PSIBLAST alignment of GI: 254781103 and protein with PDB id: 3equ

>gi|209870566|pdb|3EQU|A Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Length = 542
>gi|209870567|pdb|3EQU|B Chain B, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Length = 542
 Score =  344 bits (881), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 142/533 (26%), Positives = 244/533 (45%), Gaps = 33/533 (6%)

Query: 86  IILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVIS 145
             L ++ + Y  +  +     +       +R  + DRNG +LA   PT SL+  P     
Sbjct: 6   RGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPTESLFAVPKDXKE 65

Query: 146 PDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQWLRRKLSPQQQKRILSFGLPGVGFRL 202
                  E+L   L ++  +++R KL  +   F W++R+L P+  + + + GL    F  
Sbjct: 66  XPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEK 124

Query: 203 EKSRFYPAASHASHVVGYVDIDNRGITGIEKF-----LDMQGLTRVFTTNKG-------- 249
           E  R YP  +  +HV+G+ DID +G  G+E           G   V    +G        
Sbjct: 125 ELKRHYPXGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLRDRQGNIVDSLDS 184

Query: 250 -----EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
                 +N + I L+LD RIQ + ++EL +  + + A++   V+L+  TGE++++ + P 
Sbjct: 185 PRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPA 244

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKH 364
           YDP+   +   E   NR      E GS  K F IA  +D+G   + +  +T+        
Sbjct: 245 YDPNRPGRADSEQRRNRAVTDXIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKI--GP 302

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
                      L +  I + SSN+G ++++   G +   +F + LG+  +  +  P   A
Sbjct: 303 SPVRDTHVYPSLDVRGIXQKSSNVGTSKLSARFGAEEXYDFYHELGIGVRXHSGFPGETA 362

Query: 425 PSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS 482
               +   W+ I   T SFG+GL  + LQ A A  AL ++G L+P +F    ++      
Sbjct: 363 GLLRNWRRWRPIEQATXSFGYGLQLSLLQLARAYTALTHDGVLLPLSF---EKQAVAPQG 419

Query: 483 RIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
           + + K+ T + +R+L       GG+G    V GF+VG KTGTA+K +  RY+D  +  +F
Sbjct: 420 KRIFKEXTAREVRNLXVSVTEPGGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHVATF 479

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           +   P  +P+ IV   +D P     +    G+   P    I   S ++LG+ P
Sbjct: 480 IGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGPPFKKIXGGSLNILGISP 529