 bits (558), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 155/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LGV P 
Sbjct: 542 GYYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|313667808|ref|YP_004048092.1| penicillin-binding protein 2 [Neisseria lactamica ST-640]
 gi|313005270|emb|CBN86703.1| penicillin-binding protein 2 [Neisseria lactamica 020-06]
          Length = 581

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 162/558 (29%), Positives = 278/558 (49%), Gaps = 44/558 (7%)

Query: 70  SKNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           S  RIG  ++   V++  L +R      + Y  +  +     +       +R  I DRNG
Sbjct: 24  SDGRIGFVLLAMAVLFAGLIVRGLYLQTVTYNFLKNQGDNQIVRTQSLPAARGTISDRNG 83

Query: 125 EILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
            +LA   PT SLY  P  +  +     +E+L  ++ ++  +++R KL  + K F W++R+
Sbjct: 84  AVLALSAPTESLYAVPKDMEEMPTGAQLEQLSGLV-DVPVDVLRNKLEQKGKSFIWIKRQ 142

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL------ 235
           L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L      
Sbjct: 143 LDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLEDSLHG 202

Query: 236 ---------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                    D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++
Sbjct: 203 EDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKA 262

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  K F IA  +D
Sbjct: 263 GTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAIKPFVIAKALD 322

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G ++++     + 
Sbjct: 323 AGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTSKLSARFSSEE 378

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + LQ A A  AL
Sbjct: 379 MYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAYTAL 438

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEV 517
            ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G    V GF+V
Sbjct: 439 THDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDV 494

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           G KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     N    G+   P
Sbjct: 495 GAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NSYYGGVVAGP 551

Query: 578 MVGNIIRRSASMLGVKPV 595
               I+  S ++LGV P 
Sbjct: 552 PFKKIMGGSLNILGVSPT 569


>gi|32345864|gb|AAM97226.1| PenA [Neisseria meningitidis]
 gi|32345866|gb|AAM97227.1| PenA [Neisseria meningitidis]
 gi|32345870|gb|AAM97229.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|32345766|gb|AAM97177.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 154/507 (30%), Positives = 258/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A    AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARTYTALTHDGVLLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|121635453|ref|YP_975698.1| penicillin-binding protein 2 [Neisseria meningitidis FAM18]
 gi|31296585|gb|AAP46585.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345826|gb|AAM97207.1| PenA [Neisseria meningitidis]
 gi|32345828|gb|AAM97208.1| PenA [Neisseria meningitidis]
 gi|32345830|gb|AAM97209.1| PenA [Neisseria meningitidis]
 gi|32345832|gb|AAM97210.1| PenA [Neisseria meningitidis]
 gi|32345834|gb|AAM97211.1| PenA [Neisseria meningitidis]
 gi|120867159|emb|CAM10926.1| penicillin-binding protein 2 [Neisseria meningitidis FAM18]
          Length = 581

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 263/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ +V++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLVYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|31296643|gb|AAP46614.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 263/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G++   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGVEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|240081127|ref|ZP_04725670.1| Pbp2 [Neisseria gonorrhoeae FA19]
 gi|268597238|ref|ZP_06131405.1| penicillin-binding protein 2 [Neisseria gonorrhoeae FA19]
 gi|268551026|gb|EEZ46045.1| penicillin-binding protein 2 [Neisseria gonorrhoeae FA19]
          Length = 581

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 157/549 (28%), Positives = 276/549 (50%), Gaps = 39/549 (7%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            +T+ P K+G   + D H  P    L +  I + SSN+G ++++   G +   +F + LG
Sbjct: 332 LNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELG 387

Query: 411 LLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P 
Sbjct: 388 IGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPL 447

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQK 526
           +F    ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K
Sbjct: 448 SF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARK 503

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            +  RY+D  +  +F+   P  +P+ IV   +D P     N    G+   P    I+  S
Sbjct: 504 FVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVAGPPFKKIMGGS 560

Query: 587 ASMLGVKPV 595
            ++LG+ P 
Sbjct: 561 LNILGISPT 569


>gi|31296635|gb|AAP46610.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 583

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 153/506 (30%), Positives = 260/506 (51%), Gaps = 34/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K F IA  +D+G   + +  +T+ P K+G   + D       L +  I + SSN+G +++
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKL 371

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ
Sbjct: 372 SARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQ 431

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G  
Sbjct: 432 LARAYTALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTA 487

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 488 GAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGY 544

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P    I+  S ++LGV P 
Sbjct: 545 YGGVVAGPPFKKIMGGSLNILGVSPT 570


>gi|240014788|ref|ZP_04721701.1| penicillin-binding protein 2 [Neisseria gonorrhoeae DGI18]
 gi|240113339|ref|ZP_04727829.1| penicillin-binding protein 2 [Neisseria gonorrhoeae MS11]
 gi|240116314|ref|ZP_04730376.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID18]
 gi|240118601|ref|ZP_04732663.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID1]
 gi|240121311|ref|ZP_04734273.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID24-1]
 gi|268599413|ref|ZP_06133580.1| penicillin binding protein 2 [Neisseria gonorrhoeae MS11]
 gi|268601981|ref|ZP_06136148.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID18]
 gi|268604313|ref|ZP_06138480.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID1]
 gi|44913|emb|CAA30357.1| unnamed protein product [Neisseria gonorrhoeae]
 gi|268583544|gb|EEZ48220.1| penicillin binding protein 2 [Neisseria gonorrhoeae MS11]
 gi|268586112|gb|EEZ50788.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID18]
 gi|268588444|gb|EEZ53120.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID1]
          Length = 583

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 155/547 (28%), Positives = 275/547 (50%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     N    G+   P+   ++  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVAGPVFKQVMGGSLN 563

Query: 589 MLGVKPV 595
           +LGV P 
Sbjct: 564 ILGVSPT 570


>gi|153870776|ref|ZP_02000103.1| Peptidoglycan glycosyltransferase [Beggiatoa sp. PS]
 gi|152072755|gb|EDN69894.1| Peptidoglycan glycosyltransferase [Beggiatoa sp. PS]
          Length = 604

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 263/498 (52%), Gaps = 27/498 (5%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQ 176
           ++DR GE LA   P  S++V P + ++  +   KL  +L +++ + +  KL+   + +F 
Sbjct: 109 LMDRYGEPLAISTPVESVWVNPSQFVTARQDWSKLTELL-SINRKKLEVKLAKRMDREFV 167

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +++R +SP   +++ +  LPGV  + E  R+YP    ++HV+G+ +ID++G  G+E  L+
Sbjct: 168 YIKRHISPLLARQVNALELPGVFLQREYHRYYPTREVSAHVIGFTNIDDQGQEGLELALN 227

Query: 237 -----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                + G  RV   N G+           +  Q IR++LD R+Q + ++EL     +  
Sbjct: 228 NFLMGVPGKKRVIQNNNGQVVAYVDNISLPRPGQNIRISLDRRLQYLAYRELKAAVFRSR 287

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A +   +IL++ TGEV++MV+ P Y+P+   +   E + NR    IFE GS FK FTIA 
Sbjct: 288 ARAGSAIILDIRTGEVLAMVNQPAYNPNNRSELLSERYRNRAITDIFEPGSTFKPFTIAA 347

Query: 341 GIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            ++SG +T   L +TR   +++ K+ + D      ++ +  I + SSN+GA++IA ++  
Sbjct: 348 ALESGKYTPTTLVNTRPGYLRLHKYTVRDARNYG-VINLATIIKKSSNVGASKIALSLKR 406

Query: 400 QGHKEFLYRLGLLSKLETELP-EIQAP-SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +   + L +LG      +  P EI    ++  QW R    +ISFG+G+S T LQ A A A
Sbjct: 407 KHIWQILTQLGFGRISGSGFPGEIAGRLAHFRQWPRAQHASISFGYGISVTTLQLARAYA 466

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFE 516
           AL N+G L P  F+     +  +    VL+  T + +  +L   V  GG+G  A + G+ 
Sbjct: 467 ALGNDGILPPIHFLPVEEGQESESGEPVLQPKTARQVLKMLEAVVQPGGTGTLAQITGYR 526

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVA 576
           V GKTGT +K+I   YS T     F  + P   P+ +++  +DSP+  E      G   A
Sbjct: 527 VAGKTGTVRKIINGEYSKTDYLALFAGIVPAGVPRLVMIVVIDSPRTDE---YYGGKVAA 583

Query: 577 PMVGNIIRRSASMLGVKP 594
           P+   ++  +  +L + P
Sbjct: 584 PVFAKVMSGALRLLNIPP 601


>gi|88704094|ref|ZP_01101809.1| protein FtsI; penicillin-binding protein 2 [Congregibacter
           litoralis KT71]
 gi|88701921|gb|EAQ99025.1| protein FtsI; penicillin-binding protein 2 [Congregibacter
           litoralis KT71]
          Length = 574

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 158/503 (31%), Positives = 239/503 (47%), Gaps = 36/503 (7%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPD---EIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           I DR GE LA   P  SL+  P  +   D   E+   L +    L+  ++R    +  +F
Sbjct: 68  ITDRRGEPLAVSTPVISLWANPKVLRDSDRLPELASALDLSTAELEDRLLR---YNGKQF 124

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +LRR L P   + +L+  +PGV    E  RFYPA   A+ +VG  ++D  G+ G+E   
Sbjct: 125 MYLRRHLIPDSAREVLALNIPGVRAEREYRRFYPAGEVAAQLVGMTNVDGAGVAGLELAY 184

Query: 236 D-----MQGLTRVFTTNKGEK-----NLQPIR------LALDLRIQNIVHQELVENKKKY 279
           D       G  R      G+       + P+R      L++DLR+Q ++H+EL       
Sbjct: 185 DDWLRGHPGKKRYIKDLHGDAVRDIGVIDPVRPGRNLQLSIDLRLQYLLHRELNRAATVT 244

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
            AE+   V ++  TGEV++  S PD++P+           NR    IFE GS  K  T+ 
Sbjct: 245 GAEAGVIVTIDSHTGEVLASASYPDFNPNNRSTVTMSQTRNRALTDIFEPGSTMKPLTLV 304

Query: 340 MGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAM 397
             ++SG +    L DT    I+VG+ V+ D  P+N   +T+  +   SS +G  +IA  +
Sbjct: 305 AALESGRYDTDTLIDTSPGRIRVGRKVLPD--PRNYGEITLSRVVEKSSQVGITKIALDI 362

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVA 455
           G +   +   R GL     T  P   A   P   +W+ I  +T++FG+GL+ TPLQ A A
Sbjct: 363 GHEPIWDVFNRFGLGQTTATGFPGESAGLLPQRPRWRPIEQVTLAFGYGLTATPLQIARA 422

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVP 513
            A   N G L  P   +  RE  +     V+  +    +R +L E VTG  G+ R+A VP
Sbjct: 423 YAVFANGGML--PELSLLQREVVDVRGERVVDADIAAKVRGVLHE-VTGSQGTARKARVP 479

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           G+EVGGKTGT  KV    Y D      F+ + P  DP+++ +  +D PK    +    G 
Sbjct: 480 GYEVGGKTGTVHKVGAGGYLDDQYVALFVGMAPIEDPRFVTVVVLDRPK---GDNYGGGS 536

Query: 574 NVAPMVGNIIRRSASMLGVKPVF 596
             AP+   +   +  +LGV P  
Sbjct: 537 AAAPVFARVAAETLRLLGVAPTL 559


>gi|226941975|ref|YP_002797049.1| FtsI [Laribacter hongkongensis HLHK9]
 gi|226716902|gb|ACO76040.1| FtsI [Laribacter hongkongensis HLHK9]
          Length = 591

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 252/498 (50%), Gaps = 30/498 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQ 176
           I DRN E LA   P  S++  P  +   P   + +L  +L ++ +++I R+L+ + + F 
Sbjct: 82  ITDRNNEPLAISSPVESIWASPADMDPVPAAQVARLARLL-DMPADLIGRRLADKRREFV 140

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE---- 232
           +L+R++SP+  + +++ G+PG+  + E  RFYPA    SH+VGY  ID +G+ G+E    
Sbjct: 141 YLKRQISPELAREVMALGIPGISTQPEFRRFYPAGEITSHLVGYTGIDGQGMEGMELTRE 200

Query: 233 -KFLDMQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                  G   V    +G            ++ Q + L++D RIQ +  +EL    +K N
Sbjct: 201 SMLAGAAGRRHVIKDRRGHVVEDIAAIERPRDGQTLTLSIDRRIQYLAWRELKVAMEKSN 260

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A++   V+L+  TGEV+++V++P ++P+       E   N     I+E GS  K F IA 
Sbjct: 261 AKAASMVVLDARTGEVLALVNLPTFNPNSRSSMAPELRRNHAVIDIYEPGSTLKPFAIAK 320

Query: 341 GIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
            +D+GL     +F+T  P  +G   I D H     L +  + + SSN+G+++IA  +   
Sbjct: 321 ALDAGLVRPNQVFETL-PYMIGPARIRDTH-DYPALDVAGVLQKSSNVGSSKIALLLPPH 378

Query: 401 GHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +F   LG   + ++  P E      P   W+ I   T+S+GHG+S + LQ   A   
Sbjct: 379 DLWQFYSDLGFGRRPQSGFPGEAAGMLRPWKHWRPIEQATMSYGHGISVSLLQLVRAYTI 438

Query: 459 LINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFE 516
             N+G L+P +F   +R       R VL+  T + +R +L   VT  GG+  RA V G+ 
Sbjct: 439 FTNDGVLLPLSF---TRLAQPLPGRQVLRPETARKVRDML-VSVTQPGGTATRAQVLGYT 494

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVA 576
           VGGKTGT++K+   RY  +    SF    P + P+ I    +D P      Q   GI+ A
Sbjct: 495 VGGKTGTSRKLENGRYVTSKYVASFAGFVPASRPRLIAAVMLDEPDTSG-GQYYGGISAA 553

Query: 577 PMVGNIIRRSASMLGVKP 594
           P+   ++  S  +LG++P
Sbjct: 554 PVFSRVMAGSLRVLGIEP 571


>gi|31296685|gb|AAP46635.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 262/506 (51%), Gaps = 35/506 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPIDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K F IA  +D+G   + +  +T+ P K+G   + D H  +  L +  I + SSN+G +++
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTH-VDPSLDVRGIMQKSSNVGTSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ
Sbjct: 371 SARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQ 430

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G  
Sbjct: 431 LARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTA 486

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +  
Sbjct: 487 GAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGY 543

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G+   P    I+  S ++LG+ P 
Sbjct: 544 YGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|302344206|ref|YP_003808735.1| peptidoglycan glycosyltransferase [Desulfarculus baarsii DSM 2075]
 gi|301640819|gb|ADK86141.1| Peptidoglycan glycosyltransferase [Desulfarculus baarsii DSM 2075]
          Length = 664

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 170/550 (30%), Positives = 269/550 (48%), Gaps = 43/550 (7%)

Query: 79  VVCLVIYIILAIRIIQ---YGNIHPEPIAPSMNIDEYGMS--RPDIIDRNGEILATDIPT 133
           V  LV+++ L  R +    +       IA   +I +  +S  R  I DRN E LA  I T
Sbjct: 21  VFFLVVFLALVARAVDLQLFERQRLRDIAERESIRQVDLSPRRGIIFDRNHEELAVSIDT 80

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
            S+Y  P  +  P      L  VL     E+ +R L +E  F WL R++SP+  ++    
Sbjct: 81  DSIYANPLGIADPARHARLLAPVLGQPAGELAKR-LGAERAFVWLARRVSPEVAEKTRQL 139

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--MQGLTRVFTTNKG-- 249
           GL  +    E  R YP +  A HV+G+  +D RG+ G+E+  D  ++G  +  T+ +   
Sbjct: 140 GLDEIYILREPKRIYPYSDLACHVLGFSGLDARGLEGLERSQDQILRGQAKSLTSVRDAL 199

Query: 250 --------EKNLQP-----IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
                   E  L P     + L LD +IQ    + L E   K+ A++   ++++  TGE+
Sbjct: 200 GRTIHLTPEALLNPPEGNHLILTLDKQIQYATERYLAEAVTKHRAKAGQAIVMSPQTGEI 259

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M S P ++P+   K  K+ + NR    ++E GS FK F  A  + S   ++   FD  
Sbjct: 260 LAMASTPAFNPNAFDKYAKDAYRNRAITDLYEPGSTFKAFVAAAALASHRVSLSQTFDCE 319

Query: 357 N-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
           +   ++G  +IHD HP   +L + EI + SSNIGAA++A A+G +G    L   G     
Sbjct: 320 HGQWRIGGRIIHDTHPYG-MLRLAEIVKVSSNIGAAKVAQAIGAEGMYAMLRNFGFGQPT 378

Query: 416 ETELP-EIQAPSYPSQ-WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
             +LP E +    P++ W+ +    I+FG G+S T +Q   A AA+ N G ++ P  +I+
Sbjct: 379 GVDLPGEARGVLRPARTWRPVEMANIAFGQGVSVTAIQMVQAFAAVANGGVMMRP-HVIQ 437

Query: 474 S---------REESEKVSRIVLKKNTVKTM-RSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
           +         RE   ++ R V+ ++  + + R L+     GG+G  A V  F V GKTGT
Sbjct: 438 AVLDKHHQVVRETRPQMVRRVMSQDEARELTRMLMSVTEDGGTGTLARVGPFAVAGKTGT 497

Query: 524 AQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNI 582
           AQKV     YS T   +SF+   P  DP+ +V+  +D+P    R Q   G+   P    I
Sbjct: 498 AQKVNPGGGYSKTDYMSSFIGFAPAEDPKAVVMVLLDTP----RGQYYGGVVAGPAFSRI 553

Query: 583 IRRSASMLGV 592
            R + S +GV
Sbjct: 554 ARVALSEMGV 563


>gi|37651040|emb|CAD70587.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|78356083|ref|YP_387532.1| peptidoglycan glycosyltransferase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78218488|gb|ABB37837.1| Peptidoglycan glycosyltransferase [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 675

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 165/575 (28%), Positives = 278/575 (48%), Gaps = 56/575 (9%)

Query: 61  KRRRKVIAHS--KNRIGMTIVVCLVIYIILAIRI---IQYGNIHPEPIAPSMNIDEYGMS 115
           KR+ K +  S  K+R G+ +V    ++ +L   +     Y  +   P   +M   ++  +
Sbjct: 13  KRQPKAVPASPPKDRSGIRLVSVAAVFALLWAGLWARAWYVQLIDGPRLAAMASRQHHAT 72

Query: 116 ------RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL 169
                 R DI+DRNG +LA      S++V P +V    E    L   L    +EM+  K+
Sbjct: 73  ELVTGQRGDILDRNGLVLARSADFKSVFVRPVEVADRREAARMLANALGRTYAEMLT-KV 131

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
           S  + F W+ R++  +   RI   G+PGV    E SR YP    A  ++G+V  D++G+ 
Sbjct: 132 SRRSSFVWVAREVDDKAAARIRRAGVPGVYLTTEYSRLYPYRQLAGRLLGFVGTDDKGLE 191

Query: 230 GIE----KFLDMQGLTRVFTTNKGEKNL-------------QPIRLALDLRIQNIVHQEL 272
           G+E    ++L  Q   +V   +   + L             + +RL LD +IQ      L
Sbjct: 192 GLELAFDEYLTGQSTRQVVQRDAAGRRLYMDGAGFAEGLKGKTLRLTLDAQIQFFAEDAL 251

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG-WFNRISYGIFEMGS 331
               ++Y     G ++++V TG++++    P ++P+ A+KG     W NR++    E GS
Sbjct: 252 AAAVRRYEGAWGGCLVVDVPTGDILAWAEYPPFNPN-AYKGYAPSMWRNRLAMDALEPGS 310

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH----PQNRILTIPEIFRYSSN 387
             K F IA  ++ GL     LF   N    G+  +HD       +++ LT+ ++ RYSSN
Sbjct: 311 TVKPFLIAAAMEDGLVQPDSLFFCEN----GRWKLHDVTIRDTKRHQWLTVDKVLRYSSN 366

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE-----IQAPSYPSQWKRIHSLTISFG 442
           IG A+I   MG   + ++L RLG   + +  LP      I++P    +W+ +     SFG
Sbjct: 367 IGMAKIGLEMGAARYYDYLDRLGFGRRPDVPLPGEGRGIIRSPG---EWREVDLAAASFG 423

Query: 443 HGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV 502
            G + T  Q A A  AL N G +  P  ++    +++     +  + T   + ++LRE V
Sbjct: 424 QGFAVTGAQLAKAYLALANGG-VTRPLRLVDDGGQNQPRGERIFSEQTSAAVLAMLREVV 482

Query: 503 TG-GSGRRAFVPGFEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
            G G+GR A + G +VGGKTGTAQK  +    Y D     SF+ + P  +P++IV+  +D
Sbjct: 483 EGDGTGRHADIAGLDVGGKTGTAQKASRSGSGYGDEY-VASFVGLVPALNPRHIVVVTVD 541

Query: 560 SPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           +P+      + A    AP+  +++ R+ + LG+ P
Sbjct: 542 NPRKSHYGSVVA----APVFKSVVSRTWAYLGLLP 572


>gi|254673387|emb|CBA08683.1| peptidoglycan synthetase precursor [Neisseria meningitidis
           alpha275]
 gi|319411058|emb|CBY91458.1| penicillin-binding protein 2 (PBP-2) [Neisseria meningitidis WUE
           2594]
          Length = 560

 Score =  218 bits (555), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 53  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 111

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 112 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 171

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 172 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 231

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 232 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 291

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 292 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 347

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 348 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 407

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 408 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 463

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 464 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 520

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 521 GYYGGVVAGPPFKKIMGGSLNILGISPT 548


>gi|31296679|gb|AAP46632.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  218 bits (555), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 257/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAAKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|309379059|emb|CBX22361.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 581

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 162/558 (29%), Positives = 276/558 (49%), Gaps = 44/558 (7%)

Query: 70  SKNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
           S  RIG  ++   V++  L +R      + Y  +  +     +       +R  I DRNG
Sbjct: 24  SDGRIGFVLLAMAVLFAGLIVRGLYLQTVTYNFLKNQGDNQIVRTQSLPAARGTISDRNG 83

Query: 125 EILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
            +LA   PT SLY  P  +  +     +E+L  ++ ++  +++R KL  + K F W++R+
Sbjct: 84  AVLALSAPTESLYAVPKDMEEMPTGAQLEQLSGLV-DVPVDVLRNKLEQKGKSFIWIKRQ 142

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-KFLDM--- 237
           L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  F D    
Sbjct: 143 LDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSFEDSLHG 202

Query: 238 -QGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             G   V                NK  +N + I L+LD RIQ + ++EL +  + + A++
Sbjct: 203 EDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKA 262

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  K F IA  +D
Sbjct: 263 GTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAIKPFVIAKALD 322

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G ++++     + 
Sbjct: 323 AGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTSKLSARFSSEE 378

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + LQ A A  AL
Sbjct: 379 MYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAYTAL 438

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEV 517
            ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G    V GF+V
Sbjct: 439 THDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDV 494

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           G KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     N    G+   P
Sbjct: 495 GAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVTGP 551

Query: 578 MVGNIIRRSASMLGVKPV 595
               I+  S ++LGV P 
Sbjct: 552 PFKKIMGGSLNILGVSPT 569


>gi|31296571|gb|AAP46578.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296587|gb|AAP46586.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345778|gb|AAM97183.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|15676326|ref|NP_273462.1| penicillin-binding protein 2 [Neisseria meningitidis MC58]
 gi|218768818|ref|YP_002343330.1| penicillin-binding protein 2 [Neisseria meningitidis Z2491]
 gi|254805555|ref|YP_003083776.1| Penicillin-binding protein 2 [Neisseria meningitidis alpha14]
 gi|60392883|sp|P0A0U8|PBP2_NEIMA RecName: Full=Penicillin-binding protein 2; Short=PBP-2
 gi|60392884|sp|P0A0U9|PBP2_NEIMB RecName: Full=Penicillin-binding protein 2; Short=PBP-2
 gi|45178|emb|CAA33347.1| unnamed protein product [Neisseria meningitidis]
 gi|7225636|gb|AAF40852.1| penicillin-binding protein 2 [Neisseria meningitidis MC58]
 gi|31296573|gb|AAP46579.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296575|gb|AAP46580.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296579|gb|AAP46582.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296593|gb|AAP46589.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296599|gb|AAP46592.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296601|gb|AAP46593.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296639|gb|AAP46612.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296645|gb|AAP46615.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296647|gb|AAP46616.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296651|gb|AAP46618.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296661|gb|AAP46623.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296665|gb|AAP46625.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296669|gb|AAP46627.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296671|gb|AAP46628.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296673|gb|AAP46629.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296675|gb|AAP46630.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296677|gb|AAP46631.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296681|gb|AAP46633.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345772|gb|AAM97180.1| PenA [Neisseria meningitidis]
 gi|32345774|gb|AAM97181.1| PenA [Neisseria meningitidis]
 gi|32345776|gb|AAM97182.1| PenA [Neisseria meningitidis]
 gi|32345780|gb|AAM97184.1| PenA [Neisseria meningitidis]
 gi|32345782|gb|AAM97185.1| PenA [Neisseria meningitidis]
 gi|32345784|gb|AAM97186.1| PenA [Neisseria meningitidis]
 gi|32345786|gb|AAM97187.1| PenA [Neisseria meningitidis]
 gi|32345788|gb|AAM97188.1| PenA [Neisseria meningitidis]
 gi|32345790|gb|AAM97189.1| PenA [Neisseria meningitidis]
 gi|32345792|gb|AAM97190.1| PenA [Neisseria meningitidis]
 gi|32345794|gb|AAM97191.1| PenA [Neisseria meningitidis]
 gi|32345796|gb|AAM97192.1| PenA [Neisseria meningitidis]
 gi|32345798|gb|AAM97193.1| PenA [Neisseria meningitidis]
 gi|32345800|gb|AAM97194.1| PenA [Neisseria meningitidis]
 gi|32345802|gb|AAM97195.1| PenA [Neisseria meningitidis]
 gi|32345804|gb|AAM97196.1| PenA [Neisseria meningitidis]
 gi|32345806|gb|AAM97197.1| PenA [Neisseria meningitidis]
 gi|32345808|gb|AAM97198.1| PenA [Neisseria meningitidis]
 gi|32345810|gb|AAM97199.1| PenA [Neisseria meningitidis]
 gi|32345812|gb|AAM97200.1| PenA [Neisseria meningitidis]
 gi|32345814|gb|AAM97201.1| PenA [Neisseria meningitidis]
 gi|32345816|gb|AAM97202.1| PenA [Neisseria meningitidis]
 gi|32345818|gb|AAM97203.1| PenA [Neisseria meningitidis]
 gi|32345820|gb|AAM97204.1| PenA [Neisseria meningitidis]
 gi|32345822|gb|AAM97205.1| PenA [Neisseria meningitidis]
 gi|32345824|gb|AAM97206.1| PenA [Neisseria meningitidis]
 gi|32345838|gb|AAM97213.1| PenA [Neisseria meningitidis]
 gi|32345842|gb|AAM97215.1| PenA [Neisseria meningitidis]
 gi|121052826|emb|CAM09174.1| penicillin-binding protein 2 [Neisseria meningitidis Z2491]
 gi|254669097|emb|CBA07668.1| Penicillin-binding protein 2 [Neisseria meningitidis alpha14]
 gi|261391927|emb|CAX49389.1| penicillin-binding protein 2 (PBP-2) [Neisseria meningitidis 8013]
 gi|308388615|gb|ADO30935.1| penicillin-binding protein 2 [Neisseria meningitidis alpha710]
 gi|316984920|gb|EFV63876.1| penicillin-binding protein 2 [Neisseria meningitidis H44/76]
 gi|325130839|gb|EGC53572.1| penicillin-binding protein 2 [Neisseria meningitidis OX99.30304]
 gi|325132959|gb|EGC55636.1| penicillin-binding protein 2 [Neisseria meningitidis M6190]
 gi|325134880|gb|EGC57513.1| penicillin-binding protein 2 [Neisseria meningitidis M13399]
 gi|325136980|gb|EGC59577.1| penicillin-binding protein 2 [Neisseria meningitidis M0579]
 gi|325138947|gb|EGC61497.1| penicillin-binding protein 2 [Neisseria meningitidis ES14902]
 gi|325140928|gb|EGC63435.1| penicillin-binding protein 2 [Neisseria meningitidis CU385]
 gi|325142968|gb|EGC65325.1| penicillin-binding protein 2 [Neisseria meningitidis 961-5945]
 gi|325144952|gb|EGC67235.1| penicillin-binding protein 2 [Neisseria meningitidis M01-240013]
 gi|325198904|gb|ADY94360.1| penicillin-binding protein 2 [Neisseria meningitidis G2136]
 gi|325199602|gb|ADY95057.1| penicillin-binding protein 2 [Neisseria meningitidis H44/76]
 gi|325202775|gb|ADY98229.1| penicillin-binding protein 2 [Neisseria meningitidis M01-240149]
 gi|325203520|gb|ADY98973.1| penicillin-binding protein 2 [Neisseria meningitidis M01-240355]
 gi|325205483|gb|ADZ00936.1| penicillin-binding protein 2 [Neisseria meningitidis M04-240196]
 gi|325208771|gb|ADZ04223.1| penicillin-binding protein 2 [Neisseria meningitidis NZ-05/33]
          Length = 581

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|120555369|ref|YP_959720.1| peptidoglycan glycosyltransferase [Marinobacter aquaeolei VT8]
 gi|120325218|gb|ABM19533.1| peptidoglycan synthetase FtsI [Marinobacter aquaeolei VT8]
          Length = 580

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 157/538 (29%), Positives = 259/538 (48%), Gaps = 29/538 (5%)

Query: 78  IVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLY 137
           +VV  + + ++ + ++    +  +    ++ ++     R  + DR+GE LA   P  +++
Sbjct: 33  LVVAGIGWRLVDLHVVDNDFLRKQGDVRTIRVESIDAHRGVVTDRHGEPLAVSTPVQTVW 92

Query: 138 VEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQWLRRKLSPQQQKRILSFGL 195
             P +    D  +  L  +L  L    +R +L   +  +F +LRRK+ P   +  L+ G+
Sbjct: 93  ANPSETDPEDPQLAALARIL-GLSEGALRERLRQYAGREFIYLRRKVQPSMAREALALGV 151

Query: 196 PGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE----KFLDMQ-GLTRVFTTNKGE 250
            G+  R E  R+YPA    +HVVG+ DID  G  GIE    K+L  + G  RV   N+G 
Sbjct: 152 GGIYARQEYRRYYPAGEVTAHVVGFTDIDEHGQEGIELAYNKWLTGEPGQKRVLKDNRGR 211

Query: 251 --KNLQPIR---------LALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
             K+L  IR         L++DLR+Q + ++EL      + A     V+L+V TGEV++M
Sbjct: 212 VIKDLMLIRDARPGKDLELSIDLRLQYLAYRELKAVVGAHKARGGTLVMLDVDTGEVLAM 271

Query: 300 VSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPI 359
           V+   Y+P++  +   E   N+    +FE GS  K  TIA  ++SG +TV    DT    
Sbjct: 272 VNQGSYNPNDRSQLAAENLRNKAITDLFEPGSTMKPLTIAAALESGEYTVNSTIDTSPGF 331

Query: 360 -KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETE 418
            + G+  I D H    +L + EI   SSN+G + IA  +G    +    RLGL       
Sbjct: 332 RRFGRFTIRD-HRNYGVLDLTEIIVKSSNVGVSNIATDLGGDTLRNLYARLGLGQATGIG 390

Query: 419 LP--EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
            P   +     P +W+ +   T+S+G+G+S   LQ A A   + N G   P + M   R+
Sbjct: 391 FPGEAVGVLPAPPKWRPVEESTLSYGYGMSVNALQLAQAYMVIANGGIRYPLSLM---RQ 447

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           E     + VL +   + +R +L++ V  G+G+RA    +  GGKTGT   V    Y D+ 
Sbjct: 448 EQRPQGQRVLSEQVTRAVRDMLKQAVARGTGKRAQPGLYAAGGKTGTVHLVGANGYEDSQ 507

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               F  + P  DP+ + +  +D+P+  E      G   AP+   ++  +  +L VKP
Sbjct: 508 YKAIFAGMAPIDDPRIVTVVAVDAPQAGE---YYGGEVAAPVFARVMGDALRLLNVKP 562


>gi|37651046|emb|CAD70590.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+ D RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSFDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|254494328|ref|ZP_05107499.1| penicillin binding protein 2 [Neisseria gonorrhoeae 1291]
 gi|38564791|gb|AAR23826.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|226513368|gb|EEH62713.1| penicillin binding protein 2 [Neisseria gonorrhoeae 1291]
          Length = 583

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 156/547 (28%), Positives = 274/547 (50%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     N    G+   P    I+  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVAGPPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LGV P 
Sbjct: 564 ILGVSPT 570


>gi|327479637|gb|AEA82947.1| penicillin-binding protein 3 [Pseudomonas stutzeri DSM 4166]
          Length = 576

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 148/499 (29%), Positives = 259/499 (51%), Gaps = 30/499 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET--KFQ 176
           I DRNGE LA   P  +L+  P ++ +      +L   L   D+ ++  +L S+   +F 
Sbjct: 63  ITDRNGEPLAVSTPVTTLWGNPKELQAARARWPELAKAL-GQDAAVLSERLQSQASREFM 121

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +L R L+P+Q + IL   +PGV  + E  RFYPA   A+HVVG+ DID+RG  G+E   D
Sbjct: 122 YLVRGLTPEQGQEILDLKIPGVYAQEEFRRFYPAGEVAAHVVGFTDIDDRGREGMELAYD 181

Query: 237 -----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYN 280
                + G  +V    +G         KN +P   + L++DLR+Q + H EL     +Y 
Sbjct: 182 EWLAGVPGKRQVLKDRRGRLIKDVQVTKNAKPGKAMALSIDLRLQYLAHSELRNVVHEYG 241

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A++   V+++V TGE+++M + P Y+P+     +     NR    +FE GS  K F+IA 
Sbjct: 242 AKAASLVMVDVKTGEILAMANQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSIAA 301

Query: 341 GIDSGLFTVKDLFDT-RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + +G +    + +T    +++G++ I D   +  +L++  I   SSN+G ++IA  +G 
Sbjct: 302 ALATGKYQPDSVVNTLPGWMRIGRYTIRDVS-RGGMLSLTGILMKSSNVGISKIALDIGA 360

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +     + + G         P  +  + P+  +W+   + ++++G+GLS T +Q A A A
Sbjct: 361 EPVYAVMQQAGFGQDTGLGFPGERVGNLPNHRKWRDAETASLAYGYGLSVTAVQLAHAYA 420

Query: 458 ALINEGRLIPPTFMIRSR-EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFE 516
            L N+G  +P + +   R ++  +V    +    ++ +R+++ E   GG G RA VPG+ 
Sbjct: 421 VLGNQGTNVPLSLLRLDRAQDGVQVIDKQISGTVLQMLRAVVEE--EGGGGARAKVPGYH 478

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLA-VFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           VGGK+GTA+K+          + SF A V P ++P+   +  +D P    + Q   G+  
Sbjct: 479 VGGKSGTAKKISGTGGYTKDAYRSFFAGVAPLSNPRIAAVVVVDEP---SKGQYYGGLVA 535

Query: 576 APMVGNIIRRSASMLGVKP 594
           AP+ G ++ R+  ++ V P
Sbjct: 536 APVFGKVMARALRLMNVAP 554


>gi|146281462|ref|YP_001171615.1| penicillin-binding protein 3 [Pseudomonas stutzeri A1501]
 gi|145569667|gb|ABP78773.1| penicillin-binding protein 3 [Pseudomonas stutzeri A1501]
          Length = 575

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 148/499 (29%), Positives = 259/499 (51%), Gaps = 30/499 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET--KFQ 176
           I DRNGE LA   P  +L+  P ++ +      +L   L   D+ ++  +L S+   +F 
Sbjct: 62  ITDRNGEPLAVSTPVTTLWGNPKELQAARARWPELAKAL-GQDAAVLSERLQSQASREFM 120

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +L R L+P+Q + IL   +PGV  + E  RFYPA   A+HVVG+ DID+RG  G+E   D
Sbjct: 121 YLVRGLTPEQGQEILDLKIPGVYAQEEFRRFYPAGEVAAHVVGFTDIDDRGREGMELAYD 180

Query: 237 -----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYN 280
                + G  +V    +G         KN +P   + L++DLR+Q + H EL     +Y 
Sbjct: 181 EWLAGVPGKRQVLKDRRGRLIKDVQVTKNAKPGKAMALSIDLRLQYLAHSELRNVVHEYG 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A++   V+++V TGE+++M + P Y+P+     +     NR    +FE GS  K F+IA 
Sbjct: 241 AKAASLVMVDVKTGEILAMANQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSIAA 300

Query: 341 GIDSGLFTVKDLFDT-RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + +G +    + +T    +++G++ I D   +  +L++  I   SSN+G ++IA  +G 
Sbjct: 301 ALATGKYQPDSVVNTLPGWMRIGRYTIRDVS-RGGMLSLTGILMKSSNVGISKIALDIGA 359

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +     + + G         P  +  + P+  +W+   + ++++G+GLS T +Q A A A
Sbjct: 360 EPVYAVMQQAGFGQDTGLGFPGERVGNLPNHRKWRDAETASLAYGYGLSVTAVQLAHAYA 419

Query: 458 ALINEGRLIPPTFMIRSR-EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFE 516
            L N+G  +P + +   R ++  +V    +    ++ +R+++ E   GG G RA VPG+ 
Sbjct: 420 VLGNQGTNVPLSLLRLDRAQDGVQVIDKQISGTVLQMLRAVVEE--EGGGGARAKVPGYH 477

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLA-VFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           VGGK+GTA+K+          + SF A V P ++P+   +  +D P    + Q   G+  
Sbjct: 478 VGGKSGTAKKISGTGGYTKDAYRSFFAGVAPLSNPRIAAVVVVDEP---SKGQYYGGLVA 534

Query: 576 APMVGNIIRRSASMLGVKP 594
           AP+ G ++ R+  ++ V P
Sbjct: 535 APVFGKVMARALRLMNVAP 553


>gi|325128830|gb|EGC51689.1| penicillin-binding protein 2 [Neisseria meningitidis N1568]
          Length = 581

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPIDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|294627719|ref|ZP_06706301.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664074|ref|ZP_06729475.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598071|gb|EFF42226.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292606159|gb|EFF49409.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 622

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 155/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    R    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDDLNARLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHRVMEGALRLMDVPP 556


>gi|325915640|ref|ZP_08177948.1| peptidoglycan synthetase FtsI [Xanthomonas vesicatoria ATCC 35937]
 gi|325538200|gb|EGD09888.1| peptidoglycan synthetase FtsI [Xanthomonas vesicatoria ATCC 35937]
          Length = 620

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 253/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    R    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIAELAKALGQPLDELNARLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVALKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTIIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   +     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESSGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVAREVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHKVMEGALRLMDVPP 556


>gi|31296653|gb|AAP46619.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  217 bits (553), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFGPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|161870661|ref|YP_001599834.1| penicillin-binding protein 2 [Neisseria meningitidis 053442]
 gi|161596214|gb|ABX73874.1| penicillin-binding protein 2 [Neisseria meningitidis 053442]
          Length = 549

 Score =  217 bits (552), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 42  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPIDVLRNKLEQK 100

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 101 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 160

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 161 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 220

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 221 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 280

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 281 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 336

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 337 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 396

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 397 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 452

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 453 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 509

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 510 GYYGGVVAGPPFKKIMGGSLNILGISPT 537


>gi|317484857|ref|ZP_07943749.1| penicillin binding transpeptidase domain-containing protein
           [Bilophila wadsworthia 3_1_6]
 gi|316923903|gb|EFV45097.1| penicillin binding transpeptidase domain-containing protein
           [Bilophila wadsworthia 3_1_6]
          Length = 694

 Score =  217 bits (552), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 246/507 (48%), Gaps = 28/507 (5%)

Query: 107 MNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIR 166
           M  +   M R  I DRNG ILA  +   S+Y  P  +   +     L  VL     + I+
Sbjct: 80  MAAETVAMPRGMITDRNGHILARSVECCSVYANPSIITDIEATATTLAGVL-GRPVDQIK 138

Query: 167 RKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR 226
             L  +  F W+ R++     + I    L GV    E  R YP    A  ++G+V +D +
Sbjct: 139 PLLEKKRSFVWIARRVDDATAEAIRQADLTGVELSREFERIYPYRQVAGQLLGFVGMDGK 198

Query: 227 GITGIEKFLDMQ--GLT-----------RVFTTNKG--EKNLQPIRLALDLRIQNIVHQE 271
           G+ GIE+  D Q  GL+           R F  N     +  + + L LDL++Q+I  +E
Sbjct: 199 GLEGIERSFDEQLGGLSVRQAVRRDASGREFYVNSNYEAQPAEDVHLTLDLQVQSIAEEE 258

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           + +   ++ A+  G ++++V+ G+V++    P ++P+   + +   + NR++    E GS
Sbjct: 259 ISKAVTEFGAKWGGVLVVDVAAGDVLAWAQFPFFNPNSYNQYRPSEYRNRLAQDALEPGS 318

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVI--HDYHPQNRILTIPEIFRYSSNIG 389
            FK F IA  +  G+ T    F+  N +   +++    D  P+  I ++ +I   SSNIG
Sbjct: 319 TFKPFLIASALQEGVVTRDTTFNCENGLWKSRYITIRDDSRPKQNIQSVAKILANSSNIG 378

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS-QWKRIHSLTISFGHGLSTT 448
             +I   +G   ++ +L RLG   +   +L E +    P+ +W     ++ SFG  LS T
Sbjct: 379 CGKIGLELGAVKYQRYLSRLGFGERTSVQLAESRGILRPAREWSEADLISSSFGQSLSVT 438

Query: 449 PLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR 508
            LQ A A   L NEG +  P  ++ + +      RI   KNT + + S++RE V  G+G+
Sbjct: 439 VLQMAQAYLTLANEG-VYKPLRIVLTDDVGGGDQRI-FSKNTTREVLSMMREVVDEGTGK 496

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP-KIKERN 567
           RA +PG  V GKTGTAQK  + +Y       SF+ + P   PQY+V+ F+D P K+K   
Sbjct: 497 RAAIPGVSVAGKTGTAQKAFRGKYGGERT-ASFVGLVPAEKPQYLVVIFIDEPSKVK--- 552

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+  AP+  ++  R  +  G  P
Sbjct: 553 --YGGVIAAPVFKSVTSRVMAYHGSLP 577


>gi|298531027|ref|ZP_07018428.1| Peptidoglycan glycosyltransferase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509050|gb|EFI32955.1| Peptidoglycan glycosyltransferase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 652

 Score =  217 bits (552), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 167/572 (29%), Positives = 279/572 (48%), Gaps = 46/572 (8%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS---- 115
           Q  R+K   +S+ +IG+ +  C + +  L  R +Q   +  E +A       +       
Sbjct: 4   QPPRKKTKEYSRIKIGLVLAFCFIFWGALWARALQVQVLQGEELAEQAQRQYFSQEKIMG 63

Query: 116 -RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
            R +I DR G +LA  + + S+Y  P  +        +L  +L ++D + IR +L  ++ 
Sbjct: 64  KRGEIFDRQGRVLAQSVRSKSVYANPFLMDDIHAQAAELGRIL-DVDPDSIRVRLGRKSS 122

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL RK+S +    ++S  LPGV    E SR YP       V+G+V IDN G+ G+E+ 
Sbjct: 123 FVWLDRKVSDRVAHEVVSADLPGVFIVDEHSRVYPQKHMLGQVLGFVGIDNTGLEGLERS 182

Query: 235 LD--MQGLTRVFTTNK---GEK-NLQP-----------IRLALDLRIQNIVHQELVENKK 277
           LD  + G   V    +   G++ +L P           + L +D R+Q  V Q L +  +
Sbjct: 183 LDKRLSGAEMVLVRQRDASGQRFSLMPRQPDQQVDGEDVHLTIDSRMQFHVEQALADAVE 242

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + N +S   ++++V TG+++S  + P ++P+       + W NR +  + E GS  K F 
Sbjct: 243 ENNGQSGVAMVVHVPTGDILSWANYPFFNPNNYRASSPDIWRNRGATDLIEPGSTLKPFL 302

Query: 338 IAMGIDSGLFTVKDLFDT-RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           +A  ++  +     L+   +   ++G + I D   +   LT+  I RYSSNIGAA++   
Sbjct: 303 VAAALEENVARGDSLYYCEQGQWRLGNNQIKDVR-EYGWLTVNRILRYSSNIGAAKVGMD 361

Query: 397 MGIQGHKEFLYRLGLLSKLETELP----EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQT 452
           +G      +L RLGL      ++P     +  P  P+ W  +   TISFG G++T+ LQ 
Sbjct: 362 LGAGTLHSYLTRLGLDQATGAQVPGQSRGLLRP--PNTWSNMDLATISFGQGMATSFLQL 419

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVS--RIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           A A A L N G       +   +E+S  VS  + V  +   + + +++R+ V   G+G R
Sbjct: 420 ARAYATLGNHGVYTDLNIL---QEQSSPVSSQQRVFSRGVSRDVLAMMRDSVERDGTGTR 476

Query: 510 AFVPGFEVGGKTGTAQKVI-KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           A + G EVGGKTGTAQK   +  YSD     SF+   P  DP+Y+++  +D P+    + 
Sbjct: 477 ARISGIEVGGKTGTAQKASPQGGYSDEY-VASFVGFLPAMDPEYMIMVLVDEPE----SP 531

Query: 569 LTAGINVAPM---VGNIIRRSASMLGVKPVFL 597
              G+  AP    +G  +  S   LG++ + L
Sbjct: 532 YYGGLVAAPAFQRIGGRLLSSQKGLGLRSLAL 563


>gi|166710647|ref|ZP_02241854.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 625

 Score =  217 bits (552), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 250/498 (50%), Gaps = 31/498 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
           I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  +F +
Sbjct: 71  ITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKASKEFMY 130

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D 
Sbjct: 131 LQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDE 190

Query: 237 ----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYNA 281
                 G  +V    +G         +  QP   + L++D RIQ + ++EL     + NA
Sbjct: 191 WLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNA 250

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
                V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  
Sbjct: 251 AGGAMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATA 310

Query: 342 IDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA  +  
Sbjct: 311 LTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPD 369

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A
Sbjct: 370 QTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYA 429

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
            L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  R A + G+ V
Sbjct: 430 TLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGARGAAILGYHV 485

Query: 518 GGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVA 576
            GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G+  A
Sbjct: 486 AGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGGLVSA 541

Query: 577 PMVGNIIRRSASMLGVKP 594
           P+   ++  +  ++ V P
Sbjct: 542 PVFHKVMEGALRLMDVPP 559


>gi|240128814|ref|ZP_04741475.1| Pbp2 [Neisseria gonorrhoeae SK-93-1035]
 gi|268687196|ref|ZP_06154058.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-93-1035]
 gi|293398481|ref|ZP_06642659.1| cell division protein FtsI (penicillin binding protein 3)
           [Neisseria gonorrhoeae F62]
 gi|129665|sp|P08149|PBP2_NEIGO RecName: Full=Penicillin-binding protein 2; Short=PBP-2
 gi|150279|gb|AAA25463.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
 gi|268627480|gb|EEZ59880.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-93-1035]
 gi|291610952|gb|EFF40049.1| cell division protein FtsI (penicillin binding protein 3)
           [Neisseria gonorrhoeae F62]
          Length = 581

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 156/549 (28%), Positives = 276/549 (50%), Gaps = 39/549 (7%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            +T+ P K+G   + D H  P    L +  I + SSN+G ++++   G +   +F + LG
Sbjct: 332 LNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELG 387

Query: 411 LLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +  ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P 
Sbjct: 388 IGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPL 447

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQK 526
           +F    ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K
Sbjct: 448 SF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARK 503

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+   P    I+  S
Sbjct: 504 FVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGPPFKKIMGGS 560

Query: 587 ASMLGVKPV 595
            ++LG+ P 
Sbjct: 561 LNILGISPT 569


>gi|32345868|gb|AAM97228.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T++  K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQS-YKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|31296657|gb|AAP46621.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  216 bits (551), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   +    +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNGRLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|31296581|gb|AAP46583.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LGV P 
Sbjct: 542 GYYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|31296683|gb|AAP46634.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAPLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G++   +F + LG+  ++ +  P   A    +  +W+ I   T+S G+GL  + 
Sbjct: 369 KLSARFGVEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSCGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|289663642|ref|ZP_06485223.1| penicillin-binding protein 3 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 622

 Score =  216 bits (550), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDSIIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHRVMEGALRLMDVPP 556


>gi|194099357|ref|YP_002002457.1| penicillin-binding protein 2 [Neisseria gonorrhoeae NCCP11945]
 gi|38564793|gb|AAR23827.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|193934647|gb|ACF30471.1| penicillin-binding protein 2 [Neisseria gonorrhoeae NCCP11945]
 gi|283379454|dbj|BAI66136.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 583

 Score =  216 bits (550), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 155/547 (28%), Positives = 274/547 (50%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     +    G+   P    I+  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HSYYGGVVAGPPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LGV P 
Sbjct: 564 ILGVSPT 570


>gi|31296659|gb|AAP46622.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345840|gb|AAM97214.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A    AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARTYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|31296655|gb|AAP46620.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|311029922|ref|ZP_07708012.1| stage V sporulation protein D [Bacillus sp. m3-13]
          Length = 645

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 164/568 (28%), Positives = 286/568 (50%), Gaps = 55/568 (9%)

Query: 71  KNRIGMTIVVCLVIYIILAIRI--IQY--GNIHPEPIAPSMNID-EYGMSRPDIIDRNGE 125
           + R+ + ++V ++++ I+ +R+  +Q+  GN+  +    S + +  +   R +I+DRNG 
Sbjct: 9   RRRLTIVLLVGILLFSIIDLRLGYVQFALGNMLTDRAKDSWSRNIPFEPERGEILDRNGV 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---RKL 182
            LAT++   ++ V P ++  P++  EKL  VL N+  E + + ++  +  + +    RK+
Sbjct: 69  PLATNMSAPTVLVVPRQIKDPNDTAEKLAAVL-NMSKEKVYKLVTKSSSMERINPEGRKI 127

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ---- 238
           S ++ K I + GL GV    +  R YP  S+ SHV+G+  IDN+G+ G+E + D Q    
Sbjct: 128 SHEKAKEIRALGLKGVYIAEDSKRHYPFGSYLSHVLGFAGIDNQGLMGLELYYDEQLKGE 187

Query: 239 -GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
            G  + ++  KG +            +   +RL +D ++Q I+ +EL   ++ YN + + 
Sbjct: 188 KGYVQFYSDAKGRRMPDIPDDYEAPQDGLDLRLTIDSKVQTIMERELDLAQELYNPDGII 247

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIFKVFTIAMGID 343
            + ++ +TGE+++M S PD+DP E F+      +NR    +  +E GS FK+ T+A  ++
Sbjct: 248 AIAMDPNTGEILAMSSRPDFDPAE-FQNVAPEIYNRNLPVWSTYEPGSTFKIITLAAALE 306

Query: 344 SGLFTVK-DLFDTRNPIKVGKHVIHDY----HPQNRILTIPEIFRYSSNIGAAQIADAMG 398
                +K D F+      V    +  +    H     L   E+ + S N G  ++   +G
Sbjct: 307 ENKVNLKNDTFNDSGAAMVDGARLRCWKKGGHGHQTFL---EVVQNSCNPGFVELGQRLG 363

Query: 399 IQGHKEFLYRLGLLSKLETELP-EIQAPSY-PSQWKRIHSLTISFGHGLSTTPLQTAVAA 456
            +    ++   G   K   +L  E +   + P +   +   T +FG G+S TP+Q   A 
Sbjct: 364 TETLFNYIKSFGFGEKTGIDLAGEGKGILFKPERVGPVELATTAFGQGVSVTPIQQVAAV 423

Query: 457 AALINEGRLIPPTF-----------MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGG 505
           +A +N G L  P             ++  +   EK  R V+ + T   +R  L   V  G
Sbjct: 424 SAAVNGGILYTPFIAKEFVDPISGDIVSRKTPVEK--RRVISEETSAQVRYALESVVAQG 481

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +GR AFV G+ VGGKTGTAQKV   RY +  +  SF+ V P  DPQ +V   +D+PK   
Sbjct: 482 TGRNAFVEGYRVGGKTGTAQKVKDGRYMENNHIVSFIGVAPADDPQLVVYLAVDNPKGTV 541

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVK 593
           +     G+  AP+VGNI+  S + LGV+
Sbjct: 542 Q---FGGVVAAPIVGNIMEDSLNALGVE 566


>gi|31296625|gb|AAP46605.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 153/507 (30%), Positives = 256/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|304386667|ref|ZP_07368949.1| cell division protein FtsI/penicillin-binding protein [Neisseria
           meningitidis ATCC 13091]
 gi|467781|emb|CAA53903.1| penicillin-binding protein 2 [Neisseria sicca]
 gi|31296597|gb|AAP46591.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|254671180|emb|CBA08301.1| peptidoglycan synthetase precursor [Neisseria meningitidis
           alpha153]
 gi|304339252|gb|EFM05330.1| cell division protein FtsI/penicillin-binding protein [Neisseria
           meningitidis ATCC 13091]
          Length = 581

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|32345872|gb|AAM97230.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A     L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARTYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|58583454|ref|YP_202470.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428048|gb|AAW77085.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 625

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 67  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 126

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 127 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 186

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 187 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 246

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 247 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 306

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 307 VATALTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPHNNGVLNVTGVITRSSNIGAAKIAA 365

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 366 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 425

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 426 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 481

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 482 GYHVAGKTGTARKNGASGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 537

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 538 LVSAPVFHKVMEGALRLMDVPP 559


>gi|21241544|ref|NP_641126.1| penicillin-binding protein 3 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21106895|gb|AAM35662.1| penicillin-binding protein 3 [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 622

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDDLNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHRVMEGALRLMDVPP 556


>gi|242278173|ref|YP_002990302.1| peptidoglycan glycosyltransferase [Desulfovibrio salexigens DSM
           2638]
 gi|242121067|gb|ACS78763.1| Peptidoglycan glycosyltransferase [Desulfovibrio salexigens DSM
           2638]
          Length = 648

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 158/566 (27%), Positives = 271/566 (47%), Gaps = 44/566 (7%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIIL-----AIRIIQYGN----IHPEPIAPSMNIDE 111
           KR+++ +  S+N++   +V+  +++  L      +++ +  +    +  + +A  +   E
Sbjct: 3   KRKKESLKASRNKLLFVMVLFALVWTGLLGRAAWLQLFKGADLSRMVSRQHLAAELERGE 62

Query: 112 YGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS 171
            G     I DRNG +LAT +   S+Y+ P KV   D    KL  +L  +    +R+KLS 
Sbjct: 63  RG----SIYDRNGNLLATSVEASSVYIRPVKVTDVDGTAYKLSKIL-GISQAKLRKKLSR 117

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
           ++ F W++R+++ +  +++    LPGV    E  R YP    A  ++G+  ID  G+ G+
Sbjct: 118 KSNFIWIKRQINDRIAQKVEQAKLPGVYLTTEYIRLYPNNYLAGQLLGFSGIDGNGLEGL 177

Query: 232 EK-FLD-MQGLTRVFTTNKGEKNL---------------QPIRLALDLRIQNIVHQELVE 274
           EK F D + G    F   +                    + I L +D  +Q++    L E
Sbjct: 178 EKEFNDRLAGRKAQFVVQRDASGRRLYLDAMGREMDVRGKDIHLTIDSHLQSVTENALAE 237

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             KKYN +    +++  ++G+V++M + P ++P+         W NR +  + E GS FK
Sbjct: 238 AVKKYNGKWGSAIVVEAASGDVLAMANFPLFNPNIFRTSAPNIWRNRAALDVHEPGSTFK 297

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
            F +A  ++  + T + LFD  N   K+    I D H +   L + +I RYSSNIG A+I
Sbjct: 298 PFLMAAALEHKVVTPEKLFDCENGRWKINGKYIKDTHKEG-WLPVHKILRYSSNIGCAKI 356

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQA----PSYPSQWKRIHSLTISFGHGLSTTP 449
              +G+Q + +F+  LG   K    +P  +     P+  ++W  I     SFG G+  T 
Sbjct: 357 GLELGVQNYHKFITDLGFGHKTGLPIPGDRKGLIRPA--AKWNEIDLAAGSFGQGVGVTT 414

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGR 508
           +Q A A   + N+G   P   +   R + E   + +   +  + + +++RE V   G+GR
Sbjct: 415 VQMAKAFLTIANKGVEKPLRLVQYPRSDQEDQPKRIFSADVAEKVLAMMREVVQDDGTGR 474

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           +A + G  V GKTGTAQK  +K    T    SF+A+ P  +P YIV   +D PK      
Sbjct: 475 KARISGTTVAGKTGTAQKAHRKGGYGTEYIASFVALVPGYNPDYIVYMMVDDPKPNHYGS 534

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
             A    AP V  I+ ++ +  G  P
Sbjct: 535 TVA----APAVKEIMTQTLAYYGKLP 556


>gi|296122040|ref|YP_003629818.1| peptidoglycan glycosyltransferase [Planctomyces limnophilus DSM
           3776]
 gi|296014380|gb|ADG67619.1| Peptidoglycan glycosyltransferase [Planctomyces limnophilus DSM
           3776]
          Length = 561

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 168/545 (30%), Positives = 265/545 (48%), Gaps = 47/545 (8%)

Query: 79  VVCLVIYIILAIRIIQYGNIHPEPIAPSMN----IDEYGMSRP-DIIDRNGEILATDIPT 133
           V  LV+ ++L  R+IQ   +  +  + + +      +   +RP DI+D +G ILAT + T
Sbjct: 6   VGALVVSVVLGGRLIQLQVLEQDDFSRTASGQRIFRQTVPARPGDILDSSGRILATTVTT 65

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRIL 191
            S ++ P  +  P+    K+  VL  LD + + +K+  SS+++F W++R+L P +   I 
Sbjct: 66  QSFFLVPSLIDEPESFATKVASVL-QLDPQKLSQKIQNSSKSQFLWIKRRLDPSEVISIR 124

Query: 192 SFGLP--GVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK---------------F 234
              LP    GFR E  R YP    A+HV+G  +ID  G  GIE+                
Sbjct: 125 ELKLPRDQWGFREEYRRVYPQGQIAAHVLGLRNIDGLGQGGIEESQESILAGQPGYETLL 184

Query: 235 LDMQGL------TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
            D +G       T     + GE     + L +D  IQ    + L E   ++   SV  + 
Sbjct: 185 RDARGRVLEIDPTSTLPMSPGES----VTLTIDTVIQLQTERVLDEVMTQWQPSSVCAIA 240

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           ++  TGE++SM S P +DP++      + W NR    I+E GS FK   +A G+++GL  
Sbjct: 241 MDPHTGEILSMASRPTFDPNQPELAGSDSWKNRAIADIYEPGSTFKPLIVAYGLEAGLIQ 300

Query: 349 VKDLFDT-RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
              +FD  R   ++G+ V+HD H     L++ ++   SSNIG A++ + +G     E   
Sbjct: 301 KDQVFDCERGQYRMGRRVLHDTHAYGS-LSLTDVLVKSSNIGMAKVGELLGNAELFEAAQ 359

Query: 408 RLGLLSK----LETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           R G+  +    L  ELP +  P   SQW    + +I  GH L+ TPLQ   A AA+ N G
Sbjct: 360 RFGIGRRTGIELTGELPGLLRPL--SQWNSYSTGSIPMGHELAATPLQMIAAHAAIANGG 417

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL-LREGVTGGSGRRAFVPGFEVGGKTG 522
               PT +   RE   +VS+ V+  +    M S  LRE VT G+G++A +  +EV GKTG
Sbjct: 418 VWRSPTIIKAPRESRTQVSQQVISSDVSHWMISEPLREVVTRGTGKKAQLADYEVFGKTG 477

Query: 523 TAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           TAQ ++    YS     +SF+   P   P+ IVL  ++   +    +   G   AP    
Sbjct: 478 TAQVLLASGGYSHGKYVSSFICGAPIDKPRAIVLVVVNEASVG--GEAFGGKVAAPAAAE 535

Query: 582 IIRRS 586
           I++ +
Sbjct: 536 ILKHT 540


>gi|31296595|gb|AAP46590.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296613|gb|AAP46599.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPIDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|296313575|ref|ZP_06863516.1| peptidoglycan synthetase FtsI [Neisseria polysaccharea ATCC 43768]
 gi|296839876|gb|EFH23814.1| peptidoglycan synthetase FtsI [Neisseria polysaccharea ATCC 43768]
          Length = 581

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+V P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFVVPKDMKEMPSAAQLERLSELV-DVPVDVLRSKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPASVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPARNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVAGPVFKQVMGGSLNILGVSPT 569


>gi|31296615|gb|AAP46600.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|291615180|ref|YP_003525337.1| peptidoglycan glycosyltransferase [Sideroxydans lithotrophicus
           ES-1]
 gi|291585292|gb|ADE12950.1| Peptidoglycan glycosyltransferase [Sideroxydans lithotrophicus
           ES-1]
          Length = 577

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 152/497 (30%), Positives = 250/497 (50%), Gaps = 34/497 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQ 176
           I DR+GE LA   P  S++  P  V I+P + +   QIV   L  + ++ KLS   + F 
Sbjct: 71  ITDRHGEPLAVSTPVESVWASPGDVEITPAQTVRLAQIV--GLPPQEVKSKLSDTAREFV 128

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +++R+L P Q  +++  G+PG+  + E  R+YP     SH++G+ D+D+ G  GIE  L 
Sbjct: 129 YIKRQLPPDQAAKVIQLGIPGISLQREYRRYYPGGEVTSHLIGFTDVDDNGQEGIELALQ 188

Query: 237 MQ-----GLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
            Q     G  +V    +G            K    + L++D +IQ++  +E+ +    + 
Sbjct: 189 AQLGGKAGSQQVIKDRRGFIVEDVASLRAPKAGGDVALSIDSKIQSLAFREIKQAVVNHK 248

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A+S   V+L+  TGEV+++ + P Y+P+   K       NR     +E GS  K FTIA 
Sbjct: 249 AKSGSIVVLDAKTGEVLALANWPSYNPNNREKPSVAVLRNRAVTDEYEPGSTMKPFTIAT 308

Query: 341 GIDSGLFTVKDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + +G      + +T N +  V    IHD HP +R L++ +I + SSN+GAA+IA ++  
Sbjct: 309 ALQAGTIKPNTVINTANGMFTVNGRTIHDTHP-DRALSVTQIIQRSSNVGAAKIALSLPP 367

Query: 400 QGHKEFLYRLGLLSKLETELP---EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAA 456
           +     L   G  S   +E P   E +   Y  +W+ I   TI++G+G+S   LQ A A 
Sbjct: 368 ETLWNGLSEDGFGSPTGSEFPGEAEGKLRDY-KKWRPIDQATIAYGNGISVNLLQLARAY 426

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
               N+G L P T +   ++E+  +   V    TV+ +R ++   V  GG+   A + G+
Sbjct: 427 TVFANDGELKPVTLL---KQETPSLGVKVYSAATVQEVRDMMETVVKPGGTAPLAQITGY 483

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V GKTGTA K+   +Y D     SF+ + P +DP+ IV   ++ P  ++      G   
Sbjct: 484 RVAGKTGTAHKLENGKYVDRY-IASFVGLAPASDPRLIVAVKINEPSGRD---YYGGEVA 539

Query: 576 APMVGNIIRRSASMLGV 592
           AP+  N++  +  ML V
Sbjct: 540 APVFSNVMGATLRMLNV 556


>gi|32345878|gb|AAM97233.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|325925692|ref|ZP_08187070.1| peptidoglycan synthetase FtsI [Xanthomonas perforans 91-118]
 gi|325543908|gb|EGD15313.1| peptidoglycan synthetase FtsI [Xanthomonas perforans 91-118]
          Length = 622

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHRVMEGALRLMDVPP 556


>gi|84625266|ref|YP_452638.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188575292|ref|YP_001912221.1| peptidoglycan synthetase FtsI [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84369206|dbj|BAE70364.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519744|gb|ACD57689.1| peptidoglycan synthetase FtsI [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 622

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPHNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGASGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHKVMEGALRLMDVPP 556


>gi|59801878|ref|YP_208590.1| Pbp2 [Neisseria gonorrhoeae FA 1090]
 gi|240124144|ref|ZP_04737100.1| Pbp2 [Neisseria gonorrhoeae PID332]
 gi|260439869|ref|ZP_05793685.1| Pbp2 [Neisseria gonorrhoeae DGI2]
 gi|268682769|ref|ZP_06149631.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID332]
 gi|291043145|ref|ZP_06568868.1| penicillin-binding protein 2 [Neisseria gonorrhoeae DGI2]
 gi|509155|emb|CAA42191.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|59718773|gb|AAW90178.1| penicillin-binding protein 2 [Neisseria gonorrhoeae FA 1090]
 gi|268623053|gb|EEZ55453.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID332]
 gi|291012751|gb|EFE04734.1| penicillin-binding protein 2 [Neisseria gonorrhoeae DGI2]
          Length = 582

 Score =  215 bits (548), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/547 (28%), Positives = 274/547 (50%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K +
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKFV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY+D  +  +F+   P  +P+ IV   +D P     +    G+   P    I+  S +
Sbjct: 507 NGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGPPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LG+ P 
Sbjct: 564 ILGISPT 570


>gi|322421368|ref|YP_004200591.1| peptidoglycan glycosyltransferase [Geobacter sp. M18]
 gi|320127755|gb|ADW15315.1| Peptidoglycan glycosyltransferase [Geobacter sp. M18]
          Length = 654

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 161/510 (31%), Positives = 237/510 (46%), Gaps = 36/510 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           SR  I DRN    A  I   S Y E   + +  E   +L  VL     E+   KL     
Sbjct: 59  SRGGIYDRNNAPFAVSIEMDSCYAETRNIENIPEAAAQLAPVLGYAKDEL-EAKLKGAKN 117

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL R+++P+Q K++ + G+ G+GF  E  RFYP +  A+HV+G+  +D  G+ G+EK 
Sbjct: 118 FVWLSRRMAPEQAKKVKALGVEGIGFVKESRRFYPNSQVAAHVIGFTGVDPTGLEGVEKK 177

Query: 235 LDM-------------QGLTRVFTTNKGEKNLQP-----IRLALDLRIQNIVHQELVENK 276
            D                L R     KG +         + L LD  IQ I  +EL +  
Sbjct: 178 YDSTILGNTGYLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLDKNIQYIAEKELSKAV 237

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
           +K  A+    +++   TG +++M + P ++P+           N      FE GS FK+F
Sbjct: 238 EKNGAKGGIAIVMEPDTGRILAMANYPAFNPNNIAGYGPAALRNHAIADSFEPGSTFKIF 297

Query: 337 TIAMGIDSGLFTVKDLFDTRN-PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
            +A  +++G+    D F+  N    +    IHD H +   LT+P+I +YSSNIGAA+I  
Sbjct: 298 LVASALEAGVIRPGDSFNCENGSCYMYGRTIHDTH-KYGALTVPQILKYSSNIGAAKIGQ 356

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTA 453
            +G Q     L   G   K   +LP   A     Q  W  I   TISFG G++ T LQ  
Sbjct: 357 RLGPQRLYSALSGFGFGEKSSIDLPGEAAGMLRPQEKWYGIDLATISFGQGVTATALQLT 416

Query: 454 VAAAALINEGRLIPPTFMIRSREES--------EKVSRIVLKKNTVKTM-RSLLREGVTG 504
            A +A+ N G L+ P  + R  +++         +V R V+  +T K++ R L      G
Sbjct: 417 SAVSAVANGGNLMKPYLVDRVVDDNGVVLQQFGPQVKRRVISADTAKSVARMLEGVVGEG 476

Query: 505 GSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK 564
           G+G  A V G+ V GKTGTAQKV  + YS +    SF+   P   P+  VL  +D P   
Sbjct: 477 GTGTGAAVEGYRVAGKTGTAQKVEGRTYSASKRIASFVGFVPVEKPRLTVLVMVDEPTA- 535

Query: 565 ERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
               +  GI  AP    I +++   L V P
Sbjct: 536 ---NVYGGIVAAPAFSAISQQTLCYLNVPP 562


>gi|240126240|ref|ZP_04739126.1| Pbp2 [Neisseria gonorrhoeae SK-92-679]
 gi|268684821|ref|ZP_06151683.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-92-679]
 gi|40388705|gb|AAR85530.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|268625105|gb|EEZ57505.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-92-679]
          Length = 582

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 154/547 (28%), Positives = 274/547 (50%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     +    G+   P    I+  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGPPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LG+ P 
Sbjct: 564 ILGISPT 570


>gi|325923947|ref|ZP_08185537.1| peptidoglycan synthetase FtsI [Xanthomonas gardneri ATCC 19865]
 gi|325545573|gb|EGD16837.1| peptidoglycan synthetase FtsI [Xanthomonas gardneri ATCC 19865]
          Length = 622

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 153/502 (30%), Positives = 252/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVELKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTIIDT-NPGYMAVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   +     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESSGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVVTPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHKVMEGALRLMDVPP 556


>gi|31296627|gb|AAP46606.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 151/509 (29%), Positives = 256/509 (50%), Gaps = 41/509 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSGLV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  S  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD--------------------MQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQE 271
           E  L+                    + GL      NK  +N + I L+LD RIQ + ++E
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDGLDS--PRNKAPQNGKDIILSLDQRIQTLAYEE 250

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L +  + + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS
Sbjct: 251 LNKAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGS 310

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIG 389
             K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G
Sbjct: 311 AIKPFVIAKALDAGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLST 447
            ++++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  
Sbjct: 367 TSKLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGS 506
           + LQ A A  AL ++G L+P +F    ++      + V+K +T K +R L+      GG+
Sbjct: 427 SLLQLARAYTALTHDGVLLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GTAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA--- 540

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           N    G+   P    I+  S ++LGV P 
Sbjct: 541 NGYYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|31296663|gb|AAP46624.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+S G+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSCGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|509157|emb|CAA42190.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|253997375|ref|YP_003049439.1| peptidoglycan glycosyltransferase [Methylotenera mobilis JLW8]
 gi|253984054|gb|ACT48912.1| Peptidoglycan glycosyltransferase [Methylotenera mobilis JLW8]
          Length = 574

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 151/501 (30%), Positives = 252/501 (50%), Gaps = 36/501 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK- 174
           R  I DR GE+LA   P  S++  P  V       +KL  +L +   + I +KL++ T+ 
Sbjct: 64  RGKITDRYGELLAISSPVESVWANPSDVKITAAQTKKLAELL-SFKKDTIDKKLANNTRE 122

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +L+R++SP+    I+  G+PGV  + E  R+YPA    +H+VG+ DID++G  G E  
Sbjct: 123 FVYLKRRVSPELAAEIMQLGIPGVYLQREYKRYYPAGDVTAHLVGFTDIDDKGQEGFELA 182

Query: 235 LD-----MQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKK 278
           ++       G  +V     G   ++L+ ++         L++D RIQ +  +EL +  +K
Sbjct: 183 MNSSLSGKNGSRKVIKDRAGRIIEDLEAVKVPQDGADITLSIDRRIQYLAQRELTKAVEK 242

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEA--FKGKKEGWFNRISYGIFEMGSIFKVF 336
           + A +   V+L+  TGEV++MV++P Y+P+     +GK     NR    IFE GS  K  
Sbjct: 243 FKANAGAAVVLDAKTGEVLAMVNVPTYNPNNPINIQGKTR---NRAITDIFEPGSTMKTV 299

Query: 337 TIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           T+A  +++G +T   +  T    + +G   IHD HP   ++++ E+ + SSN+G+A++A 
Sbjct: 300 TVAAALETGKYTPDTMIQTAPGYMSIGPATIHDAHPHG-LMSVSEVIQKSSNVGSAKMAL 358

Query: 396 AMGIQGHKEFLYRLGLLSKLETELP-EIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQT 452
           ++  Q        +G  +K     P E+      Y + W+ I   T+S+GHG+S T LQ 
Sbjct: 359 SLEPQYLWGVFNLIGFGAKTRIGFPGEVSGKLRGYKT-WRPIEQATMSYGHGISVTLLQM 417

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAF 511
           A A     N+G L P + +   + +   V   V    T   ++S+L   V  GG+  RA 
Sbjct: 418 ARAYTVFANDGELKPVSLL---KLKDAPVGTQVFSAKTANEVKSMLELVVLPGGTALRAQ 474

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           V G+ V GKTGT  K+    Y       SF+ + P ++P+ I+   +D P      +   
Sbjct: 475 VLGYRVAGKTGTTLKLGDHGYEKNKYVGSFVGMAPASNPRLIMAVMIDDP---SSGEYYG 531

Query: 572 GINVAPMVGNIIRRSASMLGV 592
           G   AP+   ++  +  ML V
Sbjct: 532 GTVAAPVFSAVMADALRMLSV 552


>gi|78046381|ref|YP_362556.1| cell division protein FtsI [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78034811|emb|CAJ22456.1| cell division protein FtsI [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 622

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 251/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA+IA 
Sbjct: 304 VATALTAGVVTKDTVIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q     +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYHSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHRVMEGALRLMDVPP 556


>gi|225023747|ref|ZP_03712939.1| hypothetical protein EIKCOROL_00611 [Eikenella corrodens ATCC
           23834]
 gi|224943629|gb|EEG24838.1| hypothetical protein EIKCOROL_00611 [Eikenella corrodens ATCC
           23834]
          Length = 578

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 258/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV--ISPDEIIEKLQIVLPNLDSEMIRRKLS-S 171
           +R  I DRNG +LA   PT SLY  P  +  +   E +E+L  ++  +  E I  +L+ +
Sbjct: 74  NRGTITDRNGAVLALSAPTDSLYAIPSAMEKMPSQEQLEQLSEII-EVPVETIADRLART 132

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            + F +L+R++S +   ++ +  + G+ F+ E  R YP  +  SHV+G+ +ID +G  G+
Sbjct: 133 NSDFVFLKRQMSAETAAKVRALKIEGLAFQTEPKRQYPMGNLFSHVIGFTNIDGKGQEGL 192

Query: 232 E-----KFLDMQGLTRVFTTNKGE--------KNLQPIR-----LALDLRIQNIVHQELV 273
           E           G   V   NKG         +N   +      L+LD RIQ++ H +L 
Sbjct: 193 ELSREDDLRGQDGARVVLRDNKGNYVDQLDSPRNRDAVDGRNMVLSLDQRIQSLAHDKLA 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +    + A++   V+L+  TGE++++V++PD+DP++    +     NR    + E GS  
Sbjct: 253 QAIDYHQAKAGTAVVLDAQTGEILALVNLPDFDPNQPGGTEIALRRNRAVTDMIEPGSAM 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K F IA  +DSG      +F+T N   +G   + D H     LT+  I + SSN+G +++
Sbjct: 313 KPFPIAKALDSGKVNENMVFNT-NTYNIGPATVRDTH-NYPSLTLRGIMQKSSNVGVSKL 370

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKR---IHSLTISFGHGLSTTPL 450
           +     +   +F   +G   ++ +  P  ++P     W+    I   T+SFG+GL  + L
Sbjct: 371 SAMFKPEEMHDFYKSVGFGRRMHSGFPG-ESPGLVRDWRNWRPIEQATMSFGYGLQMSLL 429

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGR 508
           Q A +     ++G+L+P +F+   R+ +      V+K  T + +R ++   VT  GG+G 
Sbjct: 430 QLAHSYTIFTSDGKLLPVSFL---RQSTAPQGEQVIKPETARAIRRMMVS-VTEPGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           +  VPGF VG KTGTA+K++  RY+D  +  +F+   P   P+ IV   +D P    +N 
Sbjct: 486 QGAVPGFNVGAKTGTARKLVGGRYADNKHMATFIGFAPAEHPRVIVAVNIDEPT---QNG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P+  +I+  S ++LGV P 
Sbjct: 543 YYGGLVAGPVFKDIMAGSLNILGVTPT 569


>gi|91776627|ref|YP_546383.1| peptidoglycan synthetase FtsI [Methylobacillus flagellatus KT]
 gi|91710614|gb|ABE50542.1| peptidoglycan synthetase FtsI [Methylobacillus flagellatus KT]
          Length = 583

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 150/498 (30%), Positives = 250/498 (50%), Gaps = 29/498 (5%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL-SSETK 174
           R  I DR GE LA   P  S++  P  V    E + +L  +L  L  E I+ K  +++ +
Sbjct: 71  RGKITDRYGEPLAISTPVESIWASPPDVKMTPEQLSRLAGIL-KLKPEAIQSKFDNTQRE 129

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-- 232
           F +L+R+L P+   +++  G+PGV  + E  R+YPAA   +H+VG+  ID+ G  G E  
Sbjct: 130 FVYLKRRLPPEVAAQVMRIGIPGVFMQREYRRYYPAAEVTAHIVGFTGIDDNGQEGFELH 189

Query: 233 --KFLDMQ-GLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKK 278
             ++L  + G  RV    +G   ++L+ ++         L++D +IQ + ++EL     +
Sbjct: 190 FQQWLSGKPGSRRVIKDRQGRIVEDLEAVKVPQDGRDLTLSIDRKIQYLAYRELAAAVTE 249

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGEV++MV++P Y+P+           NR     FE GS  K FT 
Sbjct: 250 HKAKAGSAVVLDAKTGEVLAMVNVPSYNPNNPVNLAGGRSRNRAIVDTFEPGSTLKPFTA 309

Query: 339 AMGIDSGLFTVKDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  +DSG +    L DT   + ++G+  I D H Q  +LT+ ++ + SSNIG+A++A ++
Sbjct: 310 AAALDSGQYKPNTLIDTSAGVMRIGRATIRDAH-QQGMLTVAQVIQKSSNIGSAKMALSL 368

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVA 455
             Q       ++GL +      P   +    +   W+ I   T+S+GHGLS T LQ A A
Sbjct: 369 EPQYMWSIYSQIGLGAPTRIGFPGEASGKLRNYKTWRPIEQATMSYGHGLSLTLLQLARA 428

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPG 514
                N+G L+P + +   + +   V   V    T + +R ++   +  GG+  RA V G
Sbjct: 429 YTVFTNDGALLPVSLL---KLKEPPVGHQVYTPETARHLRDMMETVIQPGGTAPRAQVLG 485

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           + V GKTGTA K     Y      +SF+   P ++P+ I+   +D P      +   G  
Sbjct: 486 YRVAGKTGTAHKPGVGGYQANHYVSSFVGFAPASNPRLIIAVMIDDPSA---GKYYGGTV 542

Query: 575 VAPMVGNIIRRSASMLGV 592
            AP+   ++  +  ML V
Sbjct: 543 AAPVFSQVMSGALRMLAV 560


>gi|300309672|ref|YP_003773764.1| cell division FtsI protein/penicillin-binding protein 2
           [Herbaspirillum seropedicae SmR1]
 gi|300072457|gb|ADJ61856.1| cell division FtsI protein/penicillin-binding protein 2
           [Herbaspirillum seropedicae SmR1]
          Length = 592

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 152/506 (30%), Positives = 253/506 (50%), Gaps = 33/506 (6%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKL 169
           E   +R  I DRNG++LA+ +P  +++  P  V  +P + + +L  +L   D+++ R+KL
Sbjct: 80  ELPATRGKITDRNGQVLASSVPVKAIWAIPEDVQAAPKDKLVQLAKLLEMSDADL-RKKL 138

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            S+  F +L+R++      +I+  G+PG+  R E  RFYP     +HVVG+ +I++ G  
Sbjct: 139 DSDRSFVYLKRQVEQDTADKIVKLGIPGIETRKEYKRFYPEGEVMAHVVGFTNIEDAGQD 198

Query: 230 GIE-----KFLDMQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELV 273
           G+E         + G  RV     G   ++++ IR         L++D +IQ I   +L 
Sbjct: 199 GMELAAQKTLAGVTGSRRVIKDRLGRVVEDIESIREPHDGRDLTLSIDSKIQYIAFTQLK 258

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           E  +K+ A++ G ++++  TGEV+++ ++P Y+P++          NR+    FE GS  
Sbjct: 259 EAVEKFKAKAGGIIVVDAKTGEVLALANLPTYNPNDRSVLTGAQLRNRVVTDTFEPGSTM 318

Query: 334 KVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           K FT+A+ +D+   T   +F T    + +G   I D H     LT+ +I   SSNIG A+
Sbjct: 319 KPFTVALALDTHRVTPSTVFQTAPGKMTIGTATIGDSHAHGP-LTVAQIIEKSSNIGTAK 377

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAP---SYPSQWKRIHSLTISFGHGLSTTP 449
           IA  M  +   E    +G   + +   P   A     Y S W+ I   T+S+GHG+S + 
Sbjct: 378 IALGMPPEEMWEMFTTVGFGQQPKFGFPGAVAGRVRPYKS-WRPIEQATMSYGHGISVSL 436

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGR 508
           +Q A A       G +IP +F   ++     + + V+  +T   MR +L   V  GG+  
Sbjct: 437 IQLAHAYLIFARNGDIIPLSF---TKVTDSPIGQRVISADTALQMRRMLETVVAPGGTAP 493

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           +A VPG+ VGGKTGTA K+   +Y       SF  + P +DP+ I+   +D P+     Q
Sbjct: 494 QAQVPGYRVGGKTGTAYKIEGGKYVRKY-VASFSGIAPMSDPRLIISVMIDEPQ----GQ 548

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
              G    P+  N+   +   L V P
Sbjct: 549 HYGGPVAGPVFANVAANALRALNVPP 574


>gi|289671025|ref|ZP_06492100.1| penicillin-binding protein 3 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 622

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 153/502 (30%), Positives = 251/502 (50%), Gaps = 31/502 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E  + +   LD    +    +  
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQPLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGA +IA 
Sbjct: 304 VATALTAGVVTKDTIIDT-NPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAVKIAA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTA 453
            +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A
Sbjct: 363 KVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + A + 
Sbjct: 423 QAYATLGNGGKLTPPTFVRGQHNETRQVITPEVARQVIDMMETV----VTQGGAKGAAIL 478

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K       G
Sbjct: 479 GYHVAGKTGTARKNGANGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGK---VYYGG 534

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   ++  +  ++ V P
Sbjct: 535 LVSAPVFHRVMEGALRLMDVPP 556


>gi|32345874|gb|AAM97231.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 258/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|37651036|emb|CAD70585.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  I DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  ++++ KL  +
Sbjct: 74  TRGTISDRNGAVLALSAPTKSLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLKNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  S  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|37651034|emb|CAD70584.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 152/507 (29%), Positives = 258/507 (50%), Gaps = 39/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+   P+   ++  S ++LGV P
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSP 568


>gi|32345836|gb|AAM97212.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 153/509 (30%), Positives = 263/509 (51%), Gaps = 41/509 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-R 566
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P      
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTAHGYY 544

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
             + AG+    ++G     S ++LG+ P 
Sbjct: 545 GGVVAGLPFKKIMGG----SLNILGISPT 569


>gi|32345898|gb|AAM97243.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P Y+P+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|31296603|gb|AAP46594.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296607|gb|AAP46596.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345892|gb|AAM97240.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 151/507 (29%), Positives = 259/507 (51%), Gaps = 39/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSM 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+ V P+   ++  S ++LGV P
Sbjct: 542 GYYGGVVVGPVFKQVMGGSLNILGVSP 568


>gi|31296617|gb|AAP46601.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKTSTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|15837394|ref|NP_298082.1| penicillin binding protein 3 [Xylella fastidiosa 9a5c]
 gi|9105688|gb|AAF83602.1|AE003919_13 penicillin binding protein 3 [Xylella fastidiosa 9a5c]
          Length = 613

 Score =  213 bits (543), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 149/503 (29%), Positives = 254/503 (50%), Gaps = 33/503 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SE 172
           SR  I DRNGE LA   P  S++  P +++   + I KL  VL ++  + +R +LS  ++
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMDELRTRLSQKAD 122

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            +F +L+R+++P     +L   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E
Sbjct: 123 KEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLE 182

Query: 233 KFLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENK 276
              D       G  RV    +G         ++ QP   + L +D RIQ + ++EL    
Sbjct: 183 LSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRNAI 242

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
            +  A     V+++V+ GE+++MV++P Y+P+           NR    + E GS  K  
Sbjct: 243 VENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVTGINSSARRNRAVTDLVEPGSTMKPL 302

Query: 337 TIAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
           T+A  + +G+ T   + DT NP  + +G+  I D    N +L +  +   SSNIGAA+I 
Sbjct: 303 TVATALQAGVVTPDTVIDT-NPGYLSLGRFTIRDVPRNNGVLNVAGVITRSSNIGAAKIV 361

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +  +   E +   G  +   +  P   +     P++W      T+S+G+GLS TPLQ 
Sbjct: 362 AKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQI 421

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           A A A L N G+L+PPTF+     E+ +V    + +  +  M ++    VT G  + A +
Sbjct: 422 AQAYATLGNGGKLVPPTFVKGHHAEARQVVDAKVAQQVIGMMETV----VTRGGAKAAAI 477

Query: 513 PGFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
            G+ V GKTGTA+K     Y ++ ++N+ F  + P T P++  +  ++ P+ K       
Sbjct: 478 LGYHVAGKTGTARKTGANGY-ESGHYNALFAGLVPATRPRFATVIVINDPQGKA---YYG 533

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G+  AP+   ++  +  ++ V P
Sbjct: 534 GLVSAPVFHRVMEGALRLMDVPP 556


>gi|94501902|ref|ZP_01308412.1| penicillin-binding protein 2 [Oceanobacter sp. RED65]
 gi|94425955|gb|EAT10953.1| penicillin-binding protein 2 [Oceanobacter sp. RED65]
          Length = 579

 Score =  213 bits (543), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 159/551 (28%), Positives = 273/551 (49%), Gaps = 41/551 (7%)

Query: 76  MTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATD 130
           + + + L+++++LA R++Q        +  E    ++        R  I+DRN E LA  
Sbjct: 20  LVMTLGLLLFVVLAGRLVQLQTFEQDFLQSEGEKRTVRDQLIHAYRGMIVDRNNEPLAVS 79

Query: 131 IPTFSLYVEPHKVISPDEIIE-KLQIVLPNLDSEMIRRK----LSSETKFQWLRRKLSPQ 185
            P  S+++ P + +   + IE  L+ +  +L     + K    L+ + +F +L R+ +P 
Sbjct: 80  TPVKSIWINPKQFLQDSKDIEGDLRQLAFHLSQSFWQLKNRVLLNKQKEFMYLERQQTPL 139

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE----KFLD-MQGL 240
             K I +  LPGVG + E  RFYPA   ASHVVG+ +ID  GI G+E     +L+   G+
Sbjct: 140 LAKAIQALELPGVGVQQEFKRFYPAGEVASHVVGFTNIDESGIEGVELAFNDYLEGTPGV 199

Query: 241 TRVFTTNKGE--KNL---------QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            R+     G   K+L         + + L+LDLR+Q   ++EL  +  ++ A++   +++
Sbjct: 200 GRIVKDRLGRLVKDLGVVEPAQAGKELVLSLDLRLQYQAYRELKASVTQHGAKAGSLIMV 259

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGE++++V+ P ++P+   +   +   NR++  IFE GS  K FT+A  + +G+   
Sbjct: 260 DVKTGEILALVNQPAFNPNNRVELVADSVRNRVATDIFEPGSTVKPFTVAAALSNGIVQT 319

Query: 350 KDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
           + + +T    +++    I D+    R L I  I   SSNIG +++A  MG     +F   
Sbjct: 320 ESIVNTHPGFMRLKGKTIRDHRDYGR-LDITGILTKSSNIGVSKLALEMGGNALWQFYQS 378

Query: 409 LGLLSKLETELPEIQAPSYP---SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
           LGL   +   LP  Q        + W  + + T+SFG+GL+ TPLQ A A   L N G  
Sbjct: 379 LGLGQPVGLGLPGEQGGKISIRGAHWDNLQTATMSFGYGLAVTPLQLAQAYQVLANGGIK 438

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSGRRAFVPGFEVGGKTGT 523
           +P T + +++   E++    +  + V  +     E V G  G+ RRA V G+ V GKTGT
Sbjct: 439 MPLTLVKQNKVRGERIISNKVANDVVAML-----ETVVGPKGTARRARVDGYRVAGKTGT 493

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
             KV  + Y D    + F  + P  +P+   +  +D P  +E      G   AP+   + 
Sbjct: 494 VHKVGAQGYKDESYLSLFAGIAPADNPRIATIIVVDEPAGRE---YYGGEVAAPVFSRVA 550

Query: 584 RRSASMLGVKP 594
           + S  +L + P
Sbjct: 551 QASLRLLNIAP 561


>gi|152996633|ref|YP_001341468.1| peptidoglycan glycosyltransferase [Marinomonas sp. MWYL1]
 gi|150837557|gb|ABR71533.1| Peptidoglycan glycosyltransferase [Marinomonas sp. MWYL1]
          Length = 587

 Score =  213 bits (543), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 153/511 (29%), Positives = 259/511 (50%), Gaps = 39/511 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKV----------ISPDEIIEKLQIVLPNLDSEM 164
           +R  I+DR GE LA   PT+++   P  +          I P++ I++L  V+    + +
Sbjct: 61  TRGMILDRRGEPLAVSTPTWTIIANPRALWKLPRDPSLNIGPEQEIKRLAEVMGVGRAWL 120

Query: 165 IRRKLSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
             R  +++T+ F +LRR++ P +   I++  + GV    E  RFYPA   ASHVVG+ +I
Sbjct: 121 QERFEANKTRSFMYLRRQIPPHEADAIMAANVVGVSKTKEYKRFYPAGEVASHVVGFTNI 180

Query: 224 DNRGITGIE----KFLDMQGLTRVFTTN------------KGEKNLQPIRLALDLRIQNI 267
           D++G  GIE    K L+ Q   R +  +            + E   + I L++DLR+Q +
Sbjct: 181 DDKGQEGIELAYDKALEGQPGRRSYVKDLTGNIIRGIGVEEAEHPGENIELSIDLRLQYL 240

Query: 268 VHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIF 327
            ++EL     ++ A S   VIL+V TGEV++MV+ P Y+P++  K + E   NR    +F
Sbjct: 241 AYRELKAAVTEHRATSASAVILDVKTGEVLAMVNQPSYNPNDRSKLEYEELRNRAVIDLF 300

Query: 328 EMGSIFKVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
           E GS  K FTI+  + SG ++ +   +T    ++ G+  I D      ++   ++   SS
Sbjct: 301 EPGSTMKPFTISAALMSGQYSTESTINTAPGYLRFGRFTIRD-AANYGVIDFEKLLIKSS 359

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA---PSYPSQWKRIHSLTISFGH 443
           N+GA++IA ++         Y LG+ S +    P       PS+P +W      T+S+G+
Sbjct: 360 NVGASKIALSLPQDAVWNIDYELGIGSPVGIGFPGEATGVLPSHP-KWHPSEIATLSYGY 418

Query: 444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT 503
           GLS + LQ A A   L N+G  +P T     ++++    + V+ K+  +++  ++   V 
Sbjct: 419 GLSVSTLQLAQAYMVLANDGYRVPVTMF---KQDAPPAGKQVIPKDVARSVVKMMEAVVQ 475

Query: 504 GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
            GSG+ A +PG+ V GKTGT  KV  K Y        F  V P T+P+  ++  ++ PK 
Sbjct: 476 RGSGKAAQIPGYRVAGKTGTVHKVGSKGYEYDQYIAMFAGVAPATNPRLAMVVMINDPKG 535

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           +E      G   AP+   ++  + + L + P
Sbjct: 536 RE---YYGGEVAAPVFSRVMEGALTTLNIYP 563


>gi|149377268|ref|ZP_01895015.1| penicillin-binding protein 2 [Marinobacter algicola DG893]
 gi|149358456|gb|EDM46931.1| penicillin-binding protein 2 [Marinobacter algicola DG893]
          Length = 579

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 161/549 (29%), Positives = 272/549 (49%), Gaps = 36/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPEPI-----APSMNIDEYGMSRPDIIDRNGEIL 127
           R G  + V L++   LA R++    +  E +       ++ ++     R  + DR+GE L
Sbjct: 22  RYGTVLGVFLLVVGALAWRLVDLHVVDNEFLRKQGDVRTIRVESIDAHRGVVTDRHGESL 81

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQWLRRKLSPQ 185
           A   P  +++  P ++ + +  +  +  +L  L    +R +L   S  +F +LRRKL P+
Sbjct: 82  AVSTPVQTIWANPSEIDADEPRLTNVARLL-GLQEARLRERLRKYSGREFIYLRRKLQPE 140

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE----KFLDMQ-GL 240
             +++L+ G+PGV  R E  R+YPA    +HVVG+ +ID  G  GIE    ++L  + G 
Sbjct: 141 IARQVLAMGIPGVYSRQEYRRYYPAGEVTAHVVGFTNIDESGQEGIELAYNQWLSGESGR 200

Query: 241 TRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV   N+G   K+L  IR         L++DLR+Q + ++EL      ++A     V+L
Sbjct: 201 KRVLKDNRGRVIKDLTLIRDAKPGRNLELSIDLRLQYLAYRELKAVVGAHDARGGTLVML 260

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV++MV+   Y+P++  +   +   N+    +FE GS  K  ++A  ++SG F  
Sbjct: 261 DVDTGEVLAMVNQGSYNPNDRSQLSPDRLRNKAITDLFEPGSTMKPVSMAAALESGKFKA 320

Query: 350 KDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
               DT     + G+  I D H    ++++ ++   SSN+G ++IA  +G    ++   R
Sbjct: 321 SSTIDTAPGYRRFGRFTIRD-HRNYGVISLTDVIAKSSNVGISKIATELGGDTIRDLYAR 379

Query: 409 LGLLSKLETELP--EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
           LGL        P   +     P +W+ +   T+S+G+G+S   LQ A A   L N G   
Sbjct: 380 LGLGQPTGIGFPGEAVGVLPAPPKWRPVEEATLSYGYGMSVNALQLAQAYMVLANGGIRY 439

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF-EVGGKTGTAQ 525
           P + +   + E + V   VL +     +R +LRE V  G+G+RA  PGF   GGKTGT  
Sbjct: 440 PLSLL---KAEEKPVGERVLSEEVSFQIRGMLREVVENGTGKRA-QPGFYSAGGKTGTVH 495

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
            V K  Y D+     F  + P  +P+ + +  +D+P+  E      G   AP+   ++  
Sbjct: 496 LVGKNGYEDSQYKAIFAGMAPIDNPRIVTVVAVDAPQSGE---YYGGEVAAPVFARVMGD 552

Query: 586 SASMLGVKP 594
           +  +L VKP
Sbjct: 553 ALRLLNVKP 561


>gi|219105904|gb|ACL13978.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
          Length = 583

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 154/547 (28%), Positives = 273/547 (49%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     +    G+        I+  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HSYYGGVVAGSPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LGV P 
Sbjct: 564 ILGVSPT 570


>gi|32345900|gb|AAM97244.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 262/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPAPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRNWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K++T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGILLPVSF---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|31296605|gb|AAP46595.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 151/507 (29%), Positives = 259/507 (51%), Gaps = 39/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQPTMSFGYGLQLSM 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+ V P+   ++  S ++LGV P
Sbjct: 542 GYYGGVVVGPVFKQVMGGSLNILGVSP 568


>gi|37651038|emb|CAD70586.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 257/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV-LPNLDSEMIRRKLSSET 173
           +R  + DRNG +LA   PT SL+  P ++       +  Q+  L ++  +++R KL  + 
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLEQLSGLVDVPVDVLRNKLEQKG 133

Query: 174 K-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
           K F W++R+L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G  G+E
Sbjct: 134 KSFIWIKRQLDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLE 193

Query: 233 KFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELVE 274
             L+      +G   V                NK  +N + I L+LD RIQ + ++EL +
Sbjct: 194 LSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNK 253

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  K
Sbjct: 254 AVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAIK 313

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAAQ 392
            F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G ++
Sbjct: 314 PFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTSK 369

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPL 450
           ++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + L
Sbjct: 370 LSARFSSKEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLL 429

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGR 508
           Q A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G 
Sbjct: 430 QLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P+   ++  S ++LGV P 
Sbjct: 543 YYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|21230194|ref|NP_636111.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769816|ref|YP_244578.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993031|ref|YP_001905041.1| Cell division protein FtsI [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21111732|gb|AAM40035.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575148|gb|AAY50558.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167734791|emb|CAP53001.1| Cell division protein FtsI [Xanthomonas campestris pv. campestris]
          Length = 623

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 156/506 (30%), Positives = 253/506 (50%), Gaps = 39/506 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLSSET 173
           SR  I DRNGE LA   P  S++V P +++ +PD I E    +   LD    +    +  
Sbjct: 67  SRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELATALGQPLDELNAKLAQKAGK 126

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 127 EFMYLKRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 186

Query: 234 FLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQEL----V 273
             D       G  +V    +G         +  QP   + L++D RIQ + ++EL    V
Sbjct: 187 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 246

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           ENK    A     V+++V+TGEV++MV++P Y+P+           NR    + E GS  
Sbjct: 247 ENK----AAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTM 302

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
           K  T+A  + +G+ T   + DT NP  + VG+  I D    N +L +  +   SSNIGAA
Sbjct: 303 KPLTVATALTAGVVTKDTIIDT-NPGYMAVGRFTIRDVPRNNGVLNVTGVITRSSNIGAA 361

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTP 449
           +IA  +  Q   + +   G  S  ++  P   +     P +W      T+S+G+GLS TP
Sbjct: 362 KIAAKVPDQTFYQSIRNFGYGSAPQSGFPGESSGMVLQPQKWSGPSKTTMSYGYGLSVTP 421

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
           LQ A A A L N G+L PPTF+     E+ +V    + +  +  M ++    VT G  + 
Sbjct: 422 LQIAQAYATLGNGGKLTPPTFVRGQHNETRQVVTPEVARQVIDMMETV----VTQGGAKG 477

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           A + G+ V GKTGTA+K     Y +  ++N+ F  + P T P++  +  ++ P+ K    
Sbjct: 478 AAILGYHVAGKTGTARKNGAGGY-ERGHYNALFAGLVPATRPRFATVIVINDPQGKV--- 533

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
              G+  AP+   ++  +  ++ V P
Sbjct: 534 YYGGLVSAPVFHRVMEGALRLMDVPP 559


>gi|31296611|gb|AAP46598.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 149/508 (29%), Positives = 261/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F+ E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVEALGLKHFAFQKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|138894649|ref|YP_001125102.1| stage V sporulation protein D [Geobacillus thermodenitrificans
           NG80-2]
 gi|196247741|ref|ZP_03146443.1| stage V sporulation protein D [Geobacillus sp. G11MC16]
 gi|134266162|gb|ABO66357.1| Stage V sporulation protein D [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212525|gb|EDY07282.1| stage V sporulation protein D [Geobacillus sp. G11MC16]
          Length = 644

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 155/517 (29%), Positives = 259/517 (50%), Gaps = 47/517 (9%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R +I+DRNG  LAT++   ++YV P +V +P E  EKL +VL     E I ++++ +T  
Sbjct: 59  RGEILDRNGVPLATNMSAPTVYVIPRQVKNPAEAAEKLSVVL-GASVESIYKQITQKTSI 117

Query: 176 QWLR--RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
             L+  RK+S ++   + +  L G+    +  R+YP  S+ SHV+G+  IDN+G+TG+E 
Sbjct: 118 VRLKEGRKISDEKAASVRALDLDGIYIAEDTKRYYPFGSYLSHVLGFSGIDNQGLTGLEL 177

Query: 234 FLDMQ-----GLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVENK 276
           + D +     G  + ++  KG +      +  P      + L +D RIQ I+ +EL   +
Sbjct: 178 YYDKELSGERGSVQFYSDAKGRRMPGIADDYTPPTDGLDLVLTIDSRIQTIIERELDIAE 237

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIFK 334
            KYN + +  + +N +TGE+++M S P +DP   ++      +NR    +  +E GS FK
Sbjct: 238 AKYNPDGIIAIAMNPNTGEILAMASRPTFDPAN-YRDVPPEIYNRNLPIWSTYEPGSTFK 296

Query: 335 VFTIAMGIDSGLFTV-KDLFDTRNPIKVGKHVIHDY----HPQNRILTIPEIFRYSSNIG 389
           + T+A  ++ G   + KD F      KV    +  +    H +   L   E+ + S N G
Sbjct: 297 IITLAAALEEGKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGEQTFL---EVVQNSCNPG 353

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSL---TISFGHGLS 446
             ++ + +G +   +++ + G   K   +L + +        KR+  +   T +FG G+S
Sbjct: 354 FVELGERLGKETLFKYIKQFGFGEKTGIDL-QGEGTGILFDLKRVGPVELATTAFGQGVS 412

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIR---------SREESEKVSRIVLKKNTVKTMRSL 497
            TP+Q   A +A +N G L  P               R  + K  R V+ + T K +R  
Sbjct: 413 VTPIQQVAAVSAAVNGGVLYTPYIAKEWIDPETGEIVRRNTPKAKRRVISEETSKQVRYA 472

Query: 498 LREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSF 557
           L   V  G+G++A+V G+ VGGKTGTAQK    RY    +  SF+   P  DPQ +V   
Sbjct: 473 LESVVAQGTGKKAYVEGYRVGGKTGTAQKAQGGRYLQNNHIVSFIGFAPADDPQLVVYVA 532

Query: 558 MDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           +D+PK   +     G   AP+VG ++  S  ++ VKP
Sbjct: 533 VDNPKGTVQ---FGGTVAAPIVGKVMEDSLRVMNVKP 566


>gi|53803413|ref|YP_114848.1| penicillin-binding protein 3 [Methylococcus capsulatus str. Bath]
 gi|53757174|gb|AAU91465.1| penicillin-binding protein 3 [Methylococcus capsulatus str. Bath]
          Length = 575

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 142/474 (29%), Positives = 240/474 (50%), Gaps = 29/474 (6%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRR--KLSSET 173
           R  I+DRNG++LAT  P  S++V P +  + +   + L  ++     ++ RR  +  +  
Sbjct: 64  RGRILDRNGDLLATSCPVKSIWVNPKEFEATEAQYQTLAALIGETPEDLKRRLGEAGTNR 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F ++RR++SP+   ++ S GLPGV    E  R+YP     +HV+G+ DID+ G  G+E 
Sbjct: 124 AFVYVRRRVSPELADQVTSLGLPGVYAEEESRRYYPTGEVTAHVLGFTDIDDNGQEGLEL 183

Query: 234 FLD-----MQGLTRVFTTNKGE-----KNLQP------IRLALDLRIQNIVHQELVENKK 277
             D     ++G  R+    K       +N++P      + +++D R+Q + H+EL    +
Sbjct: 184 AFDGHLKGIEGARRIIRDGKRRVIEDVENVRPPVPGKDLSISIDQRLQYLAHRELKRTVQ 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           ++ A++   V+L+  TGEV++MV+ P ++P+           NR    +FE GS  K F 
Sbjct: 244 QHRAKAGALVMLDAKTGEVLAMVNQPAFNPNSRNGTVPGSTRNRAITDLFEPGSTMKPFA 303

Query: 338 IAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           +A  ++ G F    + +T    + VG +V+ D H    +L +  + R SSN+G  ++A A
Sbjct: 304 VACALEMGAFRPNAVINTSPGLMHVGSNVVKDVHNYG-VLDVAGVLRKSSNVGVTKMALA 362

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAV 454
           +      +F   LG    L T  P       P +   +     T+SFG+G+S +PL  A 
Sbjct: 363 LPPDKFWDFYRDLGFGQVLSTGFPGETQGRMPDRKGLRPFAQATLSFGYGVSASPLHLAR 422

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR--RAFV 512
           A  AL ++G +IPP  +++     E V   V+ K T  T+R +L EGV    G   +A +
Sbjct: 423 AYLALASDG-VIPPVSLLKLDRSPEPVR--VMSKKTAMTVRKML-EGVVSADGTAIKASI 478

Query: 513 PGFEVGGKTGTAQK-VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           PGF V GKTGT +K   +  Y  +   + F  + P +DP+ + +  +D P   E
Sbjct: 479 PGFRVAGKTGTVKKNAGRGGYQSSRYISVFAGMAPASDPRLVTVVMIDEPSAGE 532


>gi|209870568|pdb|3EQV|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From
           Neisseria Gonorrhoeae Containing Four Mutations
           Associated With Penicillin Resistance
 gi|209870569|pdb|3EQV|B Chain B, Crystal Structure Of Penicillin-Binding Protein 2 From
           Neisseria Gonorrhoeae Containing Four Mutations
           Associated With Penicillin Resistance
          Length = 542

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 35  TRGTVSDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 93

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 94  GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 153

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  +N + I L+LD RIQ + ++EL 
Sbjct: 154 ELSLEDSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 213

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 214 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 273

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 274 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 329

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  ++ +  P   A    +  +W+ I   T+SFG+GL  + 
Sbjct: 330 KLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSL 389

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K+ T + +R+L+   VT  GG+G
Sbjct: 390 LQLARAYTALTHDGVLLPLSF---EKQAVAPQGKRIFKEXTAREVRNLMVS-VTEPGGTG 445

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 446 TAGAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---H 502

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+        I+  S ++LG+ P 
Sbjct: 503 GYYGGVVAGSPFKKIMGGSLNILGISPT 530


>gi|28199740|ref|NP_780054.1| penicillin-binding protein 3 [Xylella fastidiosa Temecula1]
 gi|182682487|ref|YP_001830647.1| peptidoglycan glycosyltransferase [Xylella fastidiosa M23]
 gi|28057861|gb|AAO29703.1| penicillin-binding protein 3 [Xylella fastidiosa Temecula1]
 gi|182632597|gb|ACB93373.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa M23]
 gi|307578767|gb|ADN62736.1| peptidoglycan glycosyltransferase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 613

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 149/503 (29%), Positives = 254/503 (50%), Gaps = 33/503 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSE 172
           SR  I DRNGE LA   P  S++  P +++   + I KL  VL ++  E +R +L   ++
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMEELRTRLLQKAD 122

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            +F +L+R+++P     +L   +PGV  + E  RFYP +   +HV+G+ +ID+RG  G+E
Sbjct: 123 KEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEGLE 182

Query: 233 KFLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENK 276
              D       G  RV    +G         ++ QP   + L +D RIQ + ++EL    
Sbjct: 183 LSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRNAI 242

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
            +  A     V+++V+ GE+++MV++P Y+P+           NR    + E GS  K  
Sbjct: 243 IENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMKPL 302

Query: 337 TIAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
           T+A  + +G+ T   + DT NP  + +G+  I D    N +L +  +   SSNIGAA+I 
Sbjct: 303 TVATALQAGVVTPDTVIDT-NPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIV 361

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +  +   E +   G  +   +  P   +     P++W      T+S+G+GLS TPLQ 
Sbjct: 362 AKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQI 421

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           A A A L N G+L+PPTF+     E+ +V    + +  +  M ++    VT G  + A +
Sbjct: 422 AQAYATLGNGGKLVPPTFVKGHHAEARQVVDAKVAQQVIGMMETV----VTRGGAKAAAI 477

Query: 513 PGFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
            G+ V GKTGTA+K     Y ++ ++N+ F  + P T P++  +  ++ P+ K       
Sbjct: 478 LGYHVAGKTGTARKTGANGY-ESGHYNALFAGLVPATRPRFATVIVINDPQGKA---YYG 533

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G+  AP+   ++  +  ++ V P
Sbjct: 534 GLVSAPVFHRVMEGALRLMDVPP 556


>gi|32345876|gb|AAM97232.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 257/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A    AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARTYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|114566357|ref|YP_753511.1| peptidoglycan glycosyltransferase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337292|gb|ABI68140.1| Peptidoglycan glycosyltransferase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 705

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 240/480 (50%), Gaps = 41/480 (8%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISP---DEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           I DRNG  LA  +   S+Y  P +V S     EI  KL  VL  +D E + R++S  + F
Sbjct: 62  IYDRNGNELAISVSADSVYAIPAEVCSKGQQKEIAAKLAQVL-EMDEESLLRRISRSSSF 120

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
           +W++R++ P++ K I    LPG+G   E  R+YP  + ASHV+G   +DN G+ G++ + 
Sbjct: 121 EWVKRQIDPEKSKTIRKMDLPGIGLTEESRRYYPKGTLASHVLGIAGVDNNGLEGVDFYY 180

Query: 236 D-MQGLT--RVFTTNKG---------EKNLQPIR-----LALDLRIQNIVHQELVENKKK 278
           D + G T  R+   +            K + P+      L +D  IQ I  +EL +   +
Sbjct: 181 DKLVGGTKGRIIIEHDAVNRPIPEATHKFIPPVDGANLILTIDETIQYITERELDKVFNE 240

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI---FEMGSIFKV 335
             A+S   +I++VSTGE++++ S P +DP++          NR +YGI   +E GS  K+
Sbjct: 241 RKAKSAAAIIMDVSTGEILALASRPTFDPNDF---SAYAVSNRRNYGINDSYEPGSTMKI 297

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIH--DYHPQNRILTIPEIFRYSSNIGAAQI 393
            T AM +  G+   +  F     IKVGK VI   D  P     +  +    S N+   QI
Sbjct: 298 TTAAMALQEGVVNAESRFYCPGYIKVGKEVIGCPDRKPHGS-QSFAQTIEKSCNVAFIQI 356

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQ 451
              +G+Q + ++L   G   K   +LP E +    P +  ++I   T++ G   + TP+Q
Sbjct: 357 GLELGLQNYYKYLKAFGFGQKTGIDLPGEAEGILIPRASAQQIELATMAMGQANAVTPIQ 416

Query: 452 TAVAAAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGVT 503
              A  A+ NEG+L+ P  + +  ++          +V R V+   T + +  +L   V 
Sbjct: 417 LLTAVGAVANEGKLMKPHLLKQVLDDKGNVIKKVEPQVVRQVISPETARELCMMLEGEVV 476

Query: 504 GGSGRRAFVPGFEVGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
            G+GR A++ G++V GKTGTAQKV    RY    +  SF+   P   P+ + +  +D+PK
Sbjct: 477 NGTGRNAYLEGYKVAGKTGTAQKVGPDGRYMSNEHVASFVGFAPANQPRLLGIVVVDAPK 536


>gi|152986933|ref|YP_001350326.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PA7]
 gi|150962091|gb|ABR84116.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PA7]
          Length = 579

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 153/543 (28%), Positives = 274/543 (50%), Gaps = 31/543 (5%)

Query: 76  MTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFS 135
           +  +V  +++ I+ + +I +  +  +  A S+        R  I DRNGE LA   P  +
Sbjct: 22  LLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTT 81

Query: 136 LYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRILSF 193
           L+  P ++++  E   +L   L   D+++   ++  ++E +F +L R L+P+Q + ++S 
Sbjct: 82  LWANPKELMAAKERWPQLAAAL-GQDTKLFADRIEQNAEREFIYLVRGLTPEQGEGVISL 140

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFTTNK 248
            +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D     + G  +V    +
Sbjct: 141 KVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDRR 200

Query: 249 GE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           G         KN +P   + L++DLR+Q + H+EL     +  A++   VI++V TGE++
Sbjct: 201 GRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALVENGAKAGSLVIMDVKTGEIL 260

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +M + P Y+P+     +     NR    +FE GS  K F+++  + SG +   D+ D   
Sbjct: 261 AMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYP 320

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             +++G++ I D    +R L +  I   SSN+G ++IA  +G +     + ++GL     
Sbjct: 321 GTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTG 380

Query: 417 TELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              P  +  + P+  +W +  + T+++G+GLS T +Q A A AAL N+G+ +P + M R 
Sbjct: 381 LGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAALANDGKSVPLS-MTRV 439

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQKVI--KKR 531
               + V   V+      T++ +L++ V    G  RA VPG+   GK+GTA+KV    K 
Sbjct: 440 DRVPDGVQ--VISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKG 497

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG 591
           Y +    + F    P TDP+  ++  +D P    +     G+  AP+   ++  +  ++ 
Sbjct: 498 YRENAYRSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLVSAPVFSKVMAGALRLMN 554

Query: 592 VKP 594
           V P
Sbjct: 555 VPP 557


>gi|240017236|ref|ZP_04723776.1| Pbp2 [Neisseria gonorrhoeae FA6140]
 gi|44911|emb|CAA30356.1| unnamed protein product [Neisseria gonorrhoeae]
 gi|312983304|gb|ADR30448.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|312983306|gb|ADR30449.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 582

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 153/547 (27%), Positives = 273/547 (49%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     +    G+        I+  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGSPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LG+ P 
Sbjct: 564 ILGISPT 570


>gi|312983310|gb|ADR30451.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 582

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 153/547 (27%), Positives = 273/547 (49%), Gaps = 34/547 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDRRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
             RY D  +  +F+   P  +P+ IV   +D P     +    G+        I+  S +
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGSPFKKIMGGSLN 563

Query: 589 MLGVKPV 595
           +LG+ P 
Sbjct: 564 ILGISPT 570


>gi|319649669|ref|ZP_08003825.1| penicillin-binding protein [Bacillus sp. 2_A_57_CT2]
 gi|317398831|gb|EFV79513.1| penicillin-binding protein [Bacillus sp. 2_A_57_CT2]
          Length = 638

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 164/567 (28%), Positives = 283/567 (49%), Gaps = 52/567 (9%)

Query: 71  KNRIGMTIVVCLVIYIILAIRI--IQY--GNIHPEPIAPSMNID-EYGMSRPDIIDRNGE 125
           + R+ + + V ++++ I+ +R+  +Q+  GN+  +      + D  +   R +I+DRNG 
Sbjct: 9   RKRLTVALFVGILVFFIIDLRLGYVQFFLGNLLTDGAKELWSRDIPFEPERGEIVDRNGI 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE----MIRRKLSSETKFQWLRRK 181
            LAT++   ++YV P ++  P +  EKL  VL N+  E    +I ++ SS    +   RK
Sbjct: 69  PLATNVSAPTVYVVPRQIKDPADAAEKLAAVL-NMSKEKAYQLITKRESSVKIPEG--RK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++ K I +  + G+    +  R YP  ++ SHV+G+  IDN+G+ G+E + D +   
Sbjct: 126 ISHEKAKEIRALEIEGIYIGEDSKRHYPFGNYLSHVLGFSGIDNQGLMGLELYYDEELKG 185

Query: 239 --GLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + +   KGE+      + +P      ++L +D +IQ IV +EL   + +YN + +
Sbjct: 186 KKGSVKFYANAKGERMNDMADDYKPPVDGMDLKLTIDSKIQTIVERELDIAQAEYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIFKVFTIAMGI 342
             + +N + GEV++M S PD+DP   F+      +NR    +  +E GS FK+ T+A  +
Sbjct: 246 IAIAMNPNNGEVLAMASRPDFDPAN-FRNVPPEIYNRNLPIWSTYEPGSTFKIITLAAAL 304

Query: 343 DSGLFTV-KDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQ 400
           + G   + KD F     ++VG   +  +        T  E+ + S N G  ++ + +G  
Sbjct: 305 EEGKVDLEKDHFHDPGSVEVGGARLRCWKKGGHGSQTYLEVVQNSCNPGFVELGERLGKD 364

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRI---HSLTISFGHGLSTTPLQTAVAAA 457
              +++   G   K   +L + +         R+      T +FG G+S TP+Q   A +
Sbjct: 365 KLFKYIRDFGFGEKTGIDL-QGEGKGILFNLDRVGPVEQATTAFGQGVSVTPIQQVAAIS 423

Query: 458 ALINEGRLIPPTFMIRS----------REESEKVSRIVLKKNTVKTMRSLLREGVTGGSG 507
           A +N G L  P ++ +            ++S    R V+ K T   +R  L   V  GSG
Sbjct: 424 AAVNGGTLYTP-YIAKELINPATGEILMKKSPDAKRKVISKETSDEIRKALESVVAKGSG 482

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
           ++AFV G+ VGGKTGTAQK    RY +  +  SF+   P  DPQ +V   +D+PK   + 
Sbjct: 483 KKAFVDGYRVGGKTGTAQKAQNGRYLENNHIVSFIGFAPADDPQLVVYVAVDNPKGTIQ- 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+  AP+VG I+  S   +GVKP
Sbjct: 542 --FGGVVAAPIVGEIMGDSLRAMGVKP 566


>gi|169348418|ref|ZP_02866356.1| hypothetical protein CLOSPI_00133 [Clostridium spiroforme DSM 1552]
 gi|169293887|gb|EDS76020.1| hypothetical protein CLOSPI_00133 [Clostridium spiroforme DSM 1552]
          Length = 633

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 164/569 (28%), Positives = 278/569 (48%), Gaps = 43/569 (7%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           KR+ K I     +I + ++V  +I  I  I+II   NI+ +             +R  II
Sbjct: 7   KRKVKWI-----KIVIVLLVVAIITKICYIQIIDRVNIYNKATDLWQRSFPVEANRGVII 61

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR- 179
           D  G++LAT++ T SL V P ++   +    KL  +L ++D  +++ KLS +   Q ++ 
Sbjct: 62  DNQGDVLATNLTTSSLVVVPSQIKDLETTSNKLAEIL-DVDVNVMKEKLSKKVSIQRIQP 120

Query: 180 --RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE----- 232
             R+L  +   +I S  LPGV    +  R+YP  S+    +G+V IDN+G+ G+E     
Sbjct: 121 EGRQLEDEVASKISSLKLPGVYLIKDTKRYYPKGSYLGQTLGFVGIDNQGLLGLELKYDN 180

Query: 233 ----------KFLDMQG--LTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                      F+D +   LT   +      +   ++L +D  IQ+IV +EL      YN
Sbjct: 181 YLSGSNGSIDYFMDAKSNPLTLYPSVYSAPTSGLDLQLTIDGEIQDIVERELNNAYDTYN 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRIS-YGIFEMGSIFKVFTIA 339
            + +  + ++ +TG++++M S PD++P++     K+ + + I  +  +E GS FK+ T +
Sbjct: 241 PDGIWALAMDPNTGKILAMSSKPDFNPNDYKSADKDVYNHNIPIWKTYEPGSTFKIITFS 300

Query: 340 MGIDSGLFTV-KD-LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
             ++  LF + KD  FD    I  G  +       + + T  E+ + SSN G  +I   +
Sbjct: 301 SALNENLFDMDKDTYFDKGYEIVNGSRIKSWKKGGHGLQTFREVLQNSSNPGFVEIGRRL 360

Query: 398 GIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTPLQTAVA 455
           G     E++ + GL  K E +LP E +   +    +  +   T+SFG G+S TP+Q   A
Sbjct: 361 GKDKLYEYVKKFGLTEKTEIDLPGESKGIMFDYDSFNELEQATVSFGQGISVTPIQLVRA 420

Query: 456 AAALINEGRLIPPTF---MIRSR------EESEKVSRIVLKKNTVKTMRSLLREGVTGGS 506
             A +N G+L  P     +I S       E+  ++ R V+ + T K +R  L   VT G 
Sbjct: 421 ICACVNGGKLYQPYIGDKIINSTTKDVIYEKKPELLRRVISEETSKKVRDALETVVTDGG 480

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G+ A++ G+ +GGKTGTAQK +   Y D     SF+ V P  DP+ ++   MD+PK    
Sbjct: 481 GKNAYIDGYRIGGKTGTAQKAVNGSYVDGGYILSFVGVAPINDPKIVLYVAMDNPK---N 537

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
                G  VAP+   ++      +G++ V
Sbjct: 538 CVQYGGTTVAPIARKMLMDILPSMGIEKV 566


>gi|32345888|gb|AAM97238.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 260/507 (51%), Gaps = 39/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAEEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+   P+   ++  S ++LGV P
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSP 568


>gi|270157405|ref|ZP_06186062.1| peptidoglycan synthetase FtsI [Legionella longbeachae D-4968]
 gi|289164201|ref|YP_003454339.1| transpeptidase involved in septal peptidoglycan synthesis
           (penicillin-binding protein 3) [Legionella longbeachae
           NSW150]
 gi|269989430|gb|EEZ95684.1| peptidoglycan synthetase FtsI [Legionella longbeachae D-4968]
 gi|288857374|emb|CBJ11202.1| transpeptidase involved in septal peptidoglycan synthesis
           (penicillin-binding protein 3) [Legionella longbeachae
           NSW150]
          Length = 555

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 156/541 (28%), Positives = 270/541 (49%), Gaps = 38/541 (7%)

Query: 72  NRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI-----APSMNIDEYGMSRPDIIDRNGEI 126
           NR+ +      ++ +IL +R++    +H + +     A S+ + +    R  I+DRNG  
Sbjct: 8   NRLIIVSAFFSLLLVILVLRMVDLTVLHRQFLQGQGNARSLRVVDIPAHRGMIMDRNGTP 67

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL----SSETKFQWLRRKL 182
           LA   P  S++V P +     E    L   L N   + + RK+    + E +F +L+R+L
Sbjct: 68  LAISTPVESVWVNPKEFAPDKEQFMSLAAYL-NFTPQQLSRKIVDAENKELEFVYLQRQL 126

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-KFLD----M 237
            P   K+I +  +PGV F+ E  R+YP +   S +VG+ ++D++G+ GIE  + D    +
Sbjct: 127 PPPLAKQIKALKIPGVNFQKEFKRYYPDSDSISQLVGFTNVDDQGLEGIELAYQDWLKGV 186

Query: 238 QGLTRVFTTNKGE--------KNLQPIR---LALDLRIQNIVHQELVENKKKYNAESVGT 286
            G  RV     G         K  +P R   L++D R+Q + + EL +  +++ A+S   
Sbjct: 187 VGKKRVIKDRLGRIIDELGVIKEPRPGRDMTLSIDRRLQYLAYSELGKTVEEFAAKSGSV 246

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           V+++   GE+++M ++P Y+P+   +  K+ + NR     FE GS+ K F+IA  +++GL
Sbjct: 247 VVVDTENGEILAMANVPSYNPNSRGRYDKDTYRNRAVTDTFEPGSVIKTFSIASALETGL 306

Query: 347 FTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           F    + DT NP  + V  H + D H    +L +  + ++SSN+G  ++  A   +    
Sbjct: 307 FKPSTIIDT-NPSWMVVHGHAVRDIH-NYGVLDVTGVLQHSSNVGVTKMVLASPPEQLIG 364

Query: 405 FLYRLGLLSKLETELP-EIQAPSYPSQWKRIHSL-TISFGHGLSTTPLQTAVAAAALINE 462
            L R G   + E+  P E +     ++      L T+SFG+GLS T LQ A A     N+
Sbjct: 365 LLQRCGFGQRTESTYPGESEGGIVNAKDANPFVLATLSFGYGLSVTALQLAKANMIFANQ 424

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTG 522
           G+LIP T +     +       V+K  T + + +++   +  G+GR A VPG+ V GKTG
Sbjct: 425 GKLIPVTLL---HNDPPTPGVQVIKPETAQQVLNMMEAVMKDGTGRAAKVPGYRVAGKTG 481

Query: 523 TAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNI 582
           TA+   K  Y D     SF+ + P + P+++V+  +  P    R    A    AP+   +
Sbjct: 482 TARVAGKDGYKDKKYTASFVGIAPVSKPKFVVVVIIHEP---SRKGYYAAAVAAPLFTKV 538

Query: 583 I 583
           +
Sbjct: 539 M 539


>gi|253998166|ref|YP_003050229.1| peptidoglycan glycosyltransferase [Methylovorus sp. SIP3-4]
 gi|253984845|gb|ACT49702.1| Peptidoglycan glycosyltransferase [Methylovorus sp. SIP3-4]
          Length = 576

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 149/502 (29%), Positives = 249/502 (49%), Gaps = 44/502 (8%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I DR GE LA   P  S++  P  V +  + I K+  +L    +E+ ++  ++  +F ++
Sbjct: 68  ITDRFGEPLAISTPVESIWASPPDVQATPQQISKMATLLKMKPAELNKKLANNPREFVYI 127

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-KFLDM 237
           +R++ P+  K+++  G+PGV  + E  R+YPA    +H+VG+  ID  G  G E ++ D 
Sbjct: 128 KRRIPPELAKQVMQIGVPGVFMQREYRRYYPAGEVMAHLVGFTGIDENGQEGFELRYQDW 187

Query: 238 ----QGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKKYNAE 282
                G  RV    +G   ++L+ ++         L++D +IQ + ++EL    +++ A+
Sbjct: 188 LSGKSGSRRVIKDRQGHIVEDLEAVKVPQDGHDLVLSIDRKIQYLAYRELAHAVEQFKAK 247

Query: 283 SVGTVILNVSTGEVISMVSIPDYDPHEA--FKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           +   ++L+  TGEV++M ++P Y+P+      G+     NR     FE GS  K FT A 
Sbjct: 248 AGAAIVLDARTGEVLAMANLPTYNPNNPVNMAGRSR---NRAIVDTFEPGSTLKPFTAAA 304

Query: 341 GIDSGLFTVKDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM-- 397
            ++SG FT      T   I ++G   IHD HPQ  +LT+ ++ + SSN+G+A++A  +  
Sbjct: 305 ALESGHFTPDTHIQTAPGILRIGPATIHDAHPQG-MLTVAQVIQKSSNVGSAKMALTLEP 363

Query: 398 ----GIQGHKEF--LYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQ 451
               GI  H  F     +G   +    L   +       W+ I   T+SFGHG+S T LQ
Sbjct: 364 QYLWGIYNHMGFGSPTHIGFPGEASGRLRNYK------NWRPIEQATMSFGHGISLTLLQ 417

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRA 510
            A A     N+G L P + +   + +   V + V    T   +R +L   V  GG+  RA
Sbjct: 418 LARAYTVFANDGELKPVSLL---KLKEAPVGQQVFSAKTALAVRDMLELVVQPGGTAPRA 474

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            + G+ V GKTGTA K+    Y      +SF+ + P ++P+ I+   +D P      Q  
Sbjct: 475 QIAGYRVAGKTGTAHKLGPGGYLADKYVSSFVGLAPASNPRLIIAVMVDEP---SSGQYY 531

Query: 571 AGINVAPMVGNIIRRSASMLGV 592
            G   AP+   I+  +  ML V
Sbjct: 532 GGTVAAPVFSAIMAGALRMLAV 553


>gi|193222411|emb|CAL62931.2| Peptidoglycan glycosyltransferase [Herminiimonas arsenicoxydans]
          Length = 589

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 146/476 (30%), Positives = 244/476 (51%), Gaps = 31/476 (6%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKL 169
           E   +R  I DRNG++LA+ IP  +++  P  V+ +P E ++ L  +L ++    +RRKL
Sbjct: 76  ELPATRGKITDRNGQVLASSIPVRAVWAIPDDVLEAPKEKLQALAKLL-DMSERDLRRKL 134

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            S+  F +L+R++      +IL  G+ G+  R E  R+YP     +H+VG+ +++++G  
Sbjct: 135 DSDRGFVYLKRQVELDTVDKILKLGIAGIDTRKEYKRYYPEGEVMAHIVGFTNVEDKGQE 194

Query: 230 GIE-----KFLDMQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELV 273
           G+E       + + G  RV     G   ++++ +R         L++D +IQ I    L 
Sbjct: 195 GMELAFQKTLVGVTGNRRVIKDRLGRIVEDIESVREPHDGKDLTLSIDSKIQYIAFSALK 254

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           E  + + A++ G V+L+  TGEV+++ ++P Y+P+           NR+    FE GS  
Sbjct: 255 EAVELHKAKAGGIVVLDAKTGEVLALANLPTYNPNNRSVLTGAQLRNRVLTDTFEPGSTL 314

Query: 334 KVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           K FTIA+ +++   T   +  T    + +GK  I D H    +L++ ++   SSN+G A+
Sbjct: 315 KPFTIALALENKHITPNTMIQTAPGKLTIGKATIGDAHAGG-LLSVSQVIEKSSNVGTAK 373

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAP---SYPSQWKRIHSLTISFGHGLSTTP 449
           IA  M  Q   +    +G   + +   P   A     Y S W+ I   T+S+GHG+ST+ 
Sbjct: 374 IALEMEPQEMWDMFTSVGFGQQPKVGFPGAVAGRVRPYKS-WRPIEQATMSYGHGISTSL 432

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSG 507
           LQ A A      +G +IP TF    R   + +S+ V+ +   +  R +L E   G  G+ 
Sbjct: 433 LQIAHAYMIFARDGEMIPLTF---QRSSDQPISQRVISEKNARLTRGML-EMAAGPTGTA 488

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
            RA VPG+ V GKTGTA K+ K +Y       SF+   P +DP+ IV   +D P +
Sbjct: 489 PRAQVPGYRVAGKTGTAYKLEKGQYVRKY-VASFVGFAPVSDPRIIVAVMIDEPAV 543


>gi|31296629|gb|AAP46607.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 151/507 (29%), Positives = 254/507 (50%), Gaps = 37/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAEKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGR 508
           LQ A A   L ++G L+P +F    ++      + V+K +T K +R L+      GG+G 
Sbjct: 429 LQLARAYTVLTHDGELLPVSF---EKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGT 485

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
              V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N 
Sbjct: 486 AGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NG 542

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+   P    I+  S ++LGV P 
Sbjct: 543 YYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|71898208|ref|ZP_00680382.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
 gi|71731947|gb|EAO34004.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
          Length = 613

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 148/503 (29%), Positives = 254/503 (50%), Gaps = 33/503 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSE 172
           SR  I DRNGE LA   P  S++  P +++   + I KL  VL ++  + +R +L   ++
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMDELRTRLLQKAD 122

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            +F +L+R+++P     +L   +PGV  + E  RFYP +   +HV+G+ +ID+RG  G+E
Sbjct: 123 KEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEGLE 182

Query: 233 KFLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENK 276
              D       G  RV    +G         ++ QP   + L +D RIQ + ++EL    
Sbjct: 183 LSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRNAI 242

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
            +  A     V+++V+ GE+++MV++P Y+P+           NR    + E GS  K  
Sbjct: 243 VENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMKPL 302

Query: 337 TIAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
           T+A  + +G+ T   + DT NP  + +G+  I D    N +L +  +   SSNIGAA+I 
Sbjct: 303 TVATALQAGVVTPDTVIDT-NPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIV 361

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +  +   E +   G  +   +  P   +     P++W      T+S+G+GLS TPLQ 
Sbjct: 362 AKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQI 421

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           A A A L N G+L+PPTF+     E+ +V    + +  +  M ++    VT G  + A +
Sbjct: 422 AQAYATLGNGGKLVPPTFVKGHHAEARQVVDAKVAQQVIGMMETV----VTRGGAKAAAI 477

Query: 513 PGFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
            G+ V GKTGTA+K     Y ++ ++N+ F  + P T P++  +  ++ P+ K       
Sbjct: 478 LGYHVAGKTGTARKTGANGY-ESGHYNALFAGLVPATRPRFATVIVINDPQGKA---YYG 533

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G+  AP+   ++  +  ++ V P
Sbjct: 534 GLVSAPVFHRVMEGALRLMDVPP 556


>gi|313200236|ref|YP_004038894.1| peptidoglycan glycosyltransferase [Methylovorus sp. MP688]
 gi|312439552|gb|ADQ83658.1| Peptidoglycan glycosyltransferase [Methylovorus sp. MP688]
          Length = 572

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 149/502 (29%), Positives = 249/502 (49%), Gaps = 44/502 (8%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I DR GE LA   P  S++  P  V +  + I K+  +L    +E+ ++  ++  +F ++
Sbjct: 64  ITDRFGEPLAISTPVESIWASPPDVQATPQQISKMATLLKMKPAELNKKLANNPREFVYI 123

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE-KFLDM 237
           +R++ P+  K+++  G+PGV  + E  R+YPA    +H+VG+  ID  G  G E ++ D 
Sbjct: 124 KRRIPPELAKQVMQIGVPGVFMQREYRRYYPAGEVMAHLVGFTGIDENGQEGFELRYQDW 183

Query: 238 ----QGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKKYNAE 282
                G  RV    +G   ++L+ ++         L++D +IQ + ++EL    +++ A+
Sbjct: 184 LSGKSGSRRVIKDRQGHIVEDLEAVKVPQDGHDLVLSIDRKIQYLAYRELAHAVEQFKAK 243

Query: 283 SVGTVILNVSTGEVISMVSIPDYDPHEA--FKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           +   ++L+  TGEV++M ++P Y+P+      G+     NR     FE GS  K FT A 
Sbjct: 244 AGAAIVLDARTGEVLAMANLPTYNPNNPVNMAGRSR---NRAIVDTFEPGSTLKPFTAAA 300

Query: 341 GIDSGLFTVKDLFDTRNPI-KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM-- 397
            ++SG FT      T   I ++G   IHD HPQ  +LT+ ++ + SSN+G+A++A  +  
Sbjct: 301 ALESGHFTPDTHIQTAPGILRIGPATIHDAHPQG-MLTVAQVIQKSSNVGSAKMALTLEP 359

Query: 398 ----GIQGHKEF--LYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQ 451
               GI  H  F     +G   +    L   +       W+ I   T+SFGHG+S T LQ
Sbjct: 360 QYLWGIYNHMGFGSPTHIGFPGEASGRLRNYK------NWRPIEQATMSFGHGISLTLLQ 413

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRA 510
            A A     N+G L P + +   + +   V + V    T   +R +L   V  GG+  RA
Sbjct: 414 LARAYTVFANDGELKPVSLL---KLKEAPVGQQVFSAKTALAVRDMLELVVQPGGTAPRA 470

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            + G+ V GKTGTA K+    Y      +SF+ + P ++P+ I+   +D P      Q  
Sbjct: 471 QIAGYRVAGKTGTAHKLGPGGYLADKYVSSFVGLAPASNPRLIIAVMVDEP---SSGQYY 527

Query: 571 AGINVAPMVGNIIRRSASMLGV 592
            G   AP+   I+  +  ML V
Sbjct: 528 GGTVAAPVFSAIMAGALRMLAV 549


>gi|32345886|gb|AAM97237.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  211 bits (537), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 260/507 (51%), Gaps = 39/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+   P+   ++  S ++LGV P
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSP 568


>gi|44915|emb|CAA30358.1| unnamed protein product [Neisseria gonorrhoeae]
          Length = 582

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 154/548 (28%), Positives = 275/548 (50%), Gaps = 36/548 (6%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           + M ++   +I   L ++ + Y  +  +     +       +R  + DRNG +LA   PT
Sbjct: 33  MAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPT 92

Query: 134 FSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
            SL+  P   K +     +E+L  ++ ++  +++R KL  + K F W++R+L P+  + +
Sbjct: 93  ESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEV 151

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL--------------- 235
            + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L               
Sbjct: 152 KALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLR 211

Query: 236 DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           D QG +     +  NK  +N + I L+LD RIQ + ++EL +  + + A++   V+L+  
Sbjct: 212 DRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDAR 271

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  +D+G   + + 
Sbjct: 272 TGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNER 331

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
            +T+ P K+G   + D       L +  I + SSN+G ++++   G +   +F + LG+ 
Sbjct: 332 LNTQ-PYKIGPSPVRDDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG 390

Query: 413 SKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
            ++ +  P   A    +  +W+ I   T+SFG+GL  + LQ A A  AL ++G L+P +F
Sbjct: 391 VRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSF 450

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRRAFVPGFEVGGKTGTAQKVI 528
               ++      + + K++T + +R+L+   VT  GG+G    V GF+VG KTGTA+K++
Sbjct: 451 ---EKQAVAPQGKRIFKESTAREVRNLMVS-VTEPGGTGTAGAVDGFDVGAKTGTARKLV 506

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE-RNQLTAGINVAPMVGNIIRRSA 587
             RY D  +  +F+   P  +P+ IV   +D P        + AG+    ++G     S 
Sbjct: 507 NGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGLPFKKIMGG----SL 562

Query: 588 SMLGVKPV 595
           ++LG+ P 
Sbjct: 563 NILGISPT 570


>gi|218893509|ref|YP_002442378.1| penicillin-binding protein 3 [Pseudomonas aeruginosa LESB58]
 gi|218773737|emb|CAW29551.1| penicillin-binding protein 3 [Pseudomonas aeruginosa LESB58]
          Length = 579

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 152/543 (27%), Positives = 274/543 (50%), Gaps = 31/543 (5%)

Query: 76  MTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFS 135
           +  +V  +++ I+ + +I +  +  +  A S+        R  I DRNGE LA   P  +
Sbjct: 22  LLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTT 81

Query: 136 LYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRILSF 193
           L+  P ++++  E   +L   L   D+++   ++  ++E +F +L R L+P+Q + +++ 
Sbjct: 82  LWANPKELMTAKERWPQLAAAL-GQDTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIAL 140

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFTTNK 248
            +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D     + G  +V    +
Sbjct: 141 KVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDRR 200

Query: 249 GE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           G         KN +P   + L++DLR+Q + H+EL     +  A++   VI++V TGE++
Sbjct: 201 GRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEIL 260

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +M + P Y+P+     +     NR    +FE GS  K F+++  + SG +   D+ D   
Sbjct: 261 AMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYP 320

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             +++G++ I D    +R L +  I   SSN+G ++IA  +G +     + ++GL     
Sbjct: 321 GTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTG 380

Query: 417 TELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              P  +  + P+  +W +  + T+++G+GLS T +Q A A AAL N+G+ +P + M R 
Sbjct: 381 LGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAALANDGKSVPLS-MTRV 439

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQKVI--KKR 531
               + V   V+      T++ +L++ V    G  RA VPG+   GK+GTA+KV    K 
Sbjct: 440 DRVPDGVQ--VISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKG 497

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG 591
           Y +    + F    P TDP+  ++  +D P    +     G+  AP+   ++  +  ++ 
Sbjct: 498 YRENAYCSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLVSAPVFSKVMAGALRLMN 554

Query: 592 VKP 594
           V P
Sbjct: 555 VPP 557


>gi|254238919|ref|ZP_04932242.1| penicillin-binding protein 3 [Pseudomonas aeruginosa C3719]
 gi|126170850|gb|EAZ56361.1| penicillin-binding protein 3 [Pseudomonas aeruginosa C3719]
          Length = 579

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 152/543 (27%), Positives = 274/543 (50%), Gaps = 31/543 (5%)

Query: 76  MTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFS 135
           +  +V  +++ I+ + +I +  +  +  A S+        R  I DRNGE LA   P  +
Sbjct: 22  LLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTT 81

Query: 136 LYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRILSF 193
           L+  P ++++  E   +L   L   D+++   ++  ++E +F +L R L+P+Q + +++ 
Sbjct: 82  LWANPKELMTAKERWPQLAAAL-GQDTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIAL 140

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFTTNK 248
            +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D     + G  +V    +
Sbjct: 141 KVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDRR 200

Query: 249 GE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           G         KN +P   + L++DLR+Q + H+EL     +  A++   VI++V TGE++
Sbjct: 201 GRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEIL 260

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +M + P Y+P+     +     NR    +FE GS  K F+++  + SG +   D+ D   
Sbjct: 261 AMTNQPAYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYP 320

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             +++G++ I D    +R L +  I   SSN+G ++IA  +G +     + ++GL     
Sbjct: 321 GTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTG 380

Query: 417 TELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              P  +  + P+  +W +  + T+++G+GLS T +Q A A AAL N+G+ +P + M R 
Sbjct: 381 LGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAALANDGKSVPLS-MTRV 439

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQKVI--KKR 531
               + V   V+      T++ +L++ V    G  RA VPG+   GK+GTA+KV    K 
Sbjct: 440 DRVPDGVQ--VISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKG 497

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG 591
           Y +    + F    P TDP+  ++  +D P    +     G+  AP+   ++  +  ++ 
Sbjct: 498 YRENAYCSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLVSAPVFSKVMAGALRLMN 554

Query: 592 VKP 594
           V P
Sbjct: 555 VPP 557


>gi|71275127|ref|ZP_00651414.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Dixon]
 gi|71900700|ref|ZP_00682823.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
 gi|170731116|ref|YP_001776549.1| peptidoglycan glycosyltransferase [Xylella fastidiosa M12]
 gi|71163936|gb|EAO13651.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Dixon]
 gi|71729521|gb|EAO31629.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
 gi|167965909|gb|ACA12919.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa M12]
          Length = 613

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 148/503 (29%), Positives = 254/503 (50%), Gaps = 33/503 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSE 172
           SR  I DRNGE LA   P  S++  P +++   + I KL  VL ++  + +R +L   ++
Sbjct: 64  SRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMDELRTRLLQKAD 122

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            +F +L+R+++P     +L   +PGV  + E  RFYP +   +HV+G+ +ID+RG  G+E
Sbjct: 123 KEFMYLKRRINPDVAHYVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEGLE 182

Query: 233 KFLD-----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENK 276
              D       G  RV    +G         ++ QP   + L +D RIQ + ++EL    
Sbjct: 183 LSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRNAI 242

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
            +  A     V+++V+ GE+++MV++P Y+P+           NR    + E GS  K  
Sbjct: 243 VENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMKPL 302

Query: 337 TIAMGIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
           T+A  + +G+ T   + DT NP  + +G+  I D    N +L +  +   SSNIGAA+I 
Sbjct: 303 TVATALQAGVVTPDTVIDT-NPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIV 361

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +  +   E +   G  +   +  P   +     P++W      T+S+G+GLS TPLQ 
Sbjct: 362 AKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQI 421

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           A A A L N G+L+PPTF+     E+ +V    + +  +  M ++    VT G  + A +
Sbjct: 422 AQAYATLGNGGKLVPPTFVKGHHAEARQVVDAKVAQQVIGMMETV----VTRGGAKAAAI 477

Query: 513 PGFEVGGKTGTAQKVIKKRYSDTLNFNS-FLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
            G+ V GKTGTA+K     Y ++ ++N+ F  + P T P++  +  ++ P+ K       
Sbjct: 478 LGYHVAGKTGTARKTGANGY-ESGHYNALFAGLVPATRPRFATVIVINDPQGKA---YYG 533

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G+  AP+   ++  +  ++ V P
Sbjct: 534 GLVSAPVFHRVMEGALRLMDVPP 556


>gi|89099602|ref|ZP_01172477.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Bacillus sp. NRRL B-14911]
 gi|89085755|gb|EAR64881.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Bacillus sp. NRRL B-14911]
          Length = 627

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 157/522 (30%), Positives = 261/522 (50%), Gaps = 57/522 (10%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE----MIRRKLSS 171
           R +I+DRNG  LAT++   ++YV P +V  PDE  EKL  +L N+  E    +I ++ SS
Sbjct: 48  RGEIVDRNGVALATNVSAPTVYVVPRQVKDPDETAEKLAAIL-NMSEEKALQLITKQASS 106

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
               +   RK+S ++   I + G+ GV    +  R YP  ++ SHV+G+  IDN+G+ G+
Sbjct: 107 VKIPEG--RKISHEKATEIRAEGMAGVYIAEDSKRHYPFGNYLSHVLGFAGIDNQGLMGL 164

Query: 232 EKFLDM-----QGLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVE 274
           E + D      +G  + +   KG++      + +P      ++L +D ++Q IV +EL  
Sbjct: 165 ELYYDKDLKGEKGSVKFYANAKGQRMNDMADDYKPPVDGMDLKLTIDSKVQTIVERELDI 224

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSI 332
            +  YN + +  + +N +TGE+++M S PD+DP   F+      +NR    +  +E GS 
Sbjct: 225 AEAAYNPDGIIAIAMNPNTGEILAMSSRPDFDPAN-FRNVAPDIYNRNLPVWSSYEPGST 283

Query: 333 FKVFTIAMGIDSGLFTV-KDLFDTRNPIKVGKHVIHDY----HPQNRILTIPEIFRYSSN 387
           FK+ T+A  ++ G   + +D F      +VG   +  +    H     L   E+ + S N
Sbjct: 284 FKIITLAAALEEGKVDLAEDHFHDPGYTEVGGAKLRCWKRGGHGSQSFL---EVVQNSCN 340

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP-----SQWKRIHSLTISFG 442
            G  ++ + +G +   +++   G  +K   +L   Q  S            +   T +FG
Sbjct: 341 PGFVELGERLGKETLFKYIKDFGFGAKTGIDL---QGESKGILFDLENVGPVELATTAFG 397

Query: 443 HGLSTTPLQTAVAAAALINEGRLIPPTFMIRS----------REESEKVSRIVLKKNTVK 492
            G+S TP+Q   A +A +N G L  P F+ +             ++ +  R V+ + T K
Sbjct: 398 QGVSVTPIQQVAAISAAVNGGTLYTP-FIAKELIDPASGEIVMRKTPEAKRKVISEETSK 456

Query: 493 TMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQY 552
            +R  L   V  GSG++AFV G+ VGGKTGTAQK    RY +  +  SF+   P  DP+ 
Sbjct: 457 EIRLALESVVAQGSGKKAFVDGYRVGGKTGTAQKAENGRYLENNHIVSFIGFAPADDPEL 516

Query: 553 IVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           +V   +D+PK         G+  AP+VGNI+  S   +GV+P
Sbjct: 517 VVYVAVDNPK---GTIQFGGVVAAPIVGNIMGDSLRAMGVEP 555


>gi|226943447|ref|YP_002798520.1| Penicilin-binding Protein 3 [Azotobacter vinelandii DJ]
 gi|226718374|gb|ACO77545.1| Penicilin-binding Protein 3 [Azotobacter vinelandii DJ]
          Length = 579

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 153/544 (28%), Positives = 264/544 (48%), Gaps = 32/544 (5%)

Query: 76  MTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFS 135
           + ++V  + + I+ + I  +  +  +  A SM        R  I DRNGE LA   P  +
Sbjct: 20  LALMVATIAWRIVDLHIFDHDFLKGQGDARSMRHIPIPAHRGLITDRNGEPLAVSTPVTT 79

Query: 136 LYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQWLRRKLSPQQQKRILSF 193
           L+  P ++    +    L   L   D + +  +L   +  +F +L R L+P+Q + +L  
Sbjct: 80  LWANPKELAGARDQWATLAKAL-GQDEKALTERLEQLAGREFAYLVRGLTPEQGQAVLDL 138

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFTTNK 248
            +PGV    E  RFYPA    +HV+G+ DID+ G  G+E   D     + G  +V    +
Sbjct: 139 KIPGVYALEEFRRFYPAGEVTAHVLGFTDIDDHGREGMELAFDEWLAGVPGKRQVLKDRR 198

Query: 249 GE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           G            K  + + L++DLR+Q + H+EL     +  A++   V+++V TGEV+
Sbjct: 199 GRLIRDVQVVQNAKAGKTLALSIDLRLQYLAHRELRNAITEVGAKAGTLVMIDVKTGEVL 258

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +MV+ P Y+P+           NR    +FE GS  K  +++  +++G +   D  +   
Sbjct: 259 AMVNQPTYNPNNKRNLNPAAMRNRALVDVFEPGSTMKPLSMSAALETGRWKPSDRVEVAP 318

Query: 357 NPIKVGKHVIHDY-HPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
             +++G++ I D  H +  +L +  I   SSN+G +++A  +G       + R+G     
Sbjct: 319 GRLQIGRYTIRDVSHAEGGVLDLTGILIKSSNVGMSKVAFDIGGASIHSLMQRVGFGQDT 378

Query: 416 ETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
               P  Q  + PS  +W++  + T+S+G+GLS T +Q A A A L N+GR +P   +  
Sbjct: 379 GLSFPGEQVGNLPSHREWRKAETATLSYGYGLSVTAVQLAHAYATLANDGRSLP---LAL 435

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQK--VIKK 530
           +R+E       V+  N  KTM+ +L++ V    G  RA VPG+ V GK+GTA+K  V  K
Sbjct: 436 ARQEQAPEGVQVISPNVAKTMQGMLQQVVEAPGGVFRAKVPGYHVAGKSGTARKASVGAK 495

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASML 590
            Y +    + F    PT+ P+  +   +D P          G+  AP+ G ++  +  ++
Sbjct: 496 GYKEKSYRSLFAGFAPTSAPRIAMAVVIDEP---SNGAYFGGLVSAPVFGRVMAGALRLM 552

Query: 591 GVKP 594
            V P
Sbjct: 553 NVAP 556


>gi|56476233|ref|YP_157822.1| penicillin-binding 3 precursor PBP-3 transmembrane protein
           [Aromatoleum aromaticum EbN1]
 gi|56312276|emb|CAI06921.1| penicillin-binding 3 precursor PBP-3 transmembrane protein
           [Aromatoleum aromaticum EbN1]
          Length = 584

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 144/505 (28%), Positives = 250/505 (49%), Gaps = 30/505 (5%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKL 169
           E   +R  +IDR+G++LA   P  S++  P    +SP +  +  +++  ++D   +  +L
Sbjct: 66  EVPATRGRVIDRHGDVLAISTPVRSIWAIPSDARLSPADARKLAELLETSVDE--LNGRL 123

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
           ++   F +L+R+L P+  + + +  LPG+  + E  R+YP     +HV+G+  +D++G  
Sbjct: 124 ATSHDFVYLKRQLPPELAQEVAALKLPGIHQQQEYRRYYPGGEVMAHVLGFTGVDDKGQE 183

Query: 230 GIEKFLD-----MQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELV 273
           G+E   D       G  RV    +G+  ++++ IR         LA+D +IQ + H  L 
Sbjct: 184 GVELAFDKLLTGTPGARRVIRDRRGQVVEDVEAIRPPHDGQDLVLAMDAKIQYLAHSALN 243

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+V TGEV+++V+ P Y+P+           NR+    +E GS  
Sbjct: 244 QAMQTHKAKAGAAVVLDVRTGEVLALVNAPTYNPNNRTNLSGAQLRNRVFTDTYEPGSTM 303

Query: 334 KVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           K F + + +D G      + DT    + +G+  I D H ++  LT+ E+ + SSN+G  +
Sbjct: 304 KPFIVGLALDRGKVEPTTVIDTTPGRVSIGRSTISDSH-RHGPLTVAEVIQKSSNVGTVK 362

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYPSQ-WKRIHSLTISFGHGLSTTPL 450
           +A  +  +        LG  + L+   P E      P + WK I   T+SFGHG+S + +
Sbjct: 363 MAMNLAPEEMWRMFNELGFGAPLDLGFPGEASGRLRPVKTWKPIEQATMSFGHGISVSLI 422

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRR 509
           Q A A  A   +G L+P    +   +      + V   +T + MR +L      GG+  R
Sbjct: 423 QMAHAYLAFARDGELLP--LSLTRVDTPLAAGKRVYSVDTAREMRYMLELAAGPGGTAPR 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA K+   RY++    +SF+   P +DP+ IV   +D P      Q 
Sbjct: 481 AQIRGYRVAGKTGTAHKLEGGRYANKY-VSSFVGFAPASDPRIIVAVMIDEPSA---GQY 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+   I   +  +LGV P
Sbjct: 537 FGGTVAAPIFAQITEGALRVLGVAP 561


>gi|32345890|gb|AAM97239.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 260/507 (51%), Gaps = 39/507 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G+   P+   ++  S ++LGV P
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSP 568


>gi|311693449|gb|ADP96322.1| penicillin-binding protein 3 [marine bacterium HP15]
          Length = 582

 Score =  210 bits (535), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 154/499 (30%), Positives = 254/499 (50%), Gaps = 33/499 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQ 176
           + DR  E LA   P  +++  P +    +  +  L  +L +++   +R++L   S  +F 
Sbjct: 76  VTDRYDEPLAVSTPVQTIWANPSEANPSEARLTNLARLL-DINEASLRQRLEEYSGREFI 134

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE---- 232
           +LRRK+ P   +++L   + G+  R E  R+YPA    +HVVG+ DID RG  GIE    
Sbjct: 135 YLRRKVQPDLARKVLELEIDGIYTRQEYRRYYPAGEVTAHVVGFTDIDERGQEGIELAYN 194

Query: 233 KFLDMQ-GLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKKYN 280
           ++L  + G  RV   N+G   K+L  IR         L++DLR+Q + ++EL      +N
Sbjct: 195 QWLSGETGRKRVLKDNRGRVIKDLTLIRDASPGQNLALSIDLRLQYLAYRELKAVVAAHN 254

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A     V+L+V TGEV++MV+   Y+P++  +   E   N+    +FE GS  K  T+A 
Sbjct: 255 ARGGTLVMLDVDTGEVLAMVNQGSYNPNDRSQLAAENLRNKAITDLFEPGSTMKPITMAA 314

Query: 341 GIDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
            ++SG ++V    DT NP   + G+  I D H    ++ + EI   SSN+G ++IA  +G
Sbjct: 315 ALESGSYSVNSTIDT-NPGFRRFGRFTIRD-HRNYGVMDMTEIIVKSSNVGISRIATDLG 372

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAA 456
               ++   RLGL        P       PS  +W+ +   T+S+G+G+S   LQ A A 
Sbjct: 373 GDVIRDLYARLGLGQPTGIGFPGEAVGVLPSPPKWRPVEEATLSYGYGMSVNALQLAQAY 432

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF- 515
             + N G   P + +   R++ +   + VL +     +R++LRE V+ G+G+RA  PGF 
Sbjct: 433 MVIANGGVRYPLSLV---RQDKKPEGQRVLSEQVTLQVRNMLREAVSRGTGKRA-QPGFY 488

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
             GGKTGT   V  + Y D+     F  + P  +P+ + +  +D+P+  E      G   
Sbjct: 489 SAGGKTGTVHLVGAQGYEDSQYKAIFAGMAPIDNPRLVTVVAVDAPQSGE---YYGGEVA 545

Query: 576 APMVGNIIRRSASMLGVKP 594
           AP+   ++  +  +L VKP
Sbjct: 546 APVFSRVMSDALRLLNVKP 564


>gi|317154468|ref|YP_004122516.1| penicillin-binding protein transpeptidase [Desulfovibrio
           aespoeensis Aspo-2]
 gi|316944719|gb|ADU63770.1| penicillin-binding protein transpeptidase [Desulfovibrio
           aespoeensis Aspo-2]
          Length = 652

 Score =  210 bits (535), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 241/503 (47%), Gaps = 31/503 (6%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS 170
           EYG  R  I DRNGE+LAT +   S+Y  P ++   D+    +   L  +    IR+KL+
Sbjct: 59  EYG-ERGRIFDRNGEMLATSVEAKSVYACPFEIADLDKAAGTVAKAL-GMPLSQIRKKLA 116

Query: 171 SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITG 230
           S+ +F W++R++S ++   +    +PG+    E SR YP    A   +G+VDID  G+ G
Sbjct: 117 SKKQFIWVKRQISDREAAALTKADIPGIRLASEFSRIYPNGHLAGQTLGFVDIDGHGLEG 176

Query: 231 IEKFLD--MQGLTRVFTTNKGEK---------------NLQPIRLALDLRIQNIVHQELV 273
           +E+  D  MQ     F   +  K               N   +RL LD  IQ+   Q L 
Sbjct: 177 VERLFDARMQPGKAKFVVQRDAKGSRLYLDAQGREVNINGLDVRLTLDTHIQHAAEQALA 236

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
              ++Y A +   +++ V +G++++M + P ++P+            R    ++E GS F
Sbjct: 237 NAIEQYKARAGIVLVVEVESGDILAMANQPFFNPNTVKGSNPTQRRLRAVTDVYEPGSTF 296

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           K F  A  ++  +   + L +  N   KV    I D HP+   L   ++ RYSSNIG A+
Sbjct: 297 KPFLFAAALEERVIDPETLINCENGRWKVANRTIRDTHPEG-WLPAHKVMRYSSNIGTAK 355

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPL 450
           I   MG   +  +L +LG   K    L    +    +P++W  +    ISFG  +  T +
Sbjct: 356 IGLDMGADVYSSYLSKLGFGEKTSLGLSGESSGLVMHPAKWTSVDLAAISFGQAIGVTAV 415

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRI-VLKKNTVKTMRSLLREGV-TGGSGR 508
           Q A A   L N G +     ++R  +   K + + V    T  T+ S++++ V   G+GR
Sbjct: 416 QMARAFLCLANGG-VTRDLNLVRDPDPGRKNAAVRVFSPETAATVLSMMKDVVHEDGTGR 474

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
            A +PG  + GKTGTAQK  K  Y D    +SF+A+ P   P+ +V++ +D P+      
Sbjct: 475 NARIPGITMAGKTGTAQKAAKGGYGDEY-LSSFVALVPADQPKLLVITMIDEPQKANYGS 533

Query: 569 LTAGINVAPMVGNIIRRSASMLG 591
           + A    AP+  ++  R+ +  G
Sbjct: 534 MVA----APVCRDVTVRTLAYYG 552


>gi|31296609|gb|AAP46597.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  210 bits (535), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 257/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R++ P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQIDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDNLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|32345884|gb|AAM97236.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 259/510 (50%), Gaps = 43/510 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV----LPNLDSEMIRRKLS 170
           +R  I DRNG +LA   PT SLY  P  +   +E+    Q+     L ++  +++R KL 
Sbjct: 74  TRGTIEDRNGAVLALSAPTESLYAVPKDM---EEMPTAAQLEHLSELIDVPVDVLRSKLD 130

Query: 171 SETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            + K F W++R+L  +  + + + GL    F+ E  R YP  +  +HV+G+ DID +G  
Sbjct: 131 QKNKSFIWIKRQLDHKLAEEVEALGLKHFAFQKELKRHYPMGNLFAHVIGFTDIDGKGQE 190

Query: 230 GIEKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQE 271
           G+E  L+      +G   V                NK  +N + I L+LD RIQ + ++E
Sbjct: 191 GLELSLEDSLHAEEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEE 250

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS
Sbjct: 251 LNKAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGS 310

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIG 389
             K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G
Sbjct: 311 AIKPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLST 447
            ++++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  
Sbjct: 367 TSKLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GG 505
           + LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG
Sbjct: 427 SLLQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGG 482

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P    
Sbjct: 483 TGTAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA-- 540

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            N    G+   P+   ++  S ++LGV P 
Sbjct: 541 -NGYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|15599614|ref|NP_253108.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PAO1]
 gi|107099997|ref|ZP_01363915.1| hypothetical protein PaerPA_01001018 [Pseudomonas aeruginosa PACS2]
 gi|116054422|ref|YP_792764.1| penicillin-binding protein 3 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254244771|ref|ZP_04938093.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 2192]
 gi|296391127|ref|ZP_06880602.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PAb1]
 gi|313106948|ref|ZP_07793151.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 39016]
 gi|9950650|gb|AAG07806.1|AE004856_17 penicillin-binding protein 3 [Pseudomonas aeruginosa PAO1]
 gi|840842|emb|CAA58872.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PAO1]
 gi|115589643|gb|ABJ15658.1| penicillin-binding protein 3 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126198149|gb|EAZ62212.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 2192]
 gi|310879653|gb|EFQ38247.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 39016]
          Length = 579

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 152/543 (27%), Positives = 274/543 (50%), Gaps = 31/543 (5%)

Query: 76  MTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFS 135
           +  +V  +++ I+ + +I +  +  +  A S+        R  I DRNGE LA   P  +
Sbjct: 22  LLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVTT 81

Query: 136 LYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRILSF 193
           L+  P ++++  E   +L   L   D+++   ++  ++E +F +L R L+P+Q + +++ 
Sbjct: 82  LWANPKELMTAKERWPQLAAAL-GQDTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIAL 140

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFTTNK 248
            +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D     + G  +V    +
Sbjct: 141 KVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDRR 200

Query: 249 GE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           G         KN +P   + L++DLR+Q + H+EL     +  A++   VI++V TGE++
Sbjct: 201 GRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEIL 260

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR- 356
           +M + P Y+P+     +     NR    +FE GS  K F+++  + SG +   D+ D   
Sbjct: 261 AMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVYP 320

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             +++G++ I D    +R L +  I   SSN+G ++IA  +G +     + ++GL     
Sbjct: 321 GTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDTG 380

Query: 417 TELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
              P  +  + P+  +W +  + T+++G+GLS T +Q A A AAL N+G+ +P + M R 
Sbjct: 381 LGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAALANDGKSVPLS-MTRV 439

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQKVI--KKR 531
               + V   V+      T++ +L++ V    G  RA VPG+   GK+GTA+KV    K 
Sbjct: 440 DRVPDGVQ--VISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTKG 497

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG 591
           Y +    + F    P TDP+  ++  +D P    +     G+  AP+   ++  +  ++ 
Sbjct: 498 YRENAYRSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLVSAPVFSKVMAGALRLMN 554

Query: 592 VKP 594
           V P
Sbjct: 555 VPP 557


>gi|37651042|emb|CAD70588.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  210 bits (534), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELI-DVPVDVLRSKLDQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L  +  + + + GL    F+ E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 NKSFIWIKRQLDHKLAEEVEALGLKHFAFQKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAGAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|32345882|gb|AAM97235.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 259/510 (50%), Gaps = 43/510 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV----LPNLDSEMIRRKLS 170
           +R  I DRNG +LA   PT SLY  P  +   +E+    Q+     L ++  +++R KL 
Sbjct: 74  TRGTIEDRNGAVLALSAPTESLYAVPKDM---EEMPTAAQLEHLSELIDVPVDVLRSKLD 130

Query: 171 SETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            + K F W++R+L  +  + + + GL    F+ E  R YP  +  +HV+G+ DID +G  
Sbjct: 131 QKNKSFIWIKRQLDHKLAEEVEALGLKHFAFQKELKRHYPMGNLFAHVIGFTDIDGKGQE 190

Query: 230 GIEKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQE 271
           G+E  L+      +G   V                NK  +N + I L+LD RIQ + ++E
Sbjct: 191 GLELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEE 250

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS
Sbjct: 251 LNKAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGS 310

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIG 389
             K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G
Sbjct: 311 AIKPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLST 447
            ++++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  
Sbjct: 367 TSKLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GG 505
           + LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG
Sbjct: 427 SLLQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGG 482

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P    
Sbjct: 483 TGTAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA-- 540

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            N    G+   P+   ++  S ++LGV P 
Sbjct: 541 -NGYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|88811844|ref|ZP_01127097.1| Peptidoglycan glycosyltransferase [Nitrococcus mobilis Nb-231]
 gi|88790728|gb|EAR21842.1| Peptidoglycan glycosyltransferase [Nitrococcus mobilis Nb-231]
          Length = 575

 Score =  209 bits (533), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 148/505 (29%), Positives = 252/505 (49%), Gaps = 43/505 (8%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVI--SPDEIIEKLQIVLPNLDSEMIRRKLSS--ETK 174
           I DRNGE LA   P  S++ +P  ++  S D+I    Q++   LD+E +R  L +  + +
Sbjct: 68  IRDRNGEPLAISTPVDSVWADPSDLLLASRDKIARLAQLL--QLDAERLRADLRARQDRE 125

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +LRR+++P   + ++   LPGV  + E  RFYPA   A  +VG+ ++D+ G  G+E  
Sbjct: 126 FVYLRRRITPTLGQEVVDLRLPGVALQREYRRFYPAGEVAGQLVGFTNVDDVGQEGVELA 185

Query: 235 LD-----MQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELVENKKK 278
            +       G  RV     G   ++++ +R         L++D R+Q I ++ L    +K
Sbjct: 186 FNNWLRGEPGAKRVIKDRLGRVIEDIERLREPKPGHALVLSVDRRLQYIAYRALKAAVRK 245

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A S   V+L+  TGEV++MV+ P ++P++  +     + NR     FE GS  K FTI
Sbjct: 246 HGARSGSLVLLDARTGEVLAMVNQPAFNPNDRAELIPSHYRNRAVTDAFEPGSSLKPFTI 305

Query: 339 AMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  +DSG F    L DT    ++V    +HD      ++ +  +   SSN+GAA+IA  +
Sbjct: 306 AAALDSGRFAPHSLVDTTPGVLRVASDTVHDVRNYG-VIDVMTVIEKSSNVGAAKIALDL 364

Query: 398 GIQGHKEFLYRLGLLSKLETELP-------EIQAPSYPSQWKRIHSLTISFGHGLSTTPL 450
                   L R+G      +  P         + P YP     I   T++FG+G+S T L
Sbjct: 365 KPGTVWRMLGRVGFGRSTGSGFPGEAGGYLSGRPPRYP-----IDRATLAFGYGVSATAL 419

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRR 509
           Q A A  A+ N+GRL+P + +   R  +    + V+   + + +RS++ + V+  G+  +
Sbjct: 420 QLAQAYTAIANDGRLLPVSLL---RVNNAPAGQSVISARSARAVRSMMEQVVSSEGTAPK 476

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A +PG+ + GKTGT +K     YSD      F+ + P + P+++    ++ P  K     
Sbjct: 477 AAIPGYRIAGKTGTVKKSASGGYSDRRYAALFVGIAPASAPRFVCAVIINEPTGKP---Y 533

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G+  AP+  ++I  +  +  V P
Sbjct: 534 YGGLVAAPIFRHVIEGALRLRNVPP 558


>gi|315364688|pdb|3PBN|A Chain A, Crystal Structure Of Apo Pbp3 From Pseudomonas Aeruginosa
 gi|315364689|pdb|3PBO|A Chain A, Crystal Structure Of Pbp3 Complexed With Ceftazidime
 gi|315364690|pdb|3PBQ|A Chain A, Crystal Structure Of Pbp3 Complexed With Imipenem
 gi|315364691|pdb|3PBR|A Chain A, Crystal Structure Of Pbp3 Complexed With Meropenem
 gi|315364692|pdb|3PBS|A Chain A, Crystal Structure Of Pbp3 Complexed With Aztreonam
 gi|315364693|pdb|3PBT|A Chain A, Crystal Structure Of Pbp3 Complexed With Mc-1
          Length = 538

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 146/500 (29%), Positives = 256/500 (51%), Gaps = 31/500 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQ 176
           I DRNGE LA   P  +L+  P ++++  E   +L   L   D+++   ++  ++E +F 
Sbjct: 24  ITDRNGEPLAVSTPVTTLWANPKELMTAKERWPQLAAAL-GQDTKLFADRIEQNAEREFI 82

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +L R L+P+Q + +++  +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D
Sbjct: 83  YLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFD 142

Query: 237 -----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYN 280
                + G  +V    +G         KN +P   + L++DLR+Q + H+EL     +  
Sbjct: 143 EWLAGVPGKRQVLKDRRGRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENG 202

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A++   VI++V TGE+++M + P Y+P+     +     NR    +FE GS  K F+++ 
Sbjct: 203 AKAGSLVIMDVKTGEILAMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSA 262

Query: 341 GIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + SG +   D+ D     +++G++ I D    +R L +  I   SSN+G ++IA  +G 
Sbjct: 263 ALASGRWKPSDIVDVYPGTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGA 322

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +     + ++GL        P  +  + P+  +W +  + T+++G+GLS T +Q A A A
Sbjct: 323 ESIYSVMQQVGLGQDTGLGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYA 382

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFE 516
           AL N+G+ +P + M R     + V   V+      T++ +L++ V    G  RA VPG+ 
Sbjct: 383 ALANDGKSVPLS-MTRVDRVPDGVQ--VISPEVASTVQGMLQQVVEAQGGVFRAQVPGYH 439

Query: 517 VGGKTGTAQKVI--KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
             GK+GTA+KV    K Y +    + F    P TDP+  ++  +D P    +     G+ 
Sbjct: 440 AAGKSGTARKVSVGTKGYRENAYRSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLV 496

Query: 575 VAPMVGNIIRRSASMLGVKP 594
            AP+   ++  +  ++ V P
Sbjct: 497 SAPVFSKVMAGALRLMNVPP 516


>gi|311772227|pdb|3OC2|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 From
           Pseudomonas Aeruginosa
 gi|311772234|pdb|3OCL|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 From
           Pseudomonas Aeruginosa In Complex With Carbenicillin
 gi|311772235|pdb|3OCN|A Chain A, Crystal Structure Of Penicillin-Binding Protein 3 From
           Pseudomonas Aeruginosa In Complex With Ceftazidime
          Length = 564

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 146/500 (29%), Positives = 256/500 (51%), Gaps = 31/500 (6%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQ 176
           I DRNGE LA   P  +L+  P ++++  E   +L   L   D+++   ++  ++E +F 
Sbjct: 50  ITDRNGEPLAVSTPVTTLWANPKELMTAKERWPQLAAAL-GQDTKLFADRIEQNAEREFI 108

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +L R L+P+Q + +++  +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D
Sbjct: 109 YLVRGLTPEQGEGVIALKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFD 168

Query: 237 -----MQGLTRVFTTNKGE--------KNLQP---IRLALDLRIQNIVHQELVENKKKYN 280
                + G  +V    +G         KN +P   + L++DLR+Q + H+EL     +  
Sbjct: 169 EWLAGVPGKRQVLKDRRGRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENG 228

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A++   VI++V TGE+++M + P Y+P+     +     NR    +FE GS  K F+++ 
Sbjct: 229 AKAGSLVIMDVKTGEILAMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSA 288

Query: 341 GIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + SG +   D+ D     +++G++ I D    +R L +  I   SSN+G ++IA  +G 
Sbjct: 289 ALASGRWKPSDIVDVYPGTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGA 348

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           +     + ++GL        P  +  + P+  +W +  + T+++G+GLS T +Q A A A
Sbjct: 349 ESIYSVMQQVGLGQDTGLGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYA 408

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFE 516
           AL N+G+ +P + M R     + V   V+      T++ +L++ V    G  RA VPG+ 
Sbjct: 409 ALANDGKSVPLS-MTRVDRVPDGVQ--VISPEVASTVQGMLQQVVEAQGGVFRAQVPGYH 465

Query: 517 VGGKTGTAQKVI--KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
             GK+GTA+KV    K Y +    + F    P TDP+  ++  +D P    +     G+ 
Sbjct: 466 AAGKSGTARKVSVGTKGYRENAYRSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLV 522

Query: 575 VAPMVGNIIRRSASMLGVKP 594
            AP+   ++  +  ++ V P
Sbjct: 523 SAPVFSKVMAGALRLMNVPP 542


>gi|31296591|gb|AAP46588.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|37651032|emb|CAD70583.1| penicillin-binding protein 2 [Neisseria meningitidis]
 gi|37651044|emb|CAD70589.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 260/508 (51%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELI-DVPVDVLRSKLDQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L  +  + + + GL    F+ E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 NKSFIWIKRQLDHKLAEEVEALGLKHFAFQKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P+   ++  S ++LGV P 
Sbjct: 542 GYYGGVVTGPVFKQVMGGSLNILGVSPT 569


>gi|31296649|gb|AAP46617.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 485 TAGAVDGFDVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---H 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LG+ P 
Sbjct: 542 GYYGGVVAGPPFKKIMGGSLNILGISPT 569


>gi|32345894|gb|AAM97241.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 256/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  KN + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDAGKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K +T + +R+L+   VT  GG+G
Sbjct: 429 LQLARAYTALTHDGVLLPVSF---EKQAVAPQGKRIFKASTAREVRNLMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGT +K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTXRKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+        I+  S ++LGV P 
Sbjct: 542 GYYGGVVAGQPFKKIMGGSLNILGVSPT 569


>gi|308173482|ref|YP_003920187.1| penicillin-binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606346|emb|CBI42717.1| penicillin-binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|328911618|gb|AEB63214.1| penicillin-binding protein [Bacillus amyloliquefaciens LL3]
          Length = 639

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 158/518 (30%), Positives = 258/518 (49%), Gaps = 48/518 (9%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R +I+DRNG  LAT+    +++V P ++ +P +  + L  VL N+  E + + ++ +T  
Sbjct: 59  RGEILDRNGVKLATNKSAPTVFVVPRQIQNPIKTGKLLASVL-NMSEEKVYKHITKKTSI 117

Query: 176 QWLR---RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
           + +    RK+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E
Sbjct: 118 EKISPEGRKISNKKAKEIKALNLKGVYVAEDSIRHYPYGSFLSHVLGFAGIDNQGLLGLE 177

Query: 233 KFLD-----MQGLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVEN 275
            + D     ++G  + +T  KG+K      +  P      ++L +D ++Q I+ +EL   
Sbjct: 178 AYYDDDLKGVKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTIDAKVQTIIERELDNA 237

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIF 333
             KYN + +  V +N   GEV+ M S PD+DP + ++      +NR    +  +E GS F
Sbjct: 238 AAKYNPDGMIAVAMNPKNGEVLGMSSRPDFDPAD-YQSVDPSVYNRNLPVWSTYEPGSTF 296

Query: 334 KVFTIAMGIDSGLFTV-KDLFDTRNPIKVGKHVIHDY----HPQNRILTIPEIFRYSSNI 388
           K+ T+A  +      + +D F  R   +V    +  +    H     L   E+ + S N 
Sbjct: 297 KIITLAAALQEQKVNLQRDHFYDRGFAEVDGARLRCWKKGGHGSQSYL---EVVQNSCNP 353

Query: 389 GAAQIADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLS 446
           G  ++ + +G Q   +++   G   K   +L  E     +P  +   +   T +FG G+S
Sbjct: 354 GFVELGERLGKQKLFQYIKDFGFGKKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVS 413

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRS----------REESEKVSRIVLKKNTVKTMRS 496
            TP+Q   A +A IN G L  P F+ +           +++S    R V+ + T K +R 
Sbjct: 414 VTPIQQVAAVSAAINGGTLYTP-FIAKEWVDPVTKKTVKKQSPIAKRQVISQETSKQIRY 472

Query: 497 LLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLS 556
            L   V  G+GR AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V  
Sbjct: 473 ALESVVAQGTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYV 532

Query: 557 FMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            +D+PK   +     G   AP+VGNI+R S   LG+KP
Sbjct: 533 AVDNPKGTIQ---FGGTVAAPIVGNIMRDSLPELGIKP 567


>gi|209870566|pdb|3EQU|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From
           Neisseria Gonorrhoeae
 gi|209870567|pdb|3EQU|B Chain B, Crystal Structure Of Penicillin-Binding Protein 2 From
           Neisseria Gonorrhoeae
          Length = 542

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 255/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K       +E+L  ++ ++  +++R KL  +
Sbjct: 35  TRGTVSDRNGAVLALSAPTESLFAVPKDXKEXPSAAQLERLSELV-DVPVDVLRNKLEQK 93

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 94  GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPXGNLFAHVIGFTDIDGKGQEGL 153

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  +N + I L+LD RIQ + ++EL 
Sbjct: 154 ELSLEDSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 213

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++ + P YDP+   +   E   NR      E GS  
Sbjct: 214 KAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDXIEPGSAI 273

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+G   + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 274 KPFVIAKALDAGKTDLNERLNTQ-PYKIGPSPVRDTHVYPS---LDVRGIXQKSSNVGTS 329

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++   G +   +F + LG+  +  +  P   A    +  +W+ I   T SFG+GL  + 
Sbjct: 330 KLSARFGAEEXYDFYHELGIGVRXHSGFPGETAGLLRNWRRWRPIEQATXSFGYGLQLSL 389

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A  AL ++G L+P +F    ++      + + K+ T + +R+L    VT  GG+G
Sbjct: 390 LQLARAYTALTHDGVLLPLSF---EKQAVAPQGKRIFKEXTAREVRNLXVS-VTEPGGTG 445

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +
Sbjct: 446 TAGAVDGFDVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---H 502

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I   S ++LG+ P 
Sbjct: 503 GYYGGVVAGPPFKKIXGGSLNILGISPT 530


>gi|31296633|gb|AAP46609.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 150/508 (29%), Positives = 259/508 (50%), Gaps = 39/508 (7%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFL---------------DMQG-LTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L               D QG +     +  NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQSDSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIGAA 391
           K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G +
Sbjct: 313 KPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVGTS 368

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTP 449
           +++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + 
Sbjct: 369 KLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSL 428

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSG 507
           LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G
Sbjct: 429 LQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTG 484

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 485 TAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---N 541

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPV 595
               G+   P    I+  S ++LGV P 
Sbjct: 542 GYYGGVVTGPPFKKIMGGSLNILGVSPT 569


>gi|328553588|gb|AEB24080.1| penicillin-binding protein [Bacillus amyloliquefaciens TA208]
          Length = 639

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 158/518 (30%), Positives = 258/518 (49%), Gaps = 48/518 (9%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R +I+DRNG  LAT+    +++V P ++ +P +  + L  VL N+  E + + ++ +T  
Sbjct: 59  RGEILDRNGVKLATNKSAPTVFVVPRQIQNPIKTGKLLASVL-NMSEEKVYKHITKKTSI 117

Query: 176 QWLR---RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
           + +    RK+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E
Sbjct: 118 EKISPEGRKISNKKAKEIKALDLKGVYVAEDSIRHYPYGSFLSHVLGFAGIDNQGLLGLE 177

Query: 233 KFLD-----MQGLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVEN 275
            + D     ++G  + +T  KG+K      +  P      ++L +D ++Q I+ +EL   
Sbjct: 178 AYYDDDLKGVKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTIDAKVQTIIERELDNA 237

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIF 333
             KYN + +  V +N   GEV+ M S PD+DP + ++      +NR    +  +E GS F
Sbjct: 238 AAKYNPDGMIAVAMNPKNGEVLGMSSRPDFDPAD-YQSVDPSVYNRNLPVWSTYEPGSTF 296

Query: 334 KVFTIAMGIDSGLFTV-KDLFDTRNPIKVGKHVIHDY----HPQNRILTIPEIFRYSSNI 388
           K+ T+A  +      + +D F  R   +V    +  +    H     L   E+ + S N 
Sbjct: 297 KIITLAAALQEQKVNLQRDHFYDRGFAEVDGARLRCWKKGGHGSQSYL---EVVQNSCNP 353

Query: 389 GAAQIADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLS 446
           G  ++ + +G Q   +++   G   K   +L  E     +P  +   +   T +FG G+S
Sbjct: 354 GFVELGERLGKQKLFQYIKDFGFGKKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVS 413

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRS----------REESEKVSRIVLKKNTVKTMRS 496
            TP+Q   A +A IN G L  P F+ +           +++S    R V+ + T K +R 
Sbjct: 414 VTPIQQVAAVSAAINGGTLYTP-FIAKEWVDPVTKKTVKKQSPIAKRQVISQETSKQIRY 472

Query: 497 LLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLS 556
            L   V  G+GR AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V  
Sbjct: 473 ALESVVAQGTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYV 532

Query: 557 FMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            +D+PK   +     G   AP+VGNI+R S   LG+KP
Sbjct: 533 AVDNPKGTIQ---FGGTVAAPIVGNIMRDSLPELGIKP 567


>gi|311068037|ref|YP_003972960.1| penicillin-binding protein [Bacillus atrophaeus 1942]
 gi|310868554|gb|ADP32029.1| penicillin-binding protein [Bacillus atrophaeus 1942]
          Length = 639

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 154/514 (29%), Positives = 257/514 (50%), Gaps = 40/514 (7%)

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R +I+DRNG  LAT+    +++V P +V +P    ++L  VL N+  E + + L+ +   
Sbjct: 59  RGEILDRNGVKLATNKSAPTVFVVPRQVQNPVSTSKQLAAVL-NMSEEKVYKHLTKKASI 117

Query: 176 QWLR---RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
           + +    RK+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E
Sbjct: 118 EKITPEGRKISNKKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLE 177

Query: 233 KFLD-----MQGLTRVFTTNKGEK------NLQP------IRLALDLRIQNIVHQELVEN 275
            + D      +G  + +T  KG+K      +  P      ++L +D ++Q I+ +EL   
Sbjct: 178 AYYDDDLKGEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNA 237

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIF 333
           + KYN + +  V +N   GE+++M S PD+DP + ++      +NR    +  +E GS F
Sbjct: 238 EAKYNPDGMIAVAMNPKNGEILAMSSRPDFDPAD-YQSVDSSVYNRNLPVWSTYEPGSTF 296

Query: 334 KVFTIAMGIDSGLFTVK-DLFDTRNPIKVGKHVIHDYHPQNRIL-TIPEIFRYSSNIGAA 391
           K+ T+A  ++     +K D +  +   +V    +  +      L T  E+ + S N G  
Sbjct: 297 KIITLAAALEEQKVNLKRDQYYDKGHTEVDGARLRCWKKGGHGLQTFLEVVQNSCNPGFV 356

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYP-SQWKRIHSLTISFGHGLSTTP 449
           ++ + +G +   +++   G   K   +L  E     +P  +   +   T +FG G+S TP
Sbjct: 357 ELGERLGKEKLFKYIKSFGFGQKTGIDLQGEGTGILFPLDKVGPVEQATTAFGQGVSVTP 416

Query: 450 LQTAVAAAALINEGRL---------IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE 500
           +Q   A +A +N G L         I P      +++S    + V+ + T K +R  L  
Sbjct: 417 IQQVAAVSAAVNGGTLYTPYIAKEWIDPVTKKTVKKQSPVAKKQVISEETSKQIRYALES 476

Query: 501 GVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDS 560
            V  G+GR AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+
Sbjct: 477 VVAEGTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDN 536

Query: 561 PKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           PK   +     G   AP+VGNI+R S   +GVKP
Sbjct: 537 PKGTIQ---FGGTVAAPIVGNIMRDSLPEIGVKP 567


>gi|82703615|ref|YP_413181.1| peptidoglycan glycosyltransferase [Nitrosospira multiformis ATCC
           25196]
 gi|82411680|gb|ABB75789.1| peptidoglycan synthetase FtsI [Nitrosospira multiformis ATCC 25196]
          Length = 587

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 144/505 (28%), Positives = 255/505 (50%), Gaps = 40/505 (7%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL- 169
           E   +R  I DR G+ LA   P  S+++ P  V++  E + +L  ++ ++D++ + ++L 
Sbjct: 58  EMNANRGMITDRYGKPLAISTPVESVWLSPQDVVATPEQLSRLADLI-DMDADELHKRLG 116

Query: 170 -----------SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
                      +S   F +L+R LSP     ++   +PG+  + E  R+YPA    SHV+
Sbjct: 117 GLAGASQGSRAASRRDFVYLKRHLSPAVAAGVVQLKIPGIFLKREYRRYYPAGDLTSHVL 176

Query: 219 GYVDIDNRGITGIE-----KFLDMQGLTRVFTTNKGE--KNLQPIR---------LALDL 262
           G+ D+D+RG  GIE     +     G  RV    KG   ++++ IR         L++D 
Sbjct: 177 GFTDLDDRGQEGIELAWQDELAGKPGSRRVIKDRKGHIIEDVESIRAPKPGQNMALSIDS 236

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           +IQ + ++EL +  + + A++ G V L+V TGEV+++V++P Y+P+           NR 
Sbjct: 237 KIQYLAYRELKQAVETHKAKAGGLVALDVKTGEVLALVNLPTYNPNNRSNRNSAQSRNRA 296

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEI 381
              +FE GS  K FT+A  +++G  T   +F T      +GK  I D H +   LT+ ++
Sbjct: 297 VTDMFEPGSTLKPFTVAAALEAGRITPDTVFQTAPGSFTIGKATIRDAH-RTEALTVTQV 355

Query: 382 FRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYPSQ-WKRIHSLTI 439
            + SSN+G+A+IA ++  Q   E L   G      +  P E+     P + W+ I   T+
Sbjct: 356 IQKSSNVGSAKIALSLPPQTLWEMLNGAGFGELPGSGFPGEVSGKLRPYKTWRPIEQATM 415

Query: 440 SFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLR 499
           S+GHG++ + +Q A A      EG + P + +   + +S  VS+  + ++T   +  +L 
Sbjct: 416 SYGHGIAVSLMQLARAYMIFAAEGEIKPVSLL---KLDSAPVSKRAISRDTALAVSRMLE 472

Query: 500 E-GVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFM 558
                GG+  +A V G+ V GKTGTA K+  + Y+     ++F+   P ++P+Y++   +
Sbjct: 473 MVAQPGGTAPQAQVSGYRVAGKTGTAHKLEGRGYAKNRYLSTFVGYAPVSNPRYVIAVML 532

Query: 559 DSPKIKERNQLTAGINVAPMVGNII 583
           D P      Q   G   AP+   ++
Sbjct: 533 DEPSA---GQYYGGTVAAPVFSRVM 554


>gi|261378429|ref|ZP_05983002.1| peptidoglycan synthetase FtsI [Neisseria cinerea ATCC 14685]
 gi|269145207|gb|EEZ71625.1| peptidoglycan synthetase FtsI [Neisseria cinerea ATCC 14685]
          Length = 582

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 149/509 (29%), Positives = 258/509 (50%), Gaps = 43/509 (8%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV----LPNLDSEMIRRKLS 170
           +R  I DRNG +LA   PT SLY  P  +   +E+    Q+     L ++  +++R KL 
Sbjct: 74  TRGTIEDRNGAVLALSAPTESLYAVPKDM---EEMPTAAQLEHLSELIDVPVDVLRSKLD 130

Query: 171 SETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            + K F W++R+L  +  + + + GL    F+ E  R YP  +  +HV+G+ DID +G  
Sbjct: 131 QKNKSFIWIKRQLDHKLAEEVEALGLKHFAFQKELKRHYPMGNLFAHVIGFTDIDGKGQE 190

Query: 230 GIEKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQE 271
           G+E  L+      +G   V                NK  +N + I L+LD RIQ + ++E
Sbjct: 191 GLELSLEDSLHAEEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEE 250

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS
Sbjct: 251 LNKAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGS 310

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH--PQNRILTIPEIFRYSSNIG 389
             K F IA  +D+    + +  +T+ P K+G   + D H  P    L +  I + SSN+G
Sbjct: 311 AIKPFVIAKALDADKTNLNERLNTQ-PYKIGPAQVRDTHVYPS---LDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLST 447
            ++++     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  
Sbjct: 367 TSKLSARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GG 505
           + LQ A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG
Sbjct: 427 SLLQLARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGG 482

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P    
Sbjct: 483 TGTAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA-- 540

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            N    G+   P+   ++  S ++LGV P
Sbjct: 541 -NGYYGGVVAGPVFKQVMGGSLNILGVSP 568


>gi|282896263|ref|ZP_06304285.1| Penicillin-binding protein, transpeptidase [Raphidiopsis brookii
           D9]
 gi|281198759|gb|EFA73638.1| Penicillin-binding protein, transpeptidase [Raphidiopsis brookii
           D9]
          Length = 631

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 248/508 (48%), Gaps = 48/508 (9%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           M R  ++DRN  +LA D P +++YV P     S   I EK+  +L N D   + +   + 
Sbjct: 109 MPRRPLVDRNKSLLAIDRPVYTVYVHPKLFNKSSQAIAEKIAPIL-NKDVGDLVKLFKTR 167

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
                L  K+S     R++SF L G+ F  + SRFYP     + VVGYV+++  G  G+E
Sbjct: 168 KSGILLADKVSENIADRLISFRLDGLEFIEKYSRFYPQEDLVADVVGYVNLERHGQAGVE 227

Query: 233 ----KFLDMQGLTRVFTTNKGEKNLQP--------------IRLALDLRIQNIVHQELVE 274
               K L+    T V  T  G  ++ P              ++L +D R+Q  V   L +
Sbjct: 228 YSQDKLLERSRET-VRLTRTGAGDIMPDYAPDEFLYSDDFKLQLTIDSRLQRAVRSALKQ 286

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             KK+ A+    ++++   G ++S+VS P YDP+E FK     + N     ++E GS FK
Sbjct: 287 QVKKFQAKRGAVIVMDAKDGSLLSLVSQPSYDPNEYFKANIASFKNWTVTDLYEPGSTFK 346

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQN-RILTIPEIFRYSSNIGAAQI 393
              +A+ +++G+ +  D FD    I+V   +I +    + R + + EI + SSN+G  QI
Sbjct: 347 PLIVAVALETGVISPDDRFDDPGTIRVADQIIKNAAINSFRQINVAEILQTSSNVGMVQI 406

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELP---------EIQAPSYPSQWKRIHSLTISFGHG 444
              +  + +  +L +LG+  K++T+LP         + Q  S P     +   T SFG G
Sbjct: 407 VQRLQPKIYYNWLQKLGIGQKMDTDLPFGTRGILKNQDQFLSSP-----VEMATASFGQG 461

Query: 445 LSTTPLQTAVAAAALINEGRLIPPTF---MIRSREESE-----KVSRIVLKKNTVKTMRS 496
            S TPLQ      AL N G+L+ P     +I S+ +        V R +   +T +T+ +
Sbjct: 462 FSLTPLQLVQMHGALANGGKLVTPHVVQGLIDSQGKVHFSPEIPVPRQIFSPSTTQTVVN 521

Query: 497 LLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVL 555
           ++   VT GSG+ + + G+ V GKTGTAQK      Y       SF+ +FP   P+Y++L
Sbjct: 522 MMETVVTQGSGKASRIQGYAVAGKTGTAQKASPSGGYIPGARITSFVGIFPVEAPRYVIL 581

Query: 556 SFMDSPKIKERNQLTAGINVAPMVGNII 583
           + +D PK         G   AP+V +++
Sbjct: 582 AVVDEPK---GGDAYGGTVAAPIVKSVL 606


>gi|152979995|ref|YP_001354711.1| FtsI cell division protein [Janthinobacterium sp. Marseille]
 gi|151280072|gb|ABR88482.1| FtsI cell division protein [Janthinobacterium sp. Marseille]
          Length = 586

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 143/474 (30%), Positives = 239/474 (50%), Gaps = 31/474 (6%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKL 169
           E   +R  I DRNG++LA+ +P  +++  P  V+ SP E ++ L  +L ++    +RRKL
Sbjct: 73  ELPATRGKITDRNGQVLASSVPVRAVWAIPEDVLESPPEKLQALAKLL-DMPERELRRKL 131

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            S+  F +L+R++      +IL  G+ G+  R E  R+YP     +H+VG+ +++++G  
Sbjct: 132 DSDRTFVYLKRQVELDTVDKILKLGIAGIDTRKEYKRYYPEGEVMAHIVGFTNVEDKGQE 191

Query: 230 GIE-----KFLDMQGLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELV 273
           G+E       + + G  RV     G   ++++ +R         L++D +IQ I    L 
Sbjct: 192 GMELAYQKTLVGVTGSRRVIKDRLGRIVEDIESVREPHDGKDLALSIDSKIQYIAFSALK 251

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           E  +   A++ G V+++  TGEV+++ ++P Y+P+           NR+    FE GS  
Sbjct: 252 EAVEVNKAKAGGIVVMDAKTGEVLALANLPTYNPNNRSVLTGAQLRNRVITDTFEPGSTM 311

Query: 334 KVFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           K F++A+G+++   T   +  T    + +G   I D H    +L++ ++   SSNIG A+
Sbjct: 312 KPFSVALGLETNRVTPNTMIQTAPGKMTIGTATIGDAHASG-LLSVSQVIEKSSNIGTAK 370

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAP---SYPSQWKRIHSLTISFGHGLSTTP 449
           IA  M      +    +G   + +   P   A     Y S W+ I   T+S+GHG+S + 
Sbjct: 371 IALQMEPHEMWDLFTSVGFGQQPKINFPGAVAGRVRPYKS-WRPIEQATMSYGHGISVSL 429

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG--GSG 507
           LQ   A      +G LIP TF    R   + +   +    T + MRS+L E   G  GS 
Sbjct: 430 LQMVHAYTVFARDGDLIPITF---QRTTDQPIGERIFSAKTARQMRSML-EMAAGPTGSA 485

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
            RA VPG+ V GKTGTA K+ K +Y      +SF+   P +DP+ I+   +D P
Sbjct: 486 PRAQVPGYRVAGKTGTAYKIEKGQYVRKY-VSSFVGFAPVSDPRIIIAVMIDEP 538


>gi|509126|emb|CAA42183.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 584

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 146/505 (28%), Positives = 257/505 (50%), Gaps = 34/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPH--KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
           +R  + DRNG +LA   PT SL+  P   K +     +E+L  ++ ++  +++R KL  +
Sbjct: 74  TRGTVSDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSELV-DVPVDVLRNKLEQK 132

Query: 173 TK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+
Sbjct: 133 GKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGL 192

Query: 232 EKFLD-----MQGLTRVFTT-------------NKGEKNLQPIRLALDLRIQNIVHQELV 273
           E  L+      +G   V                NK  +N + I L+LD RIQ + ++EL 
Sbjct: 193 ELSLEDSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELN 252

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  + + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  
Sbjct: 253 KAVEYHQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAI 312

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K F IA  +D+    + +  +T+ P K+G   + D       L +  I + SSN+G +++
Sbjct: 313 KPFVIAKALDAEKTNLNERLNTQ-PYKIGPAQVRDDTHVYPSLDVRGIMQKSSNVGTSKL 371

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQ 451
           +     +   +  + LG+  ++ +  P   A +  +  +W+ I   T+SFG+GL  + LQ
Sbjct: 372 SARFSSKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSLLQ 431

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT--GGSGRR 509
            A A   L ++G L+P +F    ++      + + K +T + +R L+   VT  GG+G  
Sbjct: 432 LARAYTVLTHDGVLLPVSF---EKQAVAPQGKRIFKASTARQVRELMVS-VTEPGGTGTA 487

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
             V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N  
Sbjct: 488 GAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGY 544

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G+   P+   ++  S ++LGV P
Sbjct: 545 YGGVVAGPVFKQVMGGSLNILGVSP 569


>gi|282901655|ref|ZP_06309571.1| Penicillin-binding protein, transpeptidase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193418|gb|EFA68399.1| Penicillin-binding protein, transpeptidase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 631

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 153/504 (30%), Positives = 249/504 (49%), Gaps = 40/504 (7%)

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEII-EKLQIVLPNLDSEMIRRKLSSE 172
           M R  ++DRN  +LA D P ++LYV P      ++ + EK+   L N D   + +   + 
Sbjct: 109 MPRRPLVDRNKTLLAIDRPVYTLYVHPKLFSKSNQAVAEKIAPFL-NKDVTNLVKLFKTR 167

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
                L  K+S     R++SF L G+ F  + SRFYP     + VVGYV+++  G  G+E
Sbjct: 168 KSGILLADKVSENIADRLISFRLDGLEFIEKYSRFYPEEDLVADVVGYVNLERHGQAGVE 227

Query: 233 ----KFLDMQGLTRVFTTNKGEKNLQP--------------IRLALDLRIQNIVHQELVE 274
               K L+    T V  T  G  ++ P              ++L +D R+Q  V   L +
Sbjct: 228 YSQDKLLERSRET-VRLTRTGAGDIMPDYAPDEFLYSDDFKLQLTIDSRLQRAVRSALKQ 286

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             +K+ A+    ++++   G ++S+VS P Y+P+E  K     + N     ++E GS FK
Sbjct: 287 QVEKFQAKRGAVIVMDAKDGSLLSLVSQPSYNPNEYSKANIASFKNWTVTDLYEPGSTFK 346

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQN-RILTIPEIFRYSSNIGAAQI 393
              +A  ++SG+ T  D F+    I+V  HVI +    + R + I EI + SSN+G  QI
Sbjct: 347 PLIVAAALESGVITPDDRFNDPGTIRVSDHVIKNAVINSFRQINIAEILQTSSNVGMVQI 406

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHS----LTISFGHGLSTTP 449
              +  + +  +L +LG+  K++T+LP     S  +Q + + S     T SFG G S TP
Sbjct: 407 VQRLEPKIYYSWLQKLGIGQKMDTDLPFSTRGSLKNQDRFLSSPLEMATASFGQGFSLTP 466

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESE---------KVSRIVLKKNTVKTMRSLLRE 500
           LQ      AL N G+L+ P  +++   +SE          V R +   +T +T+ +++  
Sbjct: 467 LQLVQMHGALANGGKLVTP-HVVQGLIDSEGKVHFSPEIPVPRQIFSPSTTQTVVNMMET 525

Query: 501 GVTGGSGRRAFVPGFEVGGKTGTAQKVIKK-RYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
            VT GSG+ + + G+ V GKTGTAQK      Y       SF+ +FP   P+Y++L+ +D
Sbjct: 526 VVTQGSGKASRIQGYAVAGKTGTAQKASPNGGYIPGARITSFVGIFPVEAPRYVILAVVD 585

Query: 560 SPKIKERNQLTAGINVAPMVGNII 583
            PK         G   AP+V +++
Sbjct: 586 EPK---GGNAYGGTVAAPIVKSVL 606


>gi|192360172|ref|YP_001983391.1| penicillin-binding protein 3 [Cellvibrio japonicus Ueda107]
 gi|190686337|gb|ACE84015.1| penicillin-binding protein 3 - Pseudomonas aeruginosa [Cellvibrio
           japonicus Ueda107]
          Length = 610

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 145/465 (31%), Positives = 240/465 (51%), Gaps = 27/465 (5%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEM-IRRKLSSETKFQW 177
           I DRNGE LA   P  +L+  P  + +  + I +L   L    +++  R +  S+ +F +
Sbjct: 84  ITDRNGEPLAVSTPVSTLWANPKVLAAAVDRIPELAKALEQNPADLKARLERYSKKEFMY 143

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE----- 232
           L+R L+PQ  + +L+  +PGV  ++E  R+YPAA  A+H+VG  D+D+RG  G+E     
Sbjct: 144 LKRGLAPQAAQTVLALDIPGVYEQVEYHRYYPAADVAAHLVGRTDVDDRGQEGMELAYDA 203

Query: 233 ----------KFLDMQGLT-RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
                        D++G T +     K  ++ Q + L++DLR+Q + H+EL +  +   A
Sbjct: 204 WLTGENGAKEVLKDLRGRTVKELRLVKAARSGQNLALSIDLRLQYLAHRELRKALEAAGA 263

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
           ++   VIL+V TGEV++M ++P Y+P++  +   EG  NR    ++E GS  K + +   
Sbjct: 264 KAGSIVILDVLTGEVLAMSNLPSYNPNDRSRNWGEGIRNRAITDLYEPGSTVKPWVVLAA 323

Query: 342 IDSGLFTVKDLFDTRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           +++G F   D+ DT +P  + VG   I D H     L +      SSNI   +IA A+  
Sbjct: 324 LETGKFKASDVIDT-SPGYMMVGTKAIKD-HQNYGALDMAMAIAKSSNIAMTKIAFALEP 381

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
              +    RLG+   + T  P     S P     +RI    +S+G+ L+ T LQ AV A 
Sbjct: 382 GTLRGMFARLGIGQPIGTGFPGEAVGSLPLFKASQRIERANMSYGYALNITALQ-AVQAY 440

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFE 516
           A+I  G +  P  ++R   ++  V   V+ ++  + ++ +L+  VT  G+GRRA    + 
Sbjct: 441 AVIASGGIKRPVSLLRV--DTPPVGERVVAEDYTQQVQDMLKRVVTAEGTGRRAQAISYS 498

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
           V GKTGTA K I   Y+      SF+ + P  DP+ + +  +D P
Sbjct: 499 VAGKTGTAFKAIGGSYAAQKQIGSFIGMAPADDPRIVAMVVIDEP 543


>gi|83648528|ref|YP_436963.1| penicillin-binding protein 2 [Hahella chejuensis KCTC 2396]
 gi|83636571|gb|ABC32538.1| penicillin-binding protein 2 [Hahella chejuensis KCTC 2396]
          Length = 590

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 267/545 (48%), Gaps = 31/545 (5%)

Query: 74  IGMTIVVCLVIYI--ILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDI 131
           + + +V C ++ +  ++ +++I +  +  +    ++ ++    +R  I+DRNGE LA   
Sbjct: 33  VAIMLVACFIVLVWRVIDLQVINHEFLRSQGDMRTVRVEPIQATRGKILDRNGEPLAVSA 92

Query: 132 PTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQQKRI 190
           P  +L+  P +    DE   KL  +L     EM++R    + K F +++R+LSP+  +  
Sbjct: 93  PVVTLWANPQEAQENDEGWRKLADLLGMQSDEMVKRLRRHKGKEFIYVQRQLSPETGRLA 152

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFT 245
           +   L G+  + E  R+YPA   A+H+VG  DID +G  G+E   D     + G  +V  
Sbjct: 153 MDLKLQGLYAKREFKRYYPAGEVAAHIVGITDIDEKGQEGVELAFDQYLRGVNGSKKVLK 212

Query: 246 TNKGE--KNLQ---------PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTG 294
             +G   K+L           ++L++DLR+Q + ++EL    + +NA+S   VIL+V TG
Sbjct: 213 DRRGYVIKDLSLLQDAQSGADLQLSIDLRLQYMAYRELKAAVEAHNAKSGSLVILDVRTG 272

Query: 295 EVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD 354
           EV++MV+ P ++P+        G  NR    +FE GS  K  +IA  + +G FT +   +
Sbjct: 273 EVLAMVNQPSFNPNNRDSMNPSGLRNRAVTDLFEPGSTVKPLSIAAALKTGSFTTETRIN 332

Query: 355 TRNP--IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           T +P  +++    I D       L +  I   SSN+G +++A  +G +   E  Y+ G  
Sbjct: 333 T-SPGFLRLNGQTIRDARDYG-TLDLVSIITKSSNVGTSKVALKIGGEAVFETFYQAGFG 390

Query: 413 SKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
                E P       P  ++W+ I   T+S+G+GLS T LQ A +  A+  +G +  P  
Sbjct: 391 QSSGIEFPGEAVGVLPNFTKWQPIRLATLSYGYGLSVTALQLAQSYMAIAADG-VRRPVS 449

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK 529
           +IR  ++     + V+     + +R +L   V  GG+G RA V  + V GKTGT  KV +
Sbjct: 450 LIRGGQQGVSPQQ-VMSPGISRHIREMLETVVLKGGTGTRAHVAEYRVAGKTGTTHKVGE 508

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
             Y+D      F  + P   P+  +   M+ P+  E      G   AP+   ++  +  +
Sbjct: 509 HGYADDAYNAVFAGLAPVEKPRLAMAIVMNEPQGSE---YYGGEVSAPVFARVVANALRL 565

Query: 590 LGVKP 594
           L V P
Sbjct: 566 LNVAP 570


>gi|237654090|ref|YP_002890404.1| peptidoglycan glycosyltransferase [Thauera sp. MZ1T]
 gi|237625337|gb|ACR02027.1| Peptidoglycan glycosyltransferase [Thauera sp. MZ1T]
          Length = 588

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 143/505 (28%), Positives = 251/505 (49%), Gaps = 30/505 (5%)

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKL 169
           E   +R  I DR+G+ILA   P  +++  P    + P ++ E  +++  N+    +  +L
Sbjct: 66  EVPATRGRITDRHGDILAVSTPVRAVWALPADARLEPAQVRELARLLEMNVGE--LNARL 123

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
           ++   F +L+R++ P+  + +    LPG+    E  R+YP     +H++G+ D+++RG  
Sbjct: 124 AAGRDFVYLKRQVPPEVAQAVADLRLPGIHQEKEYRRYYPGGEVMAHILGFTDLEDRGQE 183

Query: 230 GIEKFLDMQ-----GLTRVFTTNKGE--KNLQPIR---------LALDLRIQNIVHQELV 273
           GIE   D +     G  RV    +G+  ++++ IR         L++D +IQ +    L 
Sbjct: 184 GIELAFDKRLSGRAGARRVIKDRRGQIVEDVEAIRPPRDGDEVALSIDGKIQYLAWSALR 243

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           E  +++  ++   V+L+V TGEV+++V+ P ++P+           NR+    FE GS+ 
Sbjct: 244 EAMEEHKPKAAAAVVLDVRTGEVLALVNAPTFNPNNRANLTGAQLRNRVFTDAFEPGSVM 303

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNP-IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           K F  A+ ++ G   +    DT N  + +G   I D   ++ ++T+ ++ + SSNIG  +
Sbjct: 304 KPFIAALALERGKVKLNTPIDTGNGRMTIGTATISDTK-RHGVITMAQVVQKSSNIGTVK 362

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELP-EIQAPSYPSQ-WKRIHSLTISFGHGLSTTPL 450
           +A  +G +       +LG  + L    P E      P++ W+ I   T+S+GHG+ST+ +
Sbjct: 363 MAQQLGAEEMWHLFDQLGFGTPLNLGFPGETSGRLRPAKTWRPIEQATMSYGHGISTSLI 422

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRR 509
           Q A A      EG L+P    +   + +    R V   +T + MR++L      GG+  R
Sbjct: 423 QMARAYLVFAREGELVP--LSLTRVDGTPSSGRRVFSADTARQMRTVLAMAAGPGGTAIR 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A VPG+ V GKTGTA K+   RY+     +SF+   P +DP+ +V   +D P      Q 
Sbjct: 481 AQVPGYTVAGKTGTAHKLEDGRYARKY-ISSFVGFAPASDPRIVVAVMVDEPSA---GQH 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+   I   +   LGV P
Sbjct: 537 YGGTVAAPVFSRITEGTLRTLGVAP 561


>gi|295399709|ref|ZP_06809690.1| stage V sporulation protein D [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111772|ref|YP_003990088.1| stage V sporulation protein D [Geobacillus sp. Y4.1MC1]
 gi|294978112|gb|EFG53709.1| stage V sporulation protein D [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216873|gb|ADP75477.1| stage V sporulation protein D [Geobacillus sp. Y4.1MC1]
          Length = 646

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 165/565 (29%), Positives = 281/565 (49%), Gaps = 48/565 (8%)

Query: 71  KNRIGMTIVVCLVIYIILAIRI----IQYGNIHPEPIAPSMNID-EYGMSRPDIIDRNGE 125
           + R+ +  +V ++I+ I+ IR+    +  G++  E    S + +  +   R +I+DRNG 
Sbjct: 9   RKRLMIVFLVGVLIFAIIDIRLGYVQLIIGDMLTERAKNSWSRNIPFEPKRGEILDRNGV 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRKLS 183
            +AT++   ++YV P ++ +P E  EKL   L N+  E   R ++ +T  + +   RK+S
Sbjct: 69  PIATNMSAPTVYVIPRQIENPAETAEKLAKAL-NMPVEKAYRHITKKTSIERIPEGRKIS 127

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
            ++   I + GL GV    +  R+YP  S+ SHV+G+  IDN+G+ G+E + D +     
Sbjct: 128 NEKANEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLMGLELYYDKELRGQR 187

Query: 239 GLTRVFTTNKGEK--NLQP----------IRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G  + ++  KG++  N+            + L +D RIQ IV +EL   + KYN + +  
Sbjct: 188 GSVQFYSDAKGKRMPNMTDEYTPPTDGLDLMLTIDSRIQTIVERELDIAEAKYNPDGIIA 247

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR--ISYGIFEMGSIFKVFTIAMGIDS 344
           + +N +TGE+++M S P +DP   ++      +NR    +  +E GS FK+ T+A  ++ 
Sbjct: 248 IAMNPNTGEILAMASRPTFDPAN-YRNVPPEIYNRNLPVWSTYEPGSTFKIITLAAALEE 306

Query: 345 G-LFTVKDLFDTRNPIKVGKHVIHDYHPQNR-ILTIPEIFRYSSNIGAAQIADAMGIQGH 402
             +  + D F     +KV    +  +        T  E+ + S N G  ++   +G +  
Sbjct: 307 KKVDLLNDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGQRLGKEKL 366

Query: 403 KEFLYRLGLLSKLETELPEIQAPSYPSQWKRI---HSLTISFGHGLSTTPLQTAVAAAAL 459
            +++ + G   K   +L + +        KR+      T SFG G+S TP+Q   A +A 
Sbjct: 367 FDYIKQFGFGEKTGIDL-QGEGTGILFDLKRVGPVEQATTSFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSREESE----------KVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
           +N G L  P ++ +   + E          K  R V+ + T K +R  L   V  G+G+ 
Sbjct: 426 VNGGILYTP-YVAKQWVDPETGKVIIRNTPKAKRRVISEETSKQVRYALESVVAQGTGKG 484

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A+V G+ VGGKTGTAQK    RY       SF+   P  DPQ +V   +D+PK   +   
Sbjct: 485 AYVEGYRVGGKTGTAQKAKGGRYLTDNYIVSFIGFAPADDPQLVVYVAVDNPKGTVQ--- 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G+  AP+VG I+  S  +LGVKP
Sbjct: 542 FGGVVSAPIVGKIMGDSLRVLGVKP 566


>gi|289209367|ref|YP_003461433.1| peptidoglycan glycosyltransferase [Thioalkalivibrio sp. K90mix]
 gi|288944998|gb|ADC72697.1| Peptidoglycan glycosyltransferase [Thioalkalivibrio sp. K90mix]
          Length = 571

 Score =  208 bits (529), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 137/503 (27%), Positives = 250/503 (49%), Gaps = 39/503 (7%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISP----DEIIEKLQIVLPNLDSEMIRRKLSSET- 173
           + DRNGE LA   P  + +  P  ++       E+ E LQ+     D++ +  ++ S   
Sbjct: 63  VTDRNGEPLAISAPVQTAWANPKDLLEQRDRWPELAEALQV-----DADWLAERIESRAG 117

Query: 174 -KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            +F +LRR + P Q +++ +  + G+G   E  R+YP     SH++GY DID+RG  G+E
Sbjct: 118 REFMYLRRHMLPAQAEQVTALRIQGLGLTREFRRYYPHGETTSHILGYTDIDDRGQEGVE 177

Query: 233 -KFLDM----QGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENK 276
             F D      G  RV     G            ++ + +RL +D R+Q + ++EL    
Sbjct: 178 LAFNDWLSGAPGAKRVLRDRHGRTIRDVASIRPARDGRTLRLTIDQRLQYLAYRELKAAV 237

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
            +++A+    V+L+  TG+V++MV+ P ++P+     + E   NR      E GS+ K F
Sbjct: 238 AEHDAQGGSAVLLDARTGDVLAMVNQPSFNPNNRGSIRSELARNRSLTDSMEPGSVIKPF 297

Query: 337 TIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           T+A  +D+G+       DTR   ++VG+  + D+     ++ +  +   SSN+GA ++A 
Sbjct: 298 TVAAALDAGIIDPNVTLDTRPGTMRVGRLTVRDFRDYG-VIDLTTLIARSSNVGATKLAL 356

Query: 396 AMGIQGHKEFLYRLGLLSKLETELP-EIQA--PSYPSQWKRIHSLTISFGHGLSTTPLQT 452
            +      + L++ G      T  P E+      +P+ W+ +   T+ +G+GLS TPLQ 
Sbjct: 357 DLPPDRFWQVLHQAGFGQSTGTHFPGEVSGRLRDFPT-WREVEQATMGYGYGLSITPLQM 415

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAF 511
           A A  A  N+G+ IP   +  + +  E     V+   T + + +++   + + G+ R+A 
Sbjct: 416 AAAYTAFANDGQRIPVRLVQTADDLREPAG--VMTPETAQRVLAMMEHTIGSEGTARQAA 473

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           + G+ + GKTGT++K     Y++    +SF+ + P +DP++++   +D P          
Sbjct: 474 IDGYRIAGKTGTSRKSGPGGYTEDRYISSFVGLAPASDPRFVMAVVIDEPNA---GTYFG 530

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G   AP+  N+I  +  M  V+P
Sbjct: 531 GAVAAPVFRNVIGSALRMFNVRP 553


>gi|91200079|emb|CAJ73122.1| similar to cell division protein FtsI [Candidatus Kuenenia
           stuttgartiensis]
          Length = 571

 Score =  207 bits (528), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 155/513 (30%), Positives = 245/513 (47%), Gaps = 39/513 (7%)

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I+DRNG  LA  +   S+Y  P  +     +   L  VL +L+   +  KL  + KF W+
Sbjct: 61  ILDRNGRKLAESLRVGSVYANPSAIKDVSLVASHLSKVL-HLNPSKVSAKLEKDKKFVWI 119

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R++S ++ K I    L GV    E  RFY      SHV+G+ DID  G+ GIE   +  
Sbjct: 120 KRRVSDEELKEIRKLSLQGVYIEHEYQRFYQNGPLGSHVIGFTDIDENGLEGIELSCNQA 179

Query: 239 -----GLTRVF------------TTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
                G  R++            T  +  ++   + L +D  IQ    +EL    K ++ 
Sbjct: 180 LQGEPGYKRMYRDAQQSNILTADTEMRRPRHGNNVMLTIDANIQRFAEEELENLDKTWSP 239

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            S   +++++STGE+++M ++P YD +   K       N      +E GSI K   +A  
Sbjct: 240 ASATAIVMDISTGEILAMANLPAYDLNNVGKYPARARKNLAVTDYYEPGSIIKPIVLAGI 299

Query: 342 IDSGLFTVKDLFDTRNPIKV-GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
            ++ L    D+ +  N   V GK ++HD H  +  LT+ EI  +SSNIG A++   MGI+
Sbjct: 300 FENKLARPNDMINCENGRYVMGKRILHDSHRYD-TLTVAEIVTHSSNIGMAKLGMRMGIE 358

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSL-TISFGHGLSTTPLQTAVAAA 457
                L +    +K   EL   Q   +     W +  SL ++S GH ++ TPLQ     +
Sbjct: 359 RMYRHLEQFNFGNKSGIELSGEQGGIFRPMKSWSKQFSLVSVSIGHEIAATPLQFVTIFS 418

Query: 458 ALINEGRLIPPTFMI-------RSREE---SEKVSRIVLKKNTVKTMRSLLREGVTGGSG 507
           ++ N G L+ P  +        + +EE    + V R++ ++     +  +L + V  G+G
Sbjct: 419 SIANGGLLLKPVIIKSITGNDGKVKEEYPVPQVVRRVMSEEVARDLLNPILVDVVRNGTG 478

Query: 508 RRAFVPGFEVGGKTGTAQKVIKK--RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +RAF+  +EV GKTGT+QKV K   RYS      SF+A  P  +P+  VL   D PK   
Sbjct: 479 KRAFLAEYEVAGKTGTSQKVNKSDGRYSRNKYIASFVAYAPADNPRICVLIMADEPK--- 535

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
                 G   AP V  II+++   L V+P+ LK
Sbjct: 536 -GAYYGGTVAAPSVREIIKKTLQYLEVEPLKLK 567


>gi|121611473|ref|YP_999280.1| peptidoglycan glycosyltransferase [Verminephrobacter eiseniae
           EF01-2]
 gi|121556113|gb|ABM60262.1| peptidoglycan synthetase FtsI [Verminephrobacter eiseniae EF01-2]
          Length = 580

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 147/505 (29%), Positives = 251/505 (49%), Gaps = 33/505 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVI--SPDEIIEKLQIV-LPNLDSEMIRRKLSS 171
           +R  I+DRNG +LA+ +P  S++  P  V+  SP +  +  Q+  L ++    +++KL+ 
Sbjct: 68  NRGRILDRNGLLLASSVPAASIWAIPEDVLQDSPADRAKLGQLAGLLDMPQAELQKKLAD 127

Query: 172 ETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITG 230
           E K F W++R+L  +Q +RI +  + G+  R E  R YP    A+HVVG+ +++++G  G
Sbjct: 128 EDKSFVWIKRQLDWEQGQRIAALDIKGIYQRKEYKRQYPEGEAAAHVVGFTNVEDQGQEG 187

Query: 231 IEKFLDM-----QGLTRVFTTNKGE------KNLQPI-----RLALDLRIQNIVHQELVE 274
           +E   D       G  RV     G       + + P+     +L++D ++Q   +Q+L +
Sbjct: 188 VELAFDALLAGKAGSRRVIKDRFGRVVEGVGETMPPVDGRDMQLSIDSKVQFFAYQKLRD 247

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
               + A++   V+L+  TGEV+++ + P Y P +      E   NR    +FE GS  K
Sbjct: 248 QVMAHKAKAGSVVVLDAHTGEVLALANYPSYLPEQRQGLSGEQLRNRALTDVFEPGSTIK 307

Query: 335 VFTIAMGIDSGLFTVKDLFDTR-NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNI