BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781103|ref|YP_003065516.1| penicillin-binding
transmembrane protein [Candidatus Liberibacter asiaticus str. psy62]
         (598 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040780|gb|ACT57576.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 598

 Score =  521 bits (1342), Expect = e-145,   Method: Composition-based stats.
 Identities = 598/598 (100%), Positives = 598/598 (100%)

Query: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60
           MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ
Sbjct: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII
Sbjct: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR
Sbjct: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
           KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL
Sbjct: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
           TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV
Sbjct: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK
Sbjct: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
           VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP
Sbjct: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK
Sbjct: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
           VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS
Sbjct: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK
Sbjct: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598


>gi|239832315|ref|ZP_04680644.1| Penicillin-binding protein 2 [Ochrobactrum intermedium LMG 3301]
 gi|239824582|gb|EEQ96150.1| Penicillin-binding protein 2 [Ochrobactrum intermedium LMG 3301]
          Length = 604

 Score =  433 bits (1113), Expect = e-119,   Method: Composition-based stats.
 Identities = 270/567 (47%), Positives = 382/567 (67%), Gaps = 4/567 (0%)

Query: 35  SFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQ 94
             +NM++G+ +   G     G   F   R+K    ++NR+ M I   + IY ++  ++I 
Sbjct: 7   RKKNMQAGNGVEPVGDEKLAGNMAFVGSRKKHGNRARNRLWMAIACFVGIYGVMGGKLIY 66

Query: 95  YGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQ 154
           +G I  E    +    +   SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L 
Sbjct: 67  FGVIGGENEDNAGPAVQQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLS 126

Query: 155 IVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHA 214
            VLP+LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    A
Sbjct: 127 TVLPDLDWEATYKRLKSGAGFVWVKRGLTPRQQSQIMALGVPGIGFRTEKRRFYPGGPTA 186

Query: 215 SHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELV 273
           SH++G V++DN+GI G+EK++D QGLT + +      ++L+P+RL++D+R+Q+I+   LV
Sbjct: 187 SHILGLVNVDNQGIAGMEKYIDSQGLTDLRSVGLATGQSLEPVRLSIDIRVQHIMRDVLV 246

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
           +  ++Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  
Sbjct: 247 KAMERYRAIAAGAVVLNVKTGEVIAMASVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTI 306

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FT AM +DSG F +    D   P+  G+  I D+H + R+LT+PE+F +SSNIG+ + 
Sbjct: 307 KSFTTAMALDSGKFNLNSRLDASRPLVFGRQTIRDFHGKGRVLTLPEVFIFSSNIGSGRE 366

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTA 453
           ADA+GI+GH+ FL ++GLL +L+TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTA
Sbjct: 367 ADAVGIEGHRAFLKKIGLLDRLQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTA 426

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAF 511
           V AAAL+N G+L+PPTF+ R++ E+++V++ ++       MR L  L     GGSG+RA 
Sbjct: 427 VGAAALMNGGKLMPPTFLTRTQAEADQVAKQIIHPQVSADMRYLYRLNATAQGGSGKRAT 486

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLT 570
           VPG+ VGGKTGTA+KV+  RYS  + FN+FLA FP  DP Y+VL+ +D PK +E     T
Sbjct: 487 VPGYRVGGKTGTAEKVVHGRYSKDVRFNAFLASFPMDDPTYVVLTIIDEPKPEEGKFSAT 546

Query: 571 AGINVAPMVGNIIRRSASMLGVKPVFL 597
           AG+N APMV  IIRRSAS LGVKP F 
Sbjct: 547 AGLNAAPMVSEIIRRSASFLGVKPDFQ 573


>gi|296133665|ref|YP_003640912.1| stage V sporulation protein D [Thermincola sp. JR]
 gi|296032243|gb|ADG83011.1| stage V sporulation protein D [Thermincola potens JR]
          Length = 706

 Score =  426 bits (1096), Expect = e-117,   Method: Composition-based stats.
 Identities = 143/560 (25%), Positives = 249/560 (44%), Gaps = 38/560 (6%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNG 124
            + RI    ++     + L  R+     ++      E +   M+  +    R  I DRNG
Sbjct: 7   MRKRITQLFLIMGAFLLFLIGRLAWIQFVNGDKLSTEALENRMDDIKVPAKRGTIYDRNG 66

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
           + L   I + ++Y  P ++  P E  +KL  +L  L  E I +K++  + F +++RK+ P
Sbjct: 67  KELVISISSDTVYAIPPEIKKPAETAKKLAEIL-GLKYEDIYKKITKRSNFVYIQRKVDP 125

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----G 239
           +  K+I    LPG+    E  R YP  + ASHV+G+V IDN G+ GIE  ++ +     G
Sbjct: 126 EISKKIKKLELPGIDIVEESQRSYPNGNLASHVLGFVGIDNYGLNGIEVTMEKELAGVPG 185

Query: 240 LTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
              +   + G             +    + L +D  IQ  V +EL    + YN +S   +
Sbjct: 186 RILIEKDSLGREIPQALHQYKPPQPGNSLVLTIDETIQYFVERELDNIVETYNPKSATII 245

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           ++   TG +++M + PD++P++  +  +  W N   +  +E GS FKV T A  ++ G+ 
Sbjct: 246 VMEPKTGGILAMGNRPDFNPNKYGEYPQTSWRNPAIWLNYEPGSTFKVITAAAALEEGVV 305

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
             +  F       V    I  +     +   +  E+ + S N G  Q+   +G +   ++
Sbjct: 306 KPESRFYDPGYAVVSGERIKCWRYPRAHGSQSFEEVAQNSCNPGFIQVGLDLGRERFYKY 365

Query: 406 LYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           +   G   K    L          + +   I+  TIS G  +S TP+Q   A +A+ N+G
Sbjct: 366 IKAFGFGQKTGIPLVGEAKGIVIPEKQVKNINLATISIGQSISVTPIQLITAISAVANDG 425

Query: 464 RLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
            L+ P  +   R+           +  R V+ ++T + +  +L + V+ G+G+ A++  +
Sbjct: 426 VLMKPQLVKEIRDSQGHLVRKIEPEPVRQVISRSTARQLAGILEKVVSQGTGKNAYMEEY 485

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
              GKTGTAQK  K  YS      SF    P  +PQ  +L  +D P+         G   
Sbjct: 486 PAAGKTGTAQKAGKGGYSSGKYIASFAGFAPVENPQVAILVVIDEPQ---GGTYYGGQIA 542

Query: 576 APMVGNIIRRSASMLGVKPV 595
           AP+  N+ R     L V+P 
Sbjct: 543 APVFKNVARDVLRYLNVRPR 562


>gi|153009068|ref|YP_001370283.1| peptidoglycan glycosyltransferase [Ochrobactrum anthropi ATCC
           49188]
 gi|151560956|gb|ABS14454.1| Peptidoglycan glycosyltransferase [Ochrobactrum anthropi ATCC
           49188]
          Length = 594

 Score =  424 bits (1091), Expect = e-116,   Method: Composition-based stats.
 Identities = 266/563 (47%), Positives = 377/563 (66%), Gaps = 4/563 (0%)

Query: 39  MESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI 98
           M++   +   G     G   F   R+K    ++NR+ M I   + IY ++  ++I +G I
Sbjct: 1   MQADDGVEPVGDEKLAGNMAFVGSRKKHGNRARNRLWMAIACFVGIYGVMGGKLIYFGVI 60

Query: 99  HPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
             E    +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP
Sbjct: 61  GGENEDNAGPAVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLP 120

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
           +LD E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++
Sbjct: 121 DLDWEATYKRLKSGAGFVWIKRGLTPRQQSQIMALGVPGIGFRTEKRRFYPGGPTASHIL 180

Query: 219 GYVDIDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKK 277
           G V++DN+GI G+EK++D QGLT + +      ++L+P+RL++D+R+Q+I+   LV+  +
Sbjct: 181 GLVNVDNQGIAGMEKYIDSQGLTDLRSVGLATGQSLEPVRLSIDIRVQHIMRDVLVKAME 240

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           +Y A + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT
Sbjct: 241 RYRAIAAGAVVLNVKTGEVIAMASVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFT 300

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
            AM +DSG F ++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+
Sbjct: 301 TAMALDSGKFNLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAV 360

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           GI+GH+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AA
Sbjct: 361 GIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAA 420

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGF 515
           AL+N G+L+ PTF++R++ ++++V++ V+       MR L  L     GGSG+RA VPG+
Sbjct: 421 ALMNGGKLMEPTFLMRTQAQADQVAKQVIHPQVSADMRYLYRLNATAQGGSGKRATVPGY 480

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGIN 574
            VGGKTGTA+KV+  RYS  + FN+FLA FP  DP Y+VL+ +D PK +E     TAG+N
Sbjct: 481 RVGGKTGTAEKVVHGRYSKDVRFNAFLASFPMDDPTYVVLTIIDEPKPEEGKFSATAGLN 540

Query: 575 VAPMVGNIIRRSASMLGVKPVFL 597
            APMV  IIRRSAS LGVKP F 
Sbjct: 541 AAPMVSEIIRRSASFLGVKPDFQ 563


>gi|227822657|ref|YP_002826629.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234]
 gi|227341658|gb|ACP25876.1| penicillin-binding protein 3 [Sinorhizobium fredii NGR234]
          Length = 582

 Score =  421 bits (1081), Expect = e-115,   Method: Composition-based stats.
 Identities = 293/566 (51%), Positives = 401/566 (70%), Gaps = 6/566 (1%)

Query: 35  SFRNMESGHNLCQKGCHMEDGQDL-FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRII 93
           S  +  +G N        E G ++ FQ  R+K  + +++R+ + I    + Y ++  R++
Sbjct: 12  SKAHFSAGGN----NRPGEAGVNVTFQGTRKKNASQARSRVAIVIASFGIAYAVIGGRLV 67

Query: 94  QYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKL 153
           QYG   PE ++     D    SRPDI+DRNGEILATDI T SLY EPHK++  DE +E+L
Sbjct: 68  QYGVAQPETVSSIGRADNLMASRPDILDRNGEILATDIRTVSLYAEPHKIVDADEAVERL 127

Query: 154 QIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASH 213
             VLP+L++  I  KL S ++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RFYP    
Sbjct: 128 ATVLPDLNAREIYNKLKSNSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRFYPGGPT 187

Query: 214 ASHVVGYVDIDNRGITGIEKFLDMQGLTRVF-TTNKGEKNLQPIRLALDLRIQNIVHQEL 272
           A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P++L++D+R+QNIV   +
Sbjct: 188 AAHILGHVNIDNRGVAGMERYIDSQGLADLAAIGMTSDAKLEPVKLSIDVRVQNIVRDVI 247

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               K Y A + G V+++V TGEV++M S+PDYDP++  +G +EGW NR+S G FEMGS 
Sbjct: 248 DSGMKNYQAIAAGAVVMDVHTGEVLAMASVPDYDPNKPAEGAEEGWMNRMSNGTFEMGST 307

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
           FK FTIAMG+DSG  T+   FD   PI++G   I D+H + R+LT+PEIF+YSSNIG A+
Sbjct: 308 FKTFTIAMGLDSGKVTLNSSFDATAPIRIGGFTIKDFHGKRRVLTVPEIFQYSSNIGTAK 367

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQT 452
           +AD +GI GHKEFL RLGLLSKL TELPE++ P+ P +WK+I+S+TISFGHG+STTPLQT
Sbjct: 368 VADLVGIPGHKEFLTRLGLLSKLPTELPEVKTPTQPREWKKINSITISFGHGVSTTPLQT 427

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           AVA AAL+N G+LIPPTF+ R+ E + +++  V+KK+T   MR LLR     GSG+RA V
Sbjct: 428 AVAGAALVNGGKLIPPTFLPRTEEAANELATAVVKKSTSDDMRFLLRWNGIAGSGKRALV 487

Query: 513 PGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           PGF VGGKTGTA KV+  RY +  NFN+FLA FP  DP+YIVL+F+D+PK  E    TAG
Sbjct: 488 PGFNVGGKTGTADKVVNGRYVNDQNFNAFLAAFPIDDPKYIVLTFIDAPKTGEGGGRTAG 547

Query: 573 INVAPMVGNIIRRSASMLGVKPVFLK 598
            N APMV +II RSA +LGV+P F +
Sbjct: 548 SNAAPMVRDIISRSAPLLGVEPKFGE 573


>gi|15965935|ref|NP_386288.1| penicillin-binding transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|307308245|ref|ZP_07587954.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C]
 gi|307319712|ref|ZP_07599137.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83]
 gi|15075204|emb|CAC46761.1| Probable peptidoglycan synthetase FtsI [Sinorhizobium meliloti
           1021]
 gi|306894643|gb|EFN25404.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti AK83]
 gi|306901243|gb|EFN31849.1| Peptidoglycan glycosyltransferase [Sinorhizobium meliloti BL225C]
          Length = 582

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 294/565 (52%), Positives = 402/565 (71%), Gaps = 4/565 (0%)

Query: 35  SFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQ 94
           S  +  +G N       +      F+  R+K  + +K+R+ + I    ++Y ++  R++Q
Sbjct: 12  SKAHFSAGGNNRPADSGL---NVAFEGTRKKSASRAKSRVAIIIASFGLVYAVIGGRLVQ 68

Query: 95  YGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQ 154
           YG   PE ++     D    SRPDI+DRNGE+LATDI T SLY EPHK++  DE +E+L 
Sbjct: 69  YGLAQPETVSSIGRADSLMASRPDILDRNGEVLATDIRTVSLYAEPHKIVDADEAVERLA 128

Query: 155 IVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHA 214
            VLP+L++  I  KL S ++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RFYP    A
Sbjct: 129 TVLPDLNAREIYNKLKSNSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRFYPGGPTA 188

Query: 215 SHVVGYVDIDNRGITGIEKFLDMQGLTRVF-TTNKGEKNLQPIRLALDLRIQNIVHQELV 273
           +H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P+RL++D+R+QNIV   + 
Sbjct: 189 AHILGHVNIDNRGVAGMERYIDEQGLADLAAIGMTSDAKLEPVRLSIDVRVQNIVRDVID 248

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
              K Y A + G V+L+V TGEV++M S+PDYDP+   +G +EGW NR+S G FEMGS F
Sbjct: 249 AGMKNYQAIAAGAVVLDVHTGEVLAMASVPDYDPNRPAEGAEEGWMNRMSNGTFEMGSTF 308

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K FTIAMG+DSG  T+ D FD   PI++G   I D+H + R+LT+PEIF+YSSNIG A+I
Sbjct: 309 KTFTIAMGLDSGKVTLNDSFDATAPIRIGGFTIKDFHGKRRVLTVPEIFQYSSNIGTAKI 368

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTA 453
           AD +GI GHKEFL R+GLL++L TELPE++APS P +WK+I+S+TISFGHG+STTPLQTA
Sbjct: 369 ADLIGIPGHKEFLTRIGLLTRLPTELPEVKAPSQPREWKKINSITISFGHGVSTTPLQTA 428

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
           VA AAL+N G+LIPPTF+ RS E + +++  V+KK+T + MR LLR     GSG+RA VP
Sbjct: 429 VAGAALVNGGKLIPPTFLPRSEEAASELASAVVKKSTSEDMRYLLRWNGIAGSGKRALVP 488

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           GF VGGKTGTA KV+  RY+  LNFN+FLA FP  DP+Y+VL+F+D+PK  E    TAG 
Sbjct: 489 GFNVGGKTGTADKVVNGRYASDLNFNAFLAAFPIDDPKYMVLTFIDAPKTGEGGGRTAGS 548

Query: 574 NVAPMVGNIIRRSASMLGVKPVFLK 598
           N APMV +II RSA +LGV+P F +
Sbjct: 549 NAAPMVRDIISRSAPLLGVEPKFGE 573


>gi|261419311|ref|YP_003252993.1| stage V sporulation protein D [Geobacillus sp. Y412MC61]
 gi|319766127|ref|YP_004131628.1| stage V sporulation protein D [Geobacillus sp. Y412MC52]
 gi|261375768|gb|ACX78511.1| stage V sporulation protein D [Geobacillus sp. Y412MC61]
 gi|317110993|gb|ADU93485.1| stage V sporulation protein D [Geobacillus sp. Y412MC52]
          Length = 644

 Score =  418 bits (1075), Expect = e-114,   Method: Composition-based stats.
 Identities = 154/565 (27%), Positives = 265/565 (46%), Gaps = 42/565 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ +  ++ ++I+ I+ +R+        + +A            +   R +I+DRN
Sbjct: 7   TVRKRLTIVFLIGILIFAIIDLRLGYVQFWLGDLLAERAKGLWGRNIPFEPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR--RK 181
           G  LAT++   ++YV P +V +P E  +KL  VL     E I ++++ +T    L+  RK
Sbjct: 67  GVPLATNMSAPTVYVIPRQVKNPAEAAKKLAGVLGG-SVESIYKQITQKTSIVRLKEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++   + S  L GV    +  R+YP  S+ SHV+G+  IDN+G+TG+E + D +   
Sbjct: 126 ISDEKAANVRSLDLDGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYDKELRG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + ++  KG +            +   + L +D RIQ I+ +EL   + KYN + +
Sbjct: 186 ERGSVQFYSDAKGRRMPDIADDYTPPTDGLNLVLTIDSRIQTIIERELDIAEAKYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + ++ +TGE+++M S P ++P +      E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMDPNTGEILAMASRPTFNPADYRSVPPEIYNRNLPIWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
                      FD       G  +       +   T  E+ + S N G  ++ + +G + 
Sbjct: 306 EHKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGDQTFLEVVQNSCNPGFVELGERLGKET 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
              ++ + G   K   +L            +   +   T +FG G+S TP+Q   A +A 
Sbjct: 366 LFRYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           IN G L  P    +  +          + K  R V+ + T K +R  L   V  G+G++A
Sbjct: 426 INGGILYTPYIAKQWVDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQGTGKKA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           +V G+ VGGKTGTAQK    RY    +  SF+   P  DP+ +V   +D+PK   +    
Sbjct: 486 YVEGYRVGGKTGTAQKAQGGRYLPNNHIVSFIGFAPADDPKLVVYVAVDNPKGTVQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G   AP+VG I+  S   LGVKP 
Sbjct: 543 GGTVAAPIVGKIMEDSLRTLGVKPR 567


>gi|297530719|ref|YP_003671994.1| stage V sporulation protein D [Geobacillus sp. C56-T3]
 gi|297253971|gb|ADI27417.1| stage V sporulation protein D [Geobacillus sp. C56-T3]
          Length = 644

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 154/564 (27%), Positives = 265/564 (46%), Gaps = 42/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ +  ++ ++I+ I+ +R+        + +A            +   R +I+DRN
Sbjct: 7   TVRKRLTIVFLIGILIFAIIDLRLGYVQFWLGDLLAERAKGLWGRNIPFEPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR--RK 181
           G  LAT++   ++YV P +V +P E  +KL  VL     E I ++++ +T    L+  RK
Sbjct: 67  GVPLATNMSAPTVYVIPRQVKNPAEAAKKLAGVLGG-SVESIYKQITQKTSIVRLKEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++   + S  L GV    +  R+YP  S+ SHV+G+  IDN+G+TG+E + D +   
Sbjct: 126 ISDEKAANVRSLDLDGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYDKELRG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + ++  KG +            +   + L +D RIQ I+ +EL   + KYN + +
Sbjct: 186 ERGSVQFYSDAKGRRMPDIADDYTPPTDGLNLVLTIDSRIQTIIERELDIAEAKYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + ++ +TGE+++M S P ++P +      E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMDPNTGEILAMASRPTFNPADYRSVPPEIYNRNLPIWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
                      FD       G  +       +   T  E+ + S N G  ++ + +G + 
Sbjct: 306 EHKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGDQTFLEVVQNSCNPGFVELGERLGKET 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
              ++ + G   K   +L            +   +   T +FG G+S TP+Q   A +A 
Sbjct: 366 LFRYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           IN G L  P    +  +          + K  R V+ + T K +R  L   V  G+G++A
Sbjct: 426 INGGILYTPYIAKQWVDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQGTGKKA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           +V G+ VGGKTGTAQK    RY    +  SF+   P  DP+ +V   +D+PK   +    
Sbjct: 486 YVEGYRVGGKTGTAQKAQGGRYLPNNHIVSFIGFAPADDPKLVVYVAVDNPKGTVQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
            G   AP+VG I+  S   LGVKP
Sbjct: 543 GGTVAAPIVGKIMEDSLRTLGVKP 566


>gi|56419649|ref|YP_146967.1| sporulation specific penicillin-binding protein [Geobacillus
           kaustophilus HTA426]
 gi|56379491|dbj|BAD75399.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Geobacillus kaustophilus HTA426]
          Length = 644

 Score =  418 bits (1074), Expect = e-114,   Method: Composition-based stats.
 Identities = 154/565 (27%), Positives = 265/565 (46%), Gaps = 42/565 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ +  ++ ++I+ I+ +R+        + +A            +   R +I+DRN
Sbjct: 7   TVRKRLTIVFLIGILIFAIIDLRLGYVQFWLGDLLAERAKGLWGRNIPFEPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR--RK 181
           G  LAT++   ++YV P +V +P E  +KL  VL     E I ++++ +T    L+  RK
Sbjct: 67  GVPLATNMSAPTVYVIPRQVKNPAEAAKKLAGVLGG-SIESIYKQITQKTSIVRLKEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++   + S  L GV    +  R+YP  S+ SHV+G+  IDN+G+TG+E + D +   
Sbjct: 126 ISDEKAANVRSLDLDGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYDKELRG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + ++  KG +            +   + L +D RIQ I+ +EL   + KYN + +
Sbjct: 186 ERGSVQFYSDAKGRRMPDIADDYTPPTDGLNLVLTIDSRIQTIIERELDIAEAKYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + ++ +TGE+++M S P ++P +      E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMDPNTGEILAMASRPTFNPADYRSVPPEIYNRNLPIWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
                      FD       G  +       +   T  E+ + S N G  ++ + +G + 
Sbjct: 306 EHKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGDQTFLEVVQNSCNPGFVELGERLGKET 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
              ++ + G   K   +L            +   +   T +FG G+S TP+Q   A +A 
Sbjct: 366 LFRYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           IN G L  P    +  +          + K  R V+ + T K +R  L   V  G+G++A
Sbjct: 426 INGGILYTPYIAKQWVDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQGTGKKA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           +V G+ VGGKTGTAQK    RY    +  SF+   P  DP+ +V   +D+PK   +    
Sbjct: 486 YVEGYRVGGKTGTAQKAQGGRYLQNNHIVSFIGFAPADDPKLVVYVAVDNPKGTVQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G   AP+VG I+  S   LGVKP 
Sbjct: 543 GGTVAAPIVGKIMEDSLRTLGVKPR 567


>gi|150397289|ref|YP_001327756.1| peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419]
 gi|150028804|gb|ABR60921.1| Peptidoglycan glycosyltransferase [Sinorhizobium medicae WSM419]
          Length = 582

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 293/568 (51%), Positives = 403/568 (70%), Gaps = 10/568 (1%)

Query: 35  SFRNMESGHNLCQKGCHMEDG---QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIR 91
           S  +  +G      G H          F+  R++  + +K+R+ + I    V+Y ++  R
Sbjct: 12  SKAHFSAG------GDHRTTDGGLNVTFEGTRKRSASRAKSRVAIMIASFGVVYAVIGGR 65

Query: 92  IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE 151
           ++QYG   PE ++     D    SRPDI+DRNGE+LATDI T SLY EPHK++  DE +E
Sbjct: 66  LVQYGLAQPETVSSIGRADTLMASRPDILDRNGEVLATDIRTVSLYAEPHKIVDADEAVE 125

Query: 152 KLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAA 211
           +L  VLP+L++  I  KL S+++FQWLRR+L+P+QQ  IL+ G+PG+GFR EK RFYP  
Sbjct: 126 RLATVLPDLNAREIYNKLKSDSRFQWLRRQLTPKQQSEILALGIPGIGFRPEKRRFYPGG 185

Query: 212 SHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF-TTNKGEKNLQPIRLALDLRIQNIVHQ 270
             A+H++G+V+IDNRG+ G+E+++D QGL  +       +  L+P+RL++D+R+QNIV  
Sbjct: 186 PTAAHILGHVNIDNRGVAGMERYIDEQGLADLAAIGMTSDAKLEPVRLSIDVRVQNIVRD 245

Query: 271 ELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG 330
            +    K Y A + G V+L+V TGEV++M S+PDYDP+   +G +EGW NR+S G FEMG
Sbjct: 246 VVDSGMKNYEAIAAGAVVLDVHTGEVLAMASVPDYDPNRPAEGAEEGWMNRMSNGTFEMG 305

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA 390
           S FK FTIAMG+DSG  T+ D FD   PI++G   I D+H + R+LT+PEIF+YSSNIG 
Sbjct: 306 STFKTFTIAMGLDSGKVTLNDSFDATRPIRIGGFTIKDFHGKRRVLTVPEIFQYSSNIGT 365

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPL 450
           A+IAD +GI GHKEFL R+GLL++L TELPE+++PS P +WK+I+S+TISFGHG+STTPL
Sbjct: 366 AKIADLIGIPGHKEFLTRMGLLTRLPTELPEVKSPSQPREWKKINSITISFGHGVSTTPL 425

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           QTAVA AAL+N G+LIPP+F+ RS EE+ +++  V+KK+T   MR LLR     GSG+RA
Sbjct: 426 QTAVAGAALVNGGKLIPPSFLPRSEEEASELASAVVKKSTSDDMRYLLRRNGIAGSGKRA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
            VPGF VGGKTGTA KV+  RY+  LNFN+FLA FP  +P+Y+VL+F+D+PK  E    T
Sbjct: 486 LVPGFNVGGKTGTADKVVNGRYASDLNFNAFLAAFPIDNPKYMVLTFIDAPKTGEGGGRT 545

Query: 571 AGINVAPMVGNIIRRSASMLGVKPVFLK 598
           AG N APMV +II RSA +LGV+P F +
Sbjct: 546 AGSNAAPMVRDIISRSAPLLGVEPKFGE 573


>gi|138894649|ref|YP_001125102.1| stage V sporulation protein D [Geobacillus thermodenitrificans
           NG80-2]
 gi|196247741|ref|ZP_03146443.1| stage V sporulation protein D [Geobacillus sp. G11MC16]
 gi|134266162|gb|ABO66357.1| Stage V sporulation protein D [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212525|gb|EDY07282.1| stage V sporulation protein D [Geobacillus sp. G11MC16]
          Length = 644

 Score =  414 bits (1065), Expect = e-113,   Method: Composition-based stats.
 Identities = 152/565 (26%), Positives = 264/565 (46%), Gaps = 42/565 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ +  ++ + I+ I+ +R+        + +             +   R +I+DRN
Sbjct: 7   TVRKRLTIVFLIGIFIFAIIDLRLGYVQFWLSDMLTERAKGLWGRNIPFEPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR--RK 181
           G  LAT++   ++YV P +V +P E  EKL +VL     E I ++++ +T    L+  RK
Sbjct: 67  GVPLATNMSAPTVYVIPRQVKNPAEAAEKLSVVL-GASVESIYKQITQKTSIVRLKEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++   + +  L G+    +  R+YP  S+ SHV+G+  IDN+G+TG+E + D +   
Sbjct: 126 ISDEKAASVRALDLDGIYIAEDTKRYYPFGSYLSHVLGFSGIDNQGLTGLELYYDKELSG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + ++  KG +            +   + L +D RIQ I+ +EL   + KYN + +
Sbjct: 186 ERGSVQFYSDAKGRRMPGIADDYTPPTDGLDLVLTIDSRIQTIIERELDIAEAKYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + +N +TGE+++M S P +DP        E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMNPNTGEILAMASRPTFDPANYRDVPPEIYNRNLPIWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
            G         FD       G  +       +   T  E+ + S N G  ++ + +G + 
Sbjct: 306 EGKVNLLKDHFFDPGYAKVAGATLRCWKKGGHGEQTFLEVVQNSCNPGFVELGERLGKET 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +++ + G   K   +L            +   +   T +FG G+S TP+Q   A +A 
Sbjct: 366 LFKYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVELATTAFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           +N G L  P       +          + K  R V+ + T K +R  L   V  G+G++A
Sbjct: 426 VNGGVLYTPYIAKEWIDPETGEIVRRNTPKAKRRVISEETSKQVRYALESVVAQGTGKKA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           +V G+ VGGKTGTAQK    RY    +  SF+   P  DPQ +V   +D+PK   +    
Sbjct: 486 YVEGYRVGGKTGTAQKAQGGRYLQNNHIVSFIGFAPADDPQLVVYVAVDNPKGTVQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G   AP+VG ++  S  ++ VKP 
Sbjct: 543 GGTVAAPIVGKVMEDSLRVMNVKPR 567


>gi|323701282|ref|ZP_08112957.1| stage V sporulation protein D [Desulfotomaculum nigrificans DSM
           574]
 gi|323533884|gb|EGB23748.1| stage V sporulation protein D [Desulfotomaculum nigrificans DSM
           574]
          Length = 712

 Score =  410 bits (1053), Expect = e-112,   Method: Composition-based stats.
 Identities = 127/558 (22%), Positives = 240/558 (43%), Gaps = 39/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIA-----PSMNIDEYGMSRPDIIDRNGE 125
           + RI    ++   +  +L +R+     +  + +        M        R  I+DRNG 
Sbjct: 9   RRRITWLFLLGSALLCMLILRLAWIQFVRGDELRQQGIINRMRDVPVEAKRGSILDRNGN 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
            L T +   S+Y  P  + +PDE   K+  +L  +D   +++ ++ +++F+W++RK+  +
Sbjct: 69  ELVTSVSADSVYAIPSHIENPDEAAAKIAPIL-GMDVAKVKQIITKKSRFEWIKRKVDFE 127

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             +++    + G+GF  E  R+Y   + A H++G+   DN+G+ G+E   D +     G 
Sbjct: 128 TSQKLKELKIAGIGFAEESRRYYKQETLAPHILGFTGTDNQGLMGMEAAYDEELKGIPGR 187

Query: 241 TRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
             +     G +                + L LD  IQ+ V +EL +    Y  +    ++
Sbjct: 188 IVIEHDAAGREIPQALHQYIPPVQGHNLVLTLDQTIQHFVERELDKIVSVYKPKMAVIIV 247

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           ++  TGEV+++ + P ++P++  +  +  W  +   +  +E GS FK+ T A  ++  + 
Sbjct: 248 MDPKTGEVLALGNRPTFNPNKWREVPQSVWDRDPAIWYNYEPGSTFKIITTAAALEENVV 307

Query: 348 TVKDLFDTRNPIKVGKHVIHDYH-PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
              D F      +V    I  +    +   +  E+ + S N G  Q+   +G +   +++
Sbjct: 308 KPSDRFYDPGYYQVADRKIRCWKAGGHGSQSFEEVVQNSCNPGFIQVGLNLGKERFYKYI 367

Query: 407 YRLGLLSKLETELPEIQAPSYPSQWKRIHS--LTISFGHGLSTTPLQTAVAAAALINEGR 464
              G        LP         +    +    T++ G  ++ TP+Q   A  A+ N G 
Sbjct: 368 QAFGFGQPTGIGLPGEARGIVIPEKDATNLNIATMAMGQSIAVTPIQLLTAVNAVANGGM 427

Query: 465 LIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFE 516
           L+ P  +    ++          +V R V+ K T      LL   V  GSGR A+V G+ 
Sbjct: 428 LMKPHLVKSIEDQKGHVIKEFKPEVVRQVISKETANLTAKLLENVVLKGSGRNAYVDGYR 487

Query: 517 VGGKTGTAQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
             GKTGTAQ V  +  Y+      SF    P  DP+  +L  +  P+         G+  
Sbjct: 488 AAGKTGTAQVVAERGGYASGKYVASFAGFAPVNDPKISILIMIAEPQ---GGSYYGGMVA 544

Query: 576 APMVGNIIRRSASMLGVK 593
           AP+  ++ + +   LGV 
Sbjct: 545 APVFSSLAQDTLHYLGVP 562


>gi|260893418|ref|YP_003239515.1| stage V sporulation protein D [Ammonifex degensii KC4]
 gi|260865559|gb|ACX52665.1| stage V sporulation protein D [Ammonifex degensii KC4]
          Length = 708

 Score =  409 bits (1050), Expect = e-112,   Method: Composition-based stats.
 Identities = 138/544 (25%), Positives = 235/544 (43%), Gaps = 35/544 (6%)

Query: 82  LVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPH 141
            +   +  ++I++   +  +     M        R DI DRNG +L T +   S+   P 
Sbjct: 23  CLAGRLFWLQIVKGAELQKQAQENRMRDIPVEAKRGDITDRNGRLLVTSVSAESVAAFPP 82

Query: 142 KVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFR 201
           ++  P ++  +L  +L  +  E ++  LS    F WL+RK+     ++I    L G+   
Sbjct: 83  QIKDPGKVAAELAPLL-EMPEEKLKEILSRRQAFVWLKRKVDYHTAQKIRKLRLEGIELY 141

Query: 202 LEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNKG------- 249
            E  R Y   S A+H++G+V +DN+G+ G+EK  D       G   +     G       
Sbjct: 142 EESRRQYICGSLAAHILGFVGVDNQGLLGVEKEYDQALRGVPGRIVIEQDAVGRDIPSAL 201

Query: 250 -----EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
                 +    + L +D  IQ+ V +EL +   +Y+  S   ++++  TGE++++ + P 
Sbjct: 202 HRFYPPRPGDKLVLTIDETIQHFVERELDKVVAQYHPASAVIIVMDPKTGEILALGNRPT 261

Query: 305 YDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           +DP    K   E W  N   + I+E GS FK+ T A  +  G+   +D F     IKV  
Sbjct: 262 FDPENWQKAPAEVWNRNLAIWQIYEPGSTFKIVTAAAALAEGVVRPEDHFYCPGYIKVAD 321

Query: 364 HVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
            +I  +    +   T  E+ + S N+G  Q+   +G +    ++   G       +LP  
Sbjct: 322 RIIRCWKDGGHGSETFAEVVQNSCNVGFIQVGLKLGKEKLYHYIRAFGFGKLTGIDLPGE 381

Query: 423 QAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
            +       +   ++  TIS G  +  TP+Q   AAAA+ N G L+ P  +        K
Sbjct: 382 ASGLLIPEDKVTNLNLATISIGQSVGVTPIQLITAAAAVANGGYLVRPHVVKAIVSPEGK 441

Query: 481 V--------SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV-IKKR 531
           V         R V+     + +  LL   V  G+G +A++ G+   GKTGTAQ V  K  
Sbjct: 442 VVKEFSSQPVRRVIPAQVARELCRLLENVVLKGTGVKAYLDGYRAAGKTGTAQVVSPKGG 501

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG 591
           Y       SF+   P  DP+ + L  +  P+         G   AP+   +++ +   LG
Sbjct: 502 YVPGKYVASFVGFAPVEDPRLVTLVVISEPQ----GAYYGGEVAAPVFKAVMQDALRYLG 557

Query: 592 VKPV 595
           V P 
Sbjct: 558 VPPQ 561


>gi|239826517|ref|YP_002949141.1| stage V sporulation protein D [Geobacillus sp. WCH70]
 gi|239806810|gb|ACS23875.1| stage V sporulation protein D [Geobacillus sp. WCH70]
          Length = 646

 Score =  408 bits (1049), Expect = e-111,   Method: Composition-based stats.
 Identities = 160/568 (28%), Positives = 267/568 (47%), Gaps = 42/568 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ +  +V + I+ I+ IR+     I  + +             +   R +I+DRN
Sbjct: 7   TVRKRLMIVFLVGVFIFAIIDIRLGYVQFILGDMLTERAKDSWSRNIPFEPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRK 181
           G  LAT++   ++YV P ++ +P E  EKL  VL N+  E   + ++ +T  + +   RK
Sbjct: 67  GVPLATNMSAPTVYVIPRQIENPAETAEKLAKVL-NMPVEKAYKHITKKTSIERIPEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++ K I + GL GV    +  R+YP  S+ SHV+G+  IDN+G+TG+E + D +   
Sbjct: 126 ISNEKAKEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYDKELSG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + ++  KG++            +   + L +D RIQ IV +EL   + KYN + +
Sbjct: 186 QRGSVQFYSDAKGKRMPNMADDYTPPTDGLNLVLTIDSRIQTIVERELDIAEAKYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + +N +TGE+++M S P +DP        E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMNPNTGEILAMASRPTFDPANYRTVPPEIYNRNLPIWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
                      +D       G  +       +   T  E+ + S N G  ++ + +G + 
Sbjct: 306 EKKVNLLKDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGERLGKER 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             E++ + G   K   +L            +   +   T +FG G+S TP+Q   A +A 
Sbjct: 366 LFEYIKKFGFGEKTGIDLQGEGTGILFDLKRVGPVEQATTAFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSREESE---------KVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           +N G L  P    +  +            K  R V+ + T K +R  L   V  G+G+ A
Sbjct: 426 VNGGILYTPYIAKQWVDPETGKVVSRNTLKAKRRVISEETSKQIRYALESVVAQGTGKGA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           +V G+ VGGKTGTAQK    RY    +  SF+   P  DPQ +V   +D+PK   +    
Sbjct: 486 YVEGYRVGGKTGTAQKAKGGRYLKDNHIVSFIGFAPADDPQLVVYVAVDNPKGTVQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPVFLK 598
            G+  AP+VG I+  S   LGVKP   +
Sbjct: 543 GGVVSAPIVGKIMEDSLRTLGVKPRKGQ 570


>gi|154245794|ref|YP_001416752.1| peptidoglycan glycosyltransferase [Xanthobacter autotrophicus Py2]
 gi|154159879|gb|ABS67095.1| Peptidoglycan glycosyltransferase [Xanthobacter autotrophicus Py2]
          Length = 614

 Score =  408 bits (1048), Expect = e-111,   Method: Composition-based stats.
 Identities = 219/529 (41%), Positives = 327/529 (61%), Gaps = 3/529 (0%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           ++ RI + +     ++I +A ++     I         + D    +RPDIIDRNG+I+A 
Sbjct: 66  ARGRIKLIMFAFCAVFIAIATQLSHLAIISDPGATRGRSTDAVSSARPDIIDRNGDIIAI 125

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           D+ + SL+ EP ++I PDE +E L  VLP+LD E  R++L+S   F WL+R+++P Q + 
Sbjct: 126 DVKSPSLFAEPRRLIDPDEALEGLLKVLPDLDVEESRKRLNSGKGFAWLKREITPAQMRA 185

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           I   GLPG+GF  E  R YP     SHV+G V++DN+GI+G+EK++D +GL  +      
Sbjct: 186 IHRLGLPGIGFLKENRRIYPDGPILSHVMGGVNVDNQGISGLEKYIDGRGLAELHLAGFA 245

Query: 250 -EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            +   +P+ L++D+R+Q+ V  EL+  K K++A     V+ +V+TGE+ISMVS+PD+DP+
Sbjct: 246 TDLQQEPVELSMDMRVQHAVRDELIRAKNKFSALHAMAVVTDVNTGEIISMVSLPDFDPN 305

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD 368
                K + + NR++ G+FEMGS FK  + AM +DSG   +   FD R  +  G+  I D
Sbjct: 306 VPGNPKDDAYLNRLTTGVFEMGSTFKALSFAMALDSGKIGLNSSFDARGAMHFGRFKISD 365

Query: 369 YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP 428
           YH +NR+LT+PEIF  SSN+G A++  ++G++ HK FL ++G L +L TELPE   P  P
Sbjct: 366 YHAENRVLTVPEIFLASSNVGTAKMVLSLGVEAHKAFLKKMGQLDRLRTELPESSEPIVP 425

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
            +W  ++S TI+FGHGLS  PLQ  +A  +++N G LI PTF+ R+ EE++KV+  VLK 
Sbjct: 426 KRWGELNSATIAFGHGLSVAPLQAVMAVNSMVNGGYLITPTFIKRTPEEAQKVAVRVLKP 485

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
            T   MR ++R     G+  +A VPG+ VGGKTGTA+KV+  RY+      SF A+FP  
Sbjct: 486 ETSDKMRYIMRLNAEKGTATKAEVPGYLVGGKTGTAEKVVNGRYAKNKLLTSFTAIFPMD 545

Query: 549 DPQYIVLSFMDSPKIKERNQLTA--GINVAPMVGNIIRRSASMLGVKPV 595
            P+Y+VL  +D PK        A  G N AP  G I+ R A +L + P 
Sbjct: 546 KPRYLVLVMLDEPKATSETYGFATSGWNAAPTAGKIVERIAPLLNIAPR 594


>gi|83589688|ref|YP_429697.1| stage V sporulation protein D [Moorella thermoacetica ATCC 39073]
 gi|83572602|gb|ABC19154.1| Stage V sporulation protein D [Moorella thermoacetica ATCC 39073]
          Length = 711

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 144/569 (25%), Positives = 241/569 (42%), Gaps = 48/569 (8%)

Query: 72  NRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
            R+ +  +V      I+ +R+          +  + +   +N       R  I DRN   
Sbjct: 9   KRLVLVFLVLTSCLAIILLRLAWLQFVRGGELQQKALNNRLNEMPVAAQRGVIYDRNRHE 68

Query: 127 LATDIPTFSLYVEPHKVIS---PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           LA  I +  +   P ++       EI   L  +L  L ++ I  K++S T F+++ R++ 
Sbjct: 69  LAVSIESDYIGAFPPEIKDSGKAQEIANTLGSIL-GLPAQKILEKITSNTGFEFVERQVD 127

Query: 184 PQQQKRILSF----GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ- 238
             + ++I +      LPG+    E  R+YP    A+ V+G+  IDN+G+ GIE   D + 
Sbjct: 128 YTKAQQIKNLVKEKKLPGIEVVPESRRYYPNGPLAAQVLGFSGIDNQGLEGIEAMYDKEL 187

Query: 239 ----GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKK-KYNA 281
               G   +     G             +N   + L +D  IQ I  +EL +      N 
Sbjct: 188 AGEPGKIVMEFDALGHEIPRATHRYIPPQNGHSLVLTIDQTIQYIAERELDKLMASPTNP 247

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
           +    ++++  TGE+++M S P +DP+   K     W N +    +E GS FK+ T A  
Sbjct: 248 KKANIIVMDPKTGEILAMASRPAFDPNNFNKYPNSVWGNPLVRDAYEPGSAFKIITAAAA 307

Query: 342 IDSGLFTVKDLFDTRNPIKVG-KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           ++ G+    D F     IKVG   +       +   T  +  + S N    Q A  +  +
Sbjct: 308 LEEGVVKPGDRFYDPGYIKVGPDTINCWLPGGHGSETFVDGVKNSCNPVFVQTALRLEEK 367

Query: 401 G---HKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHSLTISFGHGLSTTPLQTAVA 455
                  ++   G       +L          +   K I+  TI  G G++ TPLQ   A
Sbjct: 368 KAGLFYNYIRAFGFGQPTGIDLTGEGTGLLIPEQELKPINIATIGIGQGIAVTPLQLVTA 427

Query: 456 AAALINEGRLIPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGVTGGSG 507
            +A+ N G+LI P  +    ++          +V R V+   T K +R +L   V+ G+G
Sbjct: 428 VSAVANGGKLIRPHLVKEILDDKGNVLKKIEPEVERQVISPETAKQLREMLETVVSEGTG 487

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
           R A++PG+ VGGKTGTAQK     Y +     SF+ + P  DP+ + L  +D PK     
Sbjct: 488 RNAYIPGYRVGGKTGTAQKAGPGGYMEGKYVASFIGMAPVNDPRLVALVTIDEPKGYP-- 545

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPVF 596
               G   AP+   ++  +   L V P +
Sbjct: 546 -YYGGTLAAPIFQRVVADALHYLKVPPQY 573


>gi|306843216|ref|ZP_07475827.1| penicillin-binding protein [Brucella sp. BO2]
 gi|306286581|gb|EFM58158.1| penicillin-binding protein [Brucella sp. BO2]
          Length = 603

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 264/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 14  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 73

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 74  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 133

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 134 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 193

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 194 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 253

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEV++M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 254 IAAGAVVLNVKTGEVLAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 313

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 314 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 373

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 374 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 433

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 434 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 493

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 494 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 553

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 554 VAEIIRRSASFLGVSPDFRK 573


>gi|254719468|ref|ZP_05181279.1| penicillin-binding protein [Brucella sp. 83/13]
 gi|265984474|ref|ZP_06097209.1| peptidoglycan glycosyltransferase [Brucella sp. 83/13]
 gi|306839247|ref|ZP_07472064.1| penicillin-binding protein [Brucella sp. NF 2653]
 gi|264663066|gb|EEZ33327.1| peptidoglycan glycosyltransferase [Brucella sp. 83/13]
 gi|306405794|gb|EFM62056.1| penicillin-binding protein [Brucella sp. NF 2653]
          Length = 607

 Score =  407 bits (1047), Expect = e-111,   Method: Composition-based stats.
 Identities = 264/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPSGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEV++M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVLAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|294852763|ref|ZP_06793436.1| cell division protein FtsI [Brucella sp. NVSL 07-0026]
 gi|294821352|gb|EFG38351.1| cell division protein FtsI [Brucella sp. NVSL 07-0026]
          Length = 607

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 265/560 (47%), Positives = 368/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G   I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGSQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|23502308|ref|NP_698435.1| penicillin-binding protein [Brucella suis 1330]
 gi|62290330|ref|YP_222123.1| penicillin-binding protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700254|ref|YP_414828.1| beta-lactamase class A [Brucella melitensis biovar Abortus 2308]
 gi|161619385|ref|YP_001593272.1| penicillin-binding protein 2 [Brucella canis ATCC 23365]
 gi|189024563|ref|YP_001935331.1| penicillin-binding protein [Brucella abortus S19]
 gi|237815837|ref|ZP_04594834.1| Penicillin-binding protein 2 [Brucella abortus str. 2308 A]
 gi|254689631|ref|ZP_05152885.1| penicillin-binding protein [Brucella abortus bv. 6 str. 870]
 gi|254697773|ref|ZP_05159601.1| penicillin-binding protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254702158|ref|ZP_05163986.1| penicillin-binding protein [Brucella suis bv. 5 str. 513]
 gi|254704695|ref|ZP_05166523.1| penicillin-binding protein [Brucella suis bv. 3 str. 686]
 gi|254708109|ref|ZP_05169937.1| penicillin-binding protein [Brucella pinnipedialis M163/99/10]
 gi|254710478|ref|ZP_05172289.1| penicillin-binding protein [Brucella pinnipedialis B2/94]
 gi|254714471|ref|ZP_05176282.1| penicillin-binding protein [Brucella ceti M644/93/1]
 gi|254717369|ref|ZP_05179180.1| penicillin-binding protein [Brucella ceti M13/05/1]
 gi|254730662|ref|ZP_05189240.1| penicillin-binding protein [Brucella abortus bv. 4 str. 292]
 gi|256031972|ref|ZP_05445586.1| penicillin-binding protein [Brucella pinnipedialis M292/94/1]
 gi|256061494|ref|ZP_05451638.1| penicillin-binding protein [Brucella neotomae 5K33]
 gi|256160171|ref|ZP_05457865.1| penicillin-binding protein [Brucella ceti M490/95/1]
 gi|256255377|ref|ZP_05460913.1| penicillin-binding protein [Brucella ceti B1/94]
 gi|256257881|ref|ZP_05463417.1| penicillin-binding protein [Brucella abortus bv. 9 str. C68]
 gi|256369853|ref|YP_003107364.1| cell division protein/penicillin-binding protein [Brucella microti
           CCM 4915]
 gi|260169109|ref|ZP_05755920.1| cell division protein/penicillin-binding protein [Brucella sp.
           F5/99]
 gi|260546872|ref|ZP_05822611.1| penicillin-binding protein [Brucella abortus NCTC 8038]
 gi|260566058|ref|ZP_05836528.1| penicillin-binding protein [Brucella suis bv. 4 str. 40]
 gi|260755159|ref|ZP_05867507.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260758378|ref|ZP_05870726.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260762204|ref|ZP_05874547.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884172|ref|ZP_05895786.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|261219200|ref|ZP_05933481.1| peptidoglycan glycosyltransferase [Brucella ceti M13/05/1]
 gi|261222579|ref|ZP_05936860.1| peptidoglycan glycosyltransferase [Brucella ceti B1/94]
 gi|261315612|ref|ZP_05954809.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261318050|ref|ZP_05957247.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis B2/94]
 gi|261322261|ref|ZP_05961458.1| peptidoglycan glycosyltransferase [Brucella ceti M644/93/1]
 gi|261325501|ref|ZP_05964698.1| peptidoglycan glycosyltransferase [Brucella neotomae 5K33]
 gi|261752728|ref|ZP_05996437.1| peptidoglycan glycosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261755388|ref|ZP_05999097.1| peptidoglycan glycosyltransferase [Brucella suis bv. 3 str. 686]
 gi|261758616|ref|ZP_06002325.1| penicillin-binding protein [Brucella sp. F5/99]
 gi|265989081|ref|ZP_06101638.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|265998544|ref|ZP_06111101.1| peptidoglycan glycosyltransferase [Brucella ceti M490/95/1]
 gi|297248717|ref|ZP_06932435.1| cell division protein FtsI (penicillin binding protein 3) [Brucella
           abortus bv. 5 str. B3196]
 gi|23348285|gb|AAN30350.1| penicillin-binding protein [Brucella suis 1330]
 gi|62196462|gb|AAX74762.1| penicillin-binding protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616355|emb|CAJ11412.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A
           (P-loop):Penicillin-bi [Brucella melitensis biovar
           Abortus 2308]
 gi|161336196|gb|ABX62501.1| Penicillin-binding protein 2 [Brucella canis ATCC 23365]
 gi|189020135|gb|ACD72857.1| penicillin-binding protein [Brucella abortus S19]
 gi|237789135|gb|EEP63346.1| Penicillin-binding protein 2 [Brucella abortus str. 2308 A]
 gi|256000016|gb|ACU48415.1| cell division protein/penicillin-binding protein [Brucella microti
           CCM 4915]
 gi|260095922|gb|EEW79799.1| penicillin-binding protein [Brucella abortus NCTC 8038]
 gi|260155576|gb|EEW90656.1| penicillin-binding protein [Brucella suis bv. 4 str. 40]
 gi|260668696|gb|EEX55636.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 4 str. 292]
 gi|260672636|gb|EEX59457.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675267|gb|EEX62088.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 6 str. 870]
 gi|260873700|gb|EEX80769.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 9 str. C68]
 gi|260921163|gb|EEX87816.1| peptidoglycan glycosyltransferase [Brucella ceti B1/94]
 gi|260924289|gb|EEX90857.1| peptidoglycan glycosyltransferase [Brucella ceti M13/05/1]
 gi|261294951|gb|EEX98447.1| peptidoglycan glycosyltransferase [Brucella ceti M644/93/1]
 gi|261297273|gb|EEY00770.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis B2/94]
 gi|261301481|gb|EEY04978.1| peptidoglycan glycosyltransferase [Brucella neotomae 5K33]
 gi|261304638|gb|EEY08135.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M163/99/10]
 gi|261738600|gb|EEY26596.1| penicillin-binding protein [Brucella sp. F5/99]
 gi|261742481|gb|EEY30407.1| peptidoglycan glycosyltransferase [Brucella suis bv. 5 str. 513]
 gi|261745141|gb|EEY33067.1| peptidoglycan glycosyltransferase [Brucella suis bv. 3 str. 686]
 gi|262553168|gb|EEZ09002.1| peptidoglycan glycosyltransferase [Brucella ceti M490/95/1]
 gi|264661278|gb|EEZ31539.1| peptidoglycan glycosyltransferase [Brucella pinnipedialis
           M292/94/1]
 gi|297175886|gb|EFH35233.1| cell division protein FtsI (penicillin binding protein 3) [Brucella
           abortus bv. 5 str. B3196]
          Length = 607

 Score =  406 bits (1044), Expect = e-111,   Method: Composition-based stats.
 Identities = 265/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|225852919|ref|YP_002733152.1| penicillin-binding protein 2 [Brucella melitensis ATCC 23457]
 gi|256113990|ref|ZP_05454773.1| Penicillin-binding protein 2 [Brucella melitensis bv. 3 str. Ether]
 gi|256263600|ref|ZP_05466132.1| penicillin-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|265995332|ref|ZP_06107889.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|225641284|gb|ACO01198.1| Penicillin-binding protein 2 [Brucella melitensis ATCC 23457]
 gi|262766445|gb|EEZ12234.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093651|gb|EEZ17656.1| penicillin-binding protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409461|gb|ADZ66526.1| penicillin-binding protein 2 [Brucella melitensis M28]
 gi|326539167|gb|ADZ87382.1| penicillin-binding protein 2 [Brucella melitensis M5-90]
          Length = 607

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 264/560 (47%), Positives = 368/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+  TPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMATPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|225627888|ref|ZP_03785924.1| Penicillin-binding protein 2 [Brucella ceti str. Cudo]
 gi|225617051|gb|EEH14097.1| Penicillin-binding protein 2 [Brucella ceti str. Cudo]
          Length = 603

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 265/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 14  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 73

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 74  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 133

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 134 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 193

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 194 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 253

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 254 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 313

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 314 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 373

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 374 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 433

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 434 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 493

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 494 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 553

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 554 VAEIIRRSASFLGVSPDFRK 573


>gi|17986856|ref|NP_539490.1| penicillin-binding protein 2 [Brucella melitensis bv. 1 str. 16M]
 gi|256045067|ref|ZP_05447968.1| penicillin-binding protein 2 [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565334|ref|ZP_05835818.1| penicillin-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991494|ref|ZP_06104051.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|17982493|gb|AAL51754.1| penicillin-binding protein 2 [Brucella melitensis bv. 1 str. 16M]
 gi|260151402|gb|EEW86496.1| penicillin-binding protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002278|gb|EEZ14853.1| peptidoglycan glycosyltransferase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 607

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 264/560 (47%), Positives = 368/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+  TPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMATPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|254694121|ref|ZP_05155949.1| penicillin-binding protein [Brucella abortus bv. 3 str. Tulya]
 gi|261214421|ref|ZP_05928702.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 3 str.
           Tulya]
 gi|260916028|gb|EEX82889.1| peptidoglycan glycosyltransferase [Brucella abortus bv. 3 str.
           Tulya]
          Length = 607

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 265/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQASADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|306844336|ref|ZP_07476928.1| penicillin-binding protein [Brucella sp. BO1]
 gi|306275408|gb|EFM57149.1| penicillin-binding protein [Brucella sp. BO1]
          Length = 607

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 265/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGDVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|220933943|ref|YP_002512842.1| Peptidoglycan glycosyltransferase [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995253|gb|ACL71855.1| Peptidoglycan glycosyltransferase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 570

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 147/549 (26%), Positives = 256/549 (46%), Gaps = 33/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIH-----PEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + + ++ + ++  R +            E  A  + +      R  ++DRNGE L
Sbjct: 12  RRNVVLGLFVLGFAVVLGRGLDLQVFKQDFLRGEGDARHLRVVSIPAHRGMVLDRNGEPL 71

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQ 185
           A   P  S++  P + +   E + +L  VL ++D   ++R+L   +  +F +LRR ++P 
Sbjct: 72  AVSTPVDSVWANPQETLQAPERLAELARVL-DMDRGDLQRRLAERAGREFVYLRRHVNPD 130

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
              R+   G+PGV  + E  R+YP    A+HV+G+ +ID+RG  G+E  L+       G 
Sbjct: 131 VAARVQQLGVPGVALQREFRRYYPMGEVAAHVLGFTNIDDRGQEGLELALNELLTGQPGA 190

Query: 241 TRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G            +  + I L LD R+Q + ++EL    + + A S   VI+
Sbjct: 191 KRVVRDRLGRVIRDVENIRPARPGKDITLTLDQRVQYLAYRELKAAVQAHGARSGSAVIM 250

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TG++++MV+ P ++P+     +++   NR    +FE GS  K FT+A  ++SG    
Sbjct: 251 DVHTGDILAMVNQPSHNPNNRGSLRRDASRNRAVTDLFEPGSTIKPFTVAAALESGSANP 310

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               DT        +           + +  +   SSNIGA+++A +M  +     L++ 
Sbjct: 311 HMTLDTAPGFFRVGNHTIRDIRNYGRVDLTTMLAKSSNIGASKLALSMESEHLWRTLHQA 370

Query: 410 GLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL     +  P   +        W+ +   T++FG+GLS TPLQ A A AAL N+G +  
Sbjct: 371 GLGRSTGSGFPGEASGLLRDFYFWRDVDRATLAFGYGLSVTPLQLARAYAALANDGVMPA 430

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE-GVTGGSGRRAFVPGFEVGGKTGTAQK 526
           P F+     +       V+  +  + +R++L        +G RA V G+ V GKTGTA+K
Sbjct: 431 PRFLAH---QPVLPGEPVISPSVARELRAMLEASVTADSTGHRARVEGYRVAGKTGTARK 487

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
                YS+      F    P + P+ +++  +D P  +   Q   G   AP+   I++ +
Sbjct: 488 SGAGGYSEERFVAMFAGFAPASQPRLVMVVVIDEPAGE---QYYGGQVAAPVFSKIMQGA 544

Query: 587 ASMLGVKPV 595
             +L V P 
Sbjct: 545 LRLLDVPPD 553


>gi|134298537|ref|YP_001112033.1| stage V sporulation protein D [Desulfotomaculum reducens MI-1]
 gi|134051237|gb|ABO49208.1| stage V sporulation protein D [Desulfotomaculum reducens MI-1]
          Length = 713

 Score =  406 bits (1042), Expect = e-111,   Method: Composition-based stats.
 Identities = 128/558 (22%), Positives = 239/558 (42%), Gaps = 39/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIA-----PSMNIDEYGMSRPDIIDRNGE 125
           + RI    ++      ++  R++    +  + +        M        R  I+D+NG 
Sbjct: 9   RRRITCLFLMAAFFLSLIVFRLVWIQFVRGDELRQEGIINRMRDVPVEAKRGSILDQNGN 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
            L T I   S+YV P+ +  PDE+  ++  +L  +D E +R+ +S +++F+W++RK+  +
Sbjct: 69  ELVTSISADSIYVIPNHIKKPDEVASQIAPLL-GMDIEKVRKIISQKSRFEWIKRKVDFE 127

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             +++    + G+GF  E  R+Y   + A H++G+   DN+G+ G+E   + +     G 
Sbjct: 128 TSQKLKDLKIEGIGFAEESRRYYKQETLAPHILGFTGTDNQGLMGMEAAYEEELKGIPGR 187

Query: 241 TRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
             +     G +                + L LD  IQ+ V +EL +    Y+ +    ++
Sbjct: 188 IVIEHDAAGREIPQALHQYIPPTQGNNLVLTLDQTIQHFVERELDKIVASYSPKMAVIIV 247

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           ++  TG+++++ + P ++P++  +  +  W  N   +  +E GS FK+ T +  ++    
Sbjct: 248 MDPKTGDILALGNRPTFNPNKWREVPQSVWDRNPAIWYNYEPGSTFKIITASSALEENAV 307

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
              D F      +V    I  +    +   +  E+ + S N G  Q+   +G +   +++
Sbjct: 308 KTSDRFYDPGFYQVADRKIRCWKVGGHGSQSFEEVVQNSCNPGFIQVGLDLGKEKFYKYI 367

Query: 407 YRLGLLSKLETELPEIQAPSYPSQWKRIHS--LTISFGHGLSTTPLQTAVAAAALINEGR 464
              G        LP         +    +    T+S G  ++ TP+Q   A +A+ N G+
Sbjct: 368 RAYGFGQPTGIGLPGEARGIMIGEKDATNLNIATMSIGQSIAVTPIQLITAISAVANGGK 427

Query: 465 LIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFE 516
           L+ P  + R  +   KV         R V+   T K    LL   V  GSG+ AFV G+ 
Sbjct: 428 LMKPHLVKRIEDPKGKVIKEVVPQEVRQVVSAETAKVTSQLLENVVLKGSGKNAFVDGYR 487

Query: 517 VGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
             GKTGTAQ V     Y+      SF    P  DP+  VL  +  P+             
Sbjct: 488 AAGKTGTAQVVSDRGGYASGKYVASFAGFAPVNDPKIAVLVMVAEPQ---GGMYYGSQVA 544

Query: 576 APMVGNIIRRSASMLGVK 593
           AP+   + +     +GV 
Sbjct: 545 APVFAPLAKDILRYMGVP 562


>gi|315122413|ref|YP_004062902.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495815|gb|ADR52414.1| penicillin-binding transmembrane protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 577

 Score =  405 bits (1041), Expect = e-111,   Method: Composition-based stats.
 Identities = 452/598 (75%), Positives = 512/598 (85%), Gaps = 21/598 (3%)

Query: 1   MIFPFITVSQFRMFFSMGILHNHNMNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQ 60
           MIFPFI +S+F+ FFS        MN + N  NI  +NME             + Q  F 
Sbjct: 1   MIFPFIILSRFQAFFS--------MNTTSNGENIQIKNME-------------NRQRRFH 39

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           KRR+KVIA SKNRIG+TIV C++IYII AIR+IQYGN+  EPI    N++EYG SRPDII
Sbjct: 40  KRRKKVIAQSKNRIGITIVFCIIIYIIFAIRLIQYGNLQLEPIIHLTNVEEYGTSRPDII 99

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRNGEILATDI TFSLY EPHKVIS DEII+KLQ+VLPNLD ++IRRKL S+TKFQWLRR
Sbjct: 100 DRNGEILATDIRTFSLYAEPHKVISADEIIKKLQVVLPNLDIKVIRRKLLSKTKFQWLRR 159

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGL 240
           +LSPQQQKRIL+FGLPG+GFR+EK RFYPA+SH  HVVGYVDIDN GI+GIEKF+DMQGL
Sbjct: 160 QLSPQQQKRILNFGLPGLGFRIEKRRFYPASSHTLHVVGYVDIDNHGISGIEKFIDMQGL 219

Query: 241 TRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
           T   T  KGEKNL PIRL+LDLRIQNIVHQ LVEN +KY AES GTVI+NVSTGE+ISMV
Sbjct: 220 TSRSTIEKGEKNLPPIRLSLDLRIQNIVHQSLVENMQKYKAESAGTVIINVSTGEIISMV 279

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           SIPD+DPHEA KG KEGW NR+SYGIFEMGSIFK FTIAM IDSGLFTVKD FDTR PI+
Sbjct: 280 SIPDHDPHEAVKGGKEGWLNRVSYGIFEMGSIFKAFTIAMAIDSGLFTVKDSFDTRYPIQ 339

Query: 361 VGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELP 420
            GK+ I+D+HP +R+LTI EIFRYSSNIGAA+IADA+GI+ HK FL++LGLL+KLETELP
Sbjct: 340 QGKYFINDFHPHSRMLTIAEIFRYSSNIGAARIADAIGIEEHKNFLHKLGLLTKLETELP 399

Query: 421 EIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
           EI+APSYPS+WKR+HSLTISFGHGLSTTPLQTAVAAAALIN G+LIPPTFM+RSREE+EK
Sbjct: 400 EIKAPSYPSKWKRVHSLTISFGHGLSTTPLQTAVAAAALINGGQLIPPTFMVRSREEAEK 459

Query: 481 VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNS 540
            SRI+LKK TV+TMRSLLREGV  GSG+RAFVPGFEVGGKTGTAQKVI  RYS+ LNFN+
Sbjct: 460 KSRIILKKKTVETMRSLLREGVMSGSGKRAFVPGFEVGGKTGTAQKVIGNRYSNELNFNT 519

Query: 541 FLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           FLA FP ++PQY+VLSFMDSPKIKE+NQLTAGINVAPMVG+IIRRSASMLGVKP FLK
Sbjct: 520 FLATFPASNPQYVVLSFMDSPKIKEQNQLTAGINVAPMVGDIIRRSASMLGVKPTFLK 577


>gi|163843693|ref|YP_001628097.1| penicillin-binding protein 2 [Brucella suis ATCC 23445]
 gi|163674416|gb|ABY38527.1| Penicillin-binding protein 2 [Brucella suis ATCC 23445]
          Length = 607

 Score =  405 bits (1040), Expect = e-110,   Method: Composition-based stats.
 Identities = 265/560 (47%), Positives = 369/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDENLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSGRRA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGRRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|148559272|ref|YP_001259330.1| penicillin-binding protein [Brucella ovis ATCC 25840]
 gi|148370529|gb|ABQ60508.1| penicillin-binding protein [Brucella ovis ATCC 25840]
          Length = 607

 Score =  405 bits (1040), Expect = e-110,   Method: Composition-based stats.
 Identities = 264/560 (47%), Positives = 368/560 (65%), Gaps = 4/560 (0%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           H     G     G   F   R++    ++NR+ M I     IY ++A +++ +G I    
Sbjct: 18  HGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIYGVMAGKLVYFGMIGGVD 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              +        SRPDI+DRNGEILATDI T SLY EP K++ PDE IE L  VLP+LD 
Sbjct: 78  QDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVDPDETIEMLSTVLPDLDW 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E   ++L S   F W++R L+P+QQ +I++ G+PG+GFR EK RFYP    ASH++G V+
Sbjct: 138 EATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKRRFYPGGPTASHILGLVN 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
           +DN+GI G+EK++D QGL+ + +      ++L+P+ L++D+R+Q+I+   LV+  ++Y A
Sbjct: 198 VDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRVQHIMRDVLVKAMERYRA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
            + G V+LNV TGEVI+M S+PD+DP+       +   NR+S G +EMGS  K FT AM 
Sbjct: 258 IAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSAGTYEMGSTIKSFTTAMA 317

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +DSG FT++   D   P+  G+  I D+H + R LT+PE+F +SSNIG+ + ADA+GI+G
Sbjct: 318 LDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIFSSNIGSGREADAVGIEG 377

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           H+ FL ++GLL +++TELPE+  P  P  WK++HS+TISFGHG+ TTPLQTAV AAAL+N
Sbjct: 378 HRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHGMMTTPLQTAVGAAALMN 437

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSL--LREGVTGGSGRRAFVPGFEVGG 519
            G+LI PTF+ R+  ++ + S+ V+       MR L  L     GGSG RA VPG+ VGG
Sbjct: 438 GGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTAPGGSGWRATVPGYRVGG 497

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPM 578
           KTGTA+KVI  RYS  + FN+FLA FP  +P Y+VL+ +D PK +E     TAG+N APM
Sbjct: 498 KTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPKPEEGKFSATAGLNAAPM 557

Query: 579 VGNIIRRSASMLGVKPVFLK 598
           V  IIRRSAS LGV P F K
Sbjct: 558 VAEIIRRSASFLGVSPDFRK 577


>gi|169831599|ref|YP_001717581.1| stage V sporulation protein D [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638443|gb|ACA59949.1| stage V sporulation protein D [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 740

 Score =  405 bits (1040), Expect = e-110,   Method: Composition-based stats.
 Identities = 142/560 (25%), Positives = 243/560 (43%), Gaps = 39/560 (6%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNI-----HPEPIAPSMNIDEYGMSRPDIIDRN 123
             + RI   ++    +  +L++R++            E +   M        R  I DRN
Sbjct: 7   IMRKRIIFLLLASAAVLFLLSLRLVYIQFFLGEQLRKEALENRMRDIPVEAKRGTIYDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G+ L   I   S++  P ++ +P E  +K+ +VL ++D + + R ++    F W++RK+ 
Sbjct: 67  GKELVISISVDSVFAIPSQIKNPRETAQKVAVVL-DMDVDRVYRLITKPESFVWIKRKVD 125

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
            +  + + S  LPG+ F  E  R Y     A+HV+G+V IDN+G+TGIE   D+      
Sbjct: 126 FRTAQELKSLKLPGIEFVEESRRGYLKNGLAAHVLGFVGIDNQGLTGIENTCDIDLRGIP 185

Query: 239 GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G   +     G +                + L LD  IQ  V +EL      Y  +    
Sbjct: 186 GRIVMEYDAVGRQIPTAVHKYYPPVQGHALFLTLDETIQYFVERELDRLVDTYQPKYAVI 245

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSG 345
           ++++  TGE++ M + P +DP+      +  W  N   +  +E GS FK+ T+A  ++ G
Sbjct: 246 IVMDPQTGEILGMGNRPTFDPNRWADQPQSVWDRNPAIWYNYEPGSTFKIITLAAALEEG 305

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
                  F     IKV    I  +    +   T  E+ ++S N G  +I   +GI    +
Sbjct: 306 AVNKNRRFYDPGYIKVADRNIRCWKDGGHGSQTFEEVIQHSCNPGFIEIGLGVGIDPFYK 365

Query: 405 FLYRLGLLSKLETELPEIQAPSYPSQWKRI--HSLTISFGHGLSTTPLQTAVAAAALINE 462
           +L+  G  +     LP         Q +    +  T+S G  ++ TP+Q   A AA+ N 
Sbjct: 366 YLHGFGFGTPTGISLPGEAHGIMIPQKQATNLNLATMSIGQSIAVTPIQLTTAVAAVANG 425

Query: 463 GRLIPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           G L+ P  + +  +           KV R V+   T + M++LL   V  G+G  A+V G
Sbjct: 426 GELLQPQLVKKVVDHDGKVVRESKPKVVRRVVSNETAQEMQALLESVVLRGTGMNAYVDG 485

Query: 515 FEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           + V GKTGTAQ V     Y      +SF+   P  +P+ + L  +  P+           
Sbjct: 486 YRVAGKTGTAQVVGPSGGYVSGRYVSSFVGFGPVENPRAVTLVLVVEPQ---GGIYFGSQ 542

Query: 574 NVAPMVGNIIRRSASMLGVK 593
             AP   N+++     +G++
Sbjct: 543 VAAPAFRNVMQDVLRYMGLQ 562


>gi|297616975|ref|YP_003702134.1| stage V sporulation protein D [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144812|gb|ADI01569.1| stage V sporulation protein D [Syntrophothermus lipocalidus DSM
           12680]
          Length = 703

 Score =  404 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 136/549 (24%), Positives = 241/549 (43%), Gaps = 40/549 (7%)

Query: 86  IILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVIS 145
            +  ++I++   +  + +   M        R  + DRNG  LA  +   S+Y  P +V  
Sbjct: 29  RMFWVQIVRGAELSEKALENRMRDVPVKAKRGVVYDRNGRELAISVSADSVYANPAEVRK 88

Query: 146 ---PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRL 202
               +EI   L  +L  L+ E + ++++  + F+W++R++  +   ++    LPG+G   
Sbjct: 89  SGRAEEIAHTLAQIL-GLEEENVYQRITKVSGFEWIKRQVDFKTSAQLKKLDLPGIGLVE 147

Query: 203 EKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNKGEK------ 251
           E  RFYP  S A HV+G   IDN G+ G+++  +       G   +     G +      
Sbjct: 148 ESRRFYPKKSLACHVLGISSIDNIGLEGVDRQYNDIIGGIPGRIVIEHDAVGREIPEATH 207

Query: 252 ------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 +   + L +D  IQ IV +EL    +    +    V+++  TGEV++M + P +
Sbjct: 208 RYIPPTDGASVVLTIDETIQYIVERELDRVWEARKPKGAIAVVMDPRTGEVLAMANRPCF 267

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP++  +  +    N   +  +E GS  K+ T A G++ G+      F     IKVGK  
Sbjct: 268 DPNDYKQYPEVNRRNLAIWYAYEPGSTMKIVTAAAGLEEGVVRPNSRFFCPGSIKVGKET 327

Query: 366 I-HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
           I       +   T  E+  +S N+G   +   +G+  + ++L   G   K   +LP    
Sbjct: 328 ISCSQGRAHGAQTFVEVVEHSCNVGFVSLGLELGLDKYYQYLNAFGFGQKTGIDLPGEAK 387

Query: 425 PS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV- 481
                 ++ K+I   T++ G   + TP+Q   A + + N+G ++ P  +    +   KV 
Sbjct: 388 GILVPRTRAKQIDLATMAMGQANAVTPIQLLTAVSTVANDGVMMKPHLLKEVLDADGKVV 447

Query: 482 -------SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK-KRYS 533
                   R V+ K T + +  +L   V  G+G+ A++ G+ V GKTGTAQK+     Y 
Sbjct: 448 KRVEPEPVRQVISKATARELALILEGVVQNGTGQNAYIEGYRVAGKTGTAQKISPSGGYL 507

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
                 SF+   P  +P+   +  +D+P+         G   AP+   I+R S   L V 
Sbjct: 508 PNEYVASFVGFAPANNPRLACIVVIDAPQGYP---YYGGTVAAPVFREIMRDSLRYLEVP 564

Query: 594 ----PVFLK 598
               P   K
Sbjct: 565 LQGVPKVEK 573


>gi|311029922|ref|ZP_07708012.1| stage V sporulation protein D [Bacillus sp. m3-13]
          Length = 645

 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 153/564 (27%), Positives = 266/564 (47%), Gaps = 43/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + ++V ++++ I+ +R+          +             +   R +I+DRN
Sbjct: 7   TVRRRLTIVLLVGILLFSIIDLRLGYVQFALGNMLTDRAKDSWSRNIPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT++   ++ V P ++  P++  EKL  VL N+  E + + ++  +  + +    R
Sbjct: 67  GVPLATNMSAPTVLVVPRQIKDPNDTAEKLAAVL-NMSKEKVYKLVTKSSSMERINPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S ++ K I + GL GV    +  R YP  S+ SHV+G+  IDN+G+ G+E + D Q  
Sbjct: 126 KISHEKAKEIRALGLKGVYIAEDSKRHYPFGSYLSHVLGFAGIDNQGLMGLELYYDEQLK 185

Query: 239 ---GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  + ++  KG +            +   +RL +D ++Q I+ +EL   ++ YN + 
Sbjct: 186 GEKGYVQFYSDAKGRRMPDIPDDYEAPQDGLDLRLTIDSKVQTIMERELDLAQELYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + ++ +TGE+++M S PD+DP E      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 IIAIAMDPNTGEILAMSSRPDFDPAEFQNVAPEIYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +            D+   +  G  +       +   T  E+ + S N G  ++   +G +
Sbjct: 306 EENKVNLKNDTFNDSGAAMVDGARLRCWKKGGHGHQTFLEVVQNSCNPGFVELGQRLGTE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
               ++   G   K   +L          P +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 TLFNYIKSFGFGEKTGIDLAGEGKGILFKPERVGPVELATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +          +    R V+ + T   +R  L   V  G+GR 
Sbjct: 426 AVNGGILYTPFIAKEFVDPISGDIVSRKTPVEKRRVISEETSAQVRYALESVVAQGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   RY +  +  SF+ V P  DPQ +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGRYMENNHIVSFIGVAPADDPQLVVYLAVDNPKGTVQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
             G+  AP+VGNI+  S + LGV+
Sbjct: 543 FGGVVAAPIVGNIMEDSLNALGVE 566


>gi|295399709|ref|ZP_06809690.1| stage V sporulation protein D [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111772|ref|YP_003990088.1| stage V sporulation protein D [Geobacillus sp. Y4.1MC1]
 gi|294978112|gb|EFG53709.1| stage V sporulation protein D [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216873|gb|ADP75477.1| stage V sporulation protein D [Geobacillus sp. Y4.1MC1]
          Length = 646

 Score =  402 bits (1034), Expect = e-110,   Method: Composition-based stats.
 Identities = 157/568 (27%), Positives = 264/568 (46%), Gaps = 42/568 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+ +  +V ++I+ I+ IR+     I  +               +   R +I+DRN
Sbjct: 7   TVRKRLMIVFLVGVLIFAIIDIRLGYVQLIIGDMLTERAKNSWSRNIPFEPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRK 181
           G  +AT++   ++YV P ++ +P E  EKL   L N+  E   R ++ +T  + +   RK
Sbjct: 67  GVPIATNMSAPTVYVIPRQIENPAETAEKLAKAL-NMPVEKAYRHITKKTSIERIPEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++   I + GL GV    +  R+YP  S+ SHV+G+  IDN+G+ G+E + D +   
Sbjct: 126 ISNEKANEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLMGLELYYDKELRG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + ++  KG++            +   + L +D RIQ IV +EL   + KYN + +
Sbjct: 186 QRGSVQFYSDAKGKRMPNMTDEYTPPTDGLDLMLTIDSRIQTIVERELDIAEAKYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + +N +TGE+++M S P +DP        E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMNPNTGEILAMASRPTFDPANYRNVPPEIYNRNLPVWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
                      +D       G  +       +   T  E+ + S N G  ++   +G + 
Sbjct: 306 EKKVDLLNDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGQRLGKEK 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +++ + G   K   +L            +   +   T SFG G+S TP+Q   A +A 
Sbjct: 366 LFDYIKQFGFGEKTGIDLQGEGTGILFDLKRVGPVEQATTSFGQGVSVTPIQQVAAVSAA 425

Query: 460 INEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           +N G L  P    +  +          + K  R V+ + T K +R  L   V  G+G+ A
Sbjct: 426 VNGGILYTPYVAKQWVDPETGKVIIRNTPKAKRRVISEETSKQVRYALESVVAQGTGKGA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           +V G+ VGGKTGTAQK    RY       SF+   P  DPQ +V   +D+PK   +    
Sbjct: 486 YVEGYRVGGKTGTAQKAKGGRYLTDNYIVSFIGFAPADDPQLVVYVAVDNPKGTVQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPVFLK 598
            G+  AP+VG I+  S  +LGVKP   +
Sbjct: 543 GGVVSAPIVGKIMGDSLRVLGVKPRKGQ 570


>gi|56964126|ref|YP_175857.1| stage V sporulation protein D [Bacillus clausii KSM-K16]
 gi|56910369|dbj|BAD64896.1| stage V sporulation protein D [Bacillus clausii KSM-K16]
          Length = 644

 Score =  401 bits (1030), Expect = e-109,   Method: Composition-based stats.
 Identities = 157/564 (27%), Positives = 255/564 (45%), Gaps = 43/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             + R+ +   + + ++ I+A+R+          +  +          +   R DI DRN
Sbjct: 7   TVRKRLLLAFFIGVAVFAIIAVRLGYVQFGQGVWLTEQAEDSWGRNIPFEPKRGDITDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
           G  LAT+I   S+ V P +V  P +  EKL  VL  +D +     L+      WLR   +
Sbjct: 67  GVELATNISAPSVIVFPRQVTDPVDAAEKLAAVL-EMDQQKAYESLTKSASSVWLRPEGQ 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           KLS ++ + + S  LPGV    +  R YP  S+ SHV+G+  IDN+G+TG+E + D +  
Sbjct: 126 KLSQEKAQEVRSLNLPGVYIAEDSKRHYPFGSYLSHVLGFAGIDNQGLTGLEHYYDGKLK 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G    F+T KG              N   + L +D RIQ I+ +EL + + KY  + 
Sbjct: 186 GEKGYVSFFSTAKGTKMPNLADEYEPPINGLNLTLTIDSRIQTIMERELDQAEAKYEPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR-ISYGIFEMGSIFKVFTIAMGI 342
              + ++ +TGEV++M S PD++P    +   E +      +  +E GS FK+ T+A  +
Sbjct: 246 AMAIAMDPNTGEVLAMSSRPDFNPEHYREVPAEVYNQNKPVWMQYEPGSTFKLITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           + G+         D       G  +       +   T  E+ + S N G  ++   +G  
Sbjct: 306 EEGVVDLENDTFHDPGYINVAGTKLRCWKKGGHGHQTFLEVVQNSCNPGFVELGQRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G++ TPLQ  VA +A
Sbjct: 366 RLFDYIEEFGFGQKTGIDLQGEGTGILFNRDRVGPLEQATTAFGQGVAVTPLQQVVAVSA 425

Query: 459 LINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +          S  + R V+ + T + +R  +   V  GSG+ 
Sbjct: 426 AVNGGYLYEPYLAKEWTDGETGEVVESISPVMKRQVISEKTSEQVRYAMENVVAKGSGKN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQK    +Y +     SF+ V P  DPQ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKAKNGKYLENNYILSFIGVAPMDDPQIVVYVAIDNPKNTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
             G+  AP+ G II  S   +GV+
Sbjct: 543 YGGVVAAPIAGAIIGDSLEAMGVE 566


>gi|255767347|ref|NP_389400.2| penicillin-binding protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|321315280|ref|YP_004207567.1| penicillin-binding protein [Bacillus subtilis BSn5]
 gi|239938848|sp|Q03524|SP5D_BACSU RecName: Full=Stage V sporulation protein D; AltName:
           Full=Sporulation-specific penicillin-binding protein
 gi|225184974|emb|CAB13390.2| penicillin-binding protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320021554|gb|ADV96540.1| penicillin-binding protein [Bacillus subtilis BSn5]
          Length = 646

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 150/566 (26%), Positives = 261/566 (46%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P +  ++L  VL N+  E + + ++ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVL-NMSEEKVYKHVTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KY+ + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE++ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G   AP+VGNI+R S   LGVKP 
Sbjct: 543 FGGTVAAPIVGNIMRDSLPELGVKPR 568


>gi|319649669|ref|ZP_08003825.1| penicillin-binding protein [Bacillus sp. 2_A_57_CT2]
 gi|317398831|gb|EFV79513.1| penicillin-binding protein [Bacillus sp. 2_A_57_CT2]
          Length = 638

 Score =  401 bits (1029), Expect = e-109,   Method: Composition-based stats.
 Identities = 154/565 (27%), Positives = 258/565 (45%), Gaps = 42/565 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + + V ++++ I+ +R+                        +   R +I+DRN
Sbjct: 7   TVRKRLTVALFVGILVFFIIDLRLGYVQFFLGNLLTDGAKELWSRDIPFEPERGEIVDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRK 181
           G  LAT++   ++YV P ++  P +  EKL  VL N+  E   + ++       +   RK
Sbjct: 67  GIPLATNVSAPTVYVVPRQIKDPADAAEKLAAVL-NMSKEKAYQLITKRESSVKIPEGRK 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           +S ++ K I +  + G+    +  R YP  ++ SHV+G+  IDN+G+ G+E + D +   
Sbjct: 126 ISHEKAKEIRALEIEGIYIGEDSKRHYPFGNYLSHVLGFSGIDNQGLMGLELYYDEELKG 185

Query: 239 --GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G  + +   KGE+            +   ++L +D +IQ IV +EL   + +YN + +
Sbjct: 186 KKGSVKFYANAKGERMNDMADDYKPPVDGMDLKLTIDSKIQTIVERELDIAQAEYNPDGI 245

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + +N + GEV++M S PD+DP        E +  N   +  +E GS FK+ T+A  ++
Sbjct: 246 IAIAMNPNNGEVLAMASRPDFDPANFRNVPPEIYNRNLPIWSTYEPGSTFKIITLAAALE 305

Query: 344 SGLFT-VKDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
            G     KD F     ++VG           +   T  E+ + S N G  ++ + +G   
Sbjct: 306 EGKVDLEKDHFHDPGSVEVGGARLRCWKKGGHGSQTYLEVVQNSCNPGFVELGERLGKDK 365

Query: 402 HKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A 
Sbjct: 366 LFKYIRDFGFGEKTGIDLQGEGKGILFNLDRVGPVEQATTAFGQGVSVTPIQQVAAISAA 425

Query: 460 INEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           +N G L  P                  S    R V+ K T   +R  L   V  GSG++A
Sbjct: 426 VNGGTLYTPYIAKELINPATGEILMKKSPDAKRKVISKETSDEIRKALESVVAKGSGKKA 485

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           FV G+ VGGKTGTAQK    RY +  +  SF+   P  DPQ +V   +D+PK   +    
Sbjct: 486 FVDGYRVGGKTGTAQKAQNGRYLENNHIVSFIGFAPADDPQLVVYVAVDNPKGTIQ---F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
            G+  AP+VG I+  S   +GVKP 
Sbjct: 543 GGVVAAPIVGEIMGDSLRAMGVKPR 567


>gi|302389510|ref|YP_003825331.1| stage V sporulation protein D [Thermosediminibacter oceani DSM
           16646]
 gi|302200138|gb|ADL07708.1| stage V sporulation protein D [Thermosediminibacter oceani DSM
           16646]
          Length = 694

 Score =  400 bits (1028), Expect = e-109,   Method: Composition-based stats.
 Identities = 133/549 (24%), Positives = 234/549 (42%), Gaps = 40/549 (7%)

Query: 81  CLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEP 140
             +I  +  I+ ++   +  +              R  I DRN   LA      S+   P
Sbjct: 24  IALIGRVFWIQFVRGDELRQKAREQWTRDAPVEPKRGTIYDRNMNPLAISASVNSVMASP 83

Query: 141 HKVISPDEIIEKLQIVLPNLDSEMIRRKLS----SETKFQWLRRKLSPQQQKRILSFGLP 196
             +   ++    L  VL N+D + + + L      +    +++RK++ ++ + +    L 
Sbjct: 84  PDIKDIEKTASLLSPVL-NIDKDALVKTLEDAKAKKRGSIFIKRKITDEEAEAVRKLNLK 142

Query: 197 GVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNK--- 248
           G+ F  E  RFYP  + ASHV+G+  ID++G+ GIE   D       G            
Sbjct: 143 GIYFTEESKRFYPEKNLASHVLGFTGIDSQGLDGIELVYDKYLRGIPGRIISEKDALSRE 202

Query: 249 ---------GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
                      +    + L +D  IQ+I  +EL +   ++NA+    +I++  TGE+++M
Sbjct: 203 LPFGLEKYIPPEEGLNLVLTIDKVIQHIAERELEKALAEHNAKKGTIIIMDPKTGEILAM 262

Query: 300 VSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPI 359
            + PDYDP++        W N     ++E GS FK+ T + G++ G+    D F     I
Sbjct: 263 ANKPDYDPNDYKNYPSSLWRNSAVSDVYEPGSTFKIITASAGLEEGVVRPGDSFYDPGYI 322

Query: 360 KVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETE 418
            V    I  +    +   T  ++ + S N G  ++   +G +   +++   G       +
Sbjct: 323 VVAGVRIKCWRSGGHGSQTFAQVVQNSCNPGFVEVGSRLGKERFIKYIKGFGFGETTGID 382

Query: 419 LPEIQAPSYPS-QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           LP      +   +   +   T+SFG G+S TP+Q   A A + N+G++  P       ++
Sbjct: 383 LPGEAKGIFNPAKIGPVELATVSFGQGISVTPIQLVTAVATVANDGKMPQPHIAKALVDK 442

Query: 478 S--------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK 529
                     +V R V+ + T   M+ LL   V  G+G RA + G+ V GKTGTA+K   
Sbjct: 443 DGRVVYEFKPRVVRQVISEETAAEMKKLLESVVENGTGGRAKIEGYRVAGKTGTAEK--- 499

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
             Y+D     SF+   P  DP+++ L  +D P          G   AP+   ++      
Sbjct: 500 --YADGKYVASFVGFAPADDPKFVALVVIDEPST---GIYYGGQIAAPVFQKVMADVLKY 554

Query: 590 LGVKPVFLK 598
            G+KP   +
Sbjct: 555 KGIKPQLQE 563


>gi|325293471|ref|YP_004279335.1| penicillin binding protein 2 [Agrobacterium sp. H13-3]
 gi|325061324|gb|ADY65015.1| penicillin binding protein 2 [Agrobacterium sp. H13-3]
          Length = 580

 Score =  400 bits (1027), Expect = e-109,   Method: Composition-based stats.
 Identities = 287/542 (52%), Positives = 392/542 (72%), Gaps = 2/542 (0%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
           F+  R+K  A +K+R+G+ I   +  Y ++  R++QYG    E ++     D    SRPD
Sbjct: 30  FEGARKKRAAQAKSRVGLIIFGFIAFYGVVGGRLVQYGLAEQETVSSIAPADRLMASRPD 89

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           ++DRNGE+LATDI T SL+ EPH+++  DE IEKL+ VLP+LD     +KLSS ++FQWL
Sbjct: 90  LLDRNGEVLATDIRTVSLFAEPHRIVDIDEAIEKLRTVLPDLDQRGTYQKLSSNSRFQWL 149

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           RR+L+P+QQ +IL+ G+PGVGFR EK RFYP    A+HVVG+V+IDNRG+ G+E+++D Q
Sbjct: 150 RRQLTPKQQSQILALGIPGVGFRPEKRRFYPGGPTAAHVVGHVNIDNRGVAGMERYVDSQ 209

Query: 239 GLTRVFTTNK-GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           GL  +       ++ L+P++L++DLR+Q+IV + +     K+ A   G V+L+V TGEV+
Sbjct: 210 GLADLTALGMTSDQPLEPVKLSIDLRVQSIVREVVTSAITKFQAIGAGAVVLDVHTGEVL 269

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN 357
           +M S+PDYDP+   +G KEGW NR+S G FEMGS FK FTIAMG+DSG   + D+FD R 
Sbjct: 270 AMASVPDYDPNNPAEGAKEGWLNRMSNGTFEMGSTFKSFTIAMGLDSGRVRLGDMFDARY 329

Query: 358 PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLET 417
           PI++G   I D+H + R+L++PEIF+YSSNIG A+IAD +G +GHKEFL RLGLL++++T
Sbjct: 330 PIRIGGFTIKDFHGKGRMLSVPEIFQYSSNIGTAKIADTVGTEGHKEFLTRLGLLTRMQT 389

Query: 418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           ELPE+  PS P +WK+I+S+TISFGHG+STTPLQTAVA AAL+N G+LI PTF+ R+RE+
Sbjct: 390 ELPEVALPSQPREWKKINSITISFGHGVSTTPLQTAVAGAALVNGGKLIEPTFLPRTREQ 449

Query: 478 SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN 537
           +++V++ VLK    K MR L       GSGR A V GF VGGKTGTA KV+  RY    N
Sbjct: 450 ADQVAKQVLKPGASKDMRFLFEWNGVNGSGRNARVDGFNVGGKTGTADKVVNGRYVHDKN 509

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT-AGINVAPMVGNIIRRSASMLGVKPVF 596
           FN+FL+ FP  DPQY+VLSF+D PK  + N    AG + APMV +II R+A++LGVKP F
Sbjct: 510 FNAFLSAFPMDDPQYVVLSFIDEPKTDKGNGAALAGTSAAPMVHDIISRTAAVLGVKPKF 569

Query: 597 LK 598
            K
Sbjct: 570 GK 571


>gi|296331092|ref|ZP_06873566.1| penicillin-binding protein [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305674247|ref|YP_003865919.1| penicillin-binding protein [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|296151736|gb|EFG92611.1| penicillin-binding protein [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305412491|gb|ADM37610.1| penicillin-binding protein [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 646

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 150/566 (26%), Positives = 261/566 (46%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P +  ++L  VL N+  E + + ++ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVL-NMSEEKVYKHVTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KY+ + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE++ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILGMASRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKGFGFGQKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEKTSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G   AP+VGNI+R S   LGVKP 
Sbjct: 543 FGGTVAAPIVGNIMRDSLPELGVKPR 568


>gi|118590898|ref|ZP_01548298.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [Stappia aggregata
           IAM 12614]
 gi|118436420|gb|EAV43061.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [Stappia aggregata
           IAM 12614]
          Length = 570

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 244/536 (45%), Positives = 357/536 (66%), Gaps = 3/536 (0%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNID-EYGMSRPDIIDRNG 124
             +  K+R+ + ++    +Y+ +A R++    +   P    ++       SRPD++DRNG
Sbjct: 26  SASAVKSRVYVAMLAFACVYVAIAGRLVMLAQMEEAPSHAWISAQDSVAASRPDLVDRNG 85

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
           EILATDI T SLY EP +++  DE +E L  +LP+L+  ++RR+L S   F WL+R+++P
Sbjct: 86  EILATDIKTASLYAEPRRIMDVDEAVEGLIRILPDLNEGLVRRRLESGAGFVWLKREMTP 145

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF 244
           QQ +R+ + GLPG+GF  E  RFYP    A H+VG V++DN+G+ GIEK++D   L  + 
Sbjct: 146 QQAERVHNLGLPGIGFLSENQRFYPGGPTAGHIVGSVNVDNQGLAGIEKYIDDSWLRDLQ 205

Query: 245 TTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
           +     ++ ++P++L++DLR+Q++V  ELV+  ++Y A +   ++L+  TGEV++M S+P
Sbjct: 206 SLGFTSDRTMEPVKLSVDLRVQHVVRDELVKAMERYKAIAAAGIVLDAKTGEVVAMSSLP 265

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           DYDP++  +  ++   NR + G+FEMGS+FK FT AM +DSG  ++ D FD   PI+ G 
Sbjct: 266 DYDPNDRSQALEKDRLNRATGGVFEMGSVFKTFTTAMALDSGAVSINDSFDATRPIRAGG 325

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             I D+H ++RIL++PEIF YSSNIG A++  A GI   ++FL RL L  +L+TELPE  
Sbjct: 326 RTISDFHGKHRILSVPEIFIYSSNIGTAKMMLATGIARQQDFLKRLHLTDRLQTELPENA 385

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
           AP  P +W  + ++TISFGHG+S TP+QTAVAAAAL+N G L+PPTF+ RS E+ +K+ +
Sbjct: 386 APLLPPKWNELAAMTISFGHGISVTPMQTAVAAAALVNGGTLLPPTFLPRSPEDVQKLGK 445

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            V+   T + MR L R  V  GSGRRA VPG+ VGGKTGTA+K+   RY      NSFL+
Sbjct: 446 QVVSPETSRIMRYLFRLNVLSGSGRRADVPGYTVGGKTGTAEKIENGRYVSNKRRNSFLS 505

Query: 544 VFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            FP  DP+Y+VL  +D PK +      TAG+N APMVG I+RR+A MLGV P F K
Sbjct: 506 AFPMDDPRYVVLVVIDEPKPEREGIGATAGLNAAPMVGAIVRRAAPMLGVMPRFSK 561


>gi|190892589|ref|YP_001979131.1| cell division penicillin-binding protein [Rhizobium etli CIAT 652]
 gi|190697868|gb|ACE91953.1| cell division penicillin-binding protein [Rhizobium etli CIAT 652]
          Length = 585

 Score =  399 bits (1026), Expect = e-109,   Method: Composition-based stats.
 Identities = 265/546 (48%), Positives = 380/546 (69%), Gaps = 8/546 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
            +  R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPD
Sbjct: 33  IEGTRKKKSGQAKSRVGLLILGFMGVYVVIGGRLVEYAMKDQEVVSSILPPDRLMASRPD 92

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SETKFQW 177
           I+DRNGE+LATDI T SL+ EP+K++ PDE +EKL  VLP LD +   +KLS   + F W
Sbjct: 93  ILDRNGEVLATDIRTVSLFAEPNKIVDPDEAVEKLATVLPELDVKDTYKKLSVKTSHFAW 152

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           LRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EKF+D 
Sbjct: 153 LRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKFIDD 212

Query: 238 QGLTRV-FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           QGL  +       ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV
Sbjct: 213 QGLADLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEV 272

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD  
Sbjct: 273 LAMASAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMSDTFDAS 332

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
            PI +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L +LGLL+K++
Sbjct: 333 KPIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLNKLGLLTKMQ 392

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE++ P+ P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE
Sbjct: 393 TELPEVKMPTQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTRE 452

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           E++++++ V+KK+T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TL
Sbjct: 453 EADQIAKQVIKKSTSDEIRYLLDFNGFKGSGRVARVPGFAVGSKTGTADKVVNGRYSSTL 512

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI----NVAPMVGNIIRRSASMLGV 592
           NFNSF+A FP  DP+Y V++F D PK  E+     G        P+   II R+A +LG+
Sbjct: 513 NFNSFIAAFPINDPKYAVITFCDEPKTGEKQ--YGGTISAGTAGPIAREIISRAAPILGI 570

Query: 593 KPVFLK 598
           +P F +
Sbjct: 571 EPKFGE 576


>gi|302391525|ref|YP_003827345.1| stage V sporulation protein D [Acetohalobium arabaticum DSM 5501]
 gi|302203602|gb|ADL12280.1| stage V sporulation protein D [Acetohalobium arabaticum DSM 5501]
          Length = 693

 Score =  399 bits (1025), Expect = e-109,   Method: Composition-based stats.
 Identities = 145/559 (25%), Positives = 250/559 (44%), Gaps = 42/559 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             + RI +  ++ + + + + +R+             + +   +   +    R  I D+N
Sbjct: 7   QVRKRILILFLIVVFVMLGIILRLAWIQIFNNELYQSKALNQRLRKLKVEPRRGIIYDKN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           GE LA    + ++   P ++  P ++ +KL ++L +++   I +K++      +L RK+S
Sbjct: 67  GEELAISGSSQTVVAVPAEIEDPSKVADKLTLIL-DMERSEIYKKITKSAYAVYLERKIS 125

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----Q 238
            ++  +I S  L G+ F  E  RFYP    A+H++G+  IDN+G+ GIE   D       
Sbjct: 126 EKKAAQIKSLDLSGITFTEETKRFYPKGDLAAHILGFAGIDNQGLNGIELAYDQVLRGEP 185

Query: 239 GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G   +     G              +   + L +D  +Q I  +EL +  +   AE    
Sbjct: 186 GRIMIEKDATGRMMPRGVEQYLDPTDGNNLYLTIDHVVQYIAERELEKALRGNEAEGGTI 245

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           +++N  TG V+++ + P Y+P+   K     W N      +E GS FK+ T++  ++ G+
Sbjct: 246 IVMNPQTGGVLALANRPTYNPNHFAKYSPGRWRNSAISDSYEPGSTFKIVTMSAALEEGV 305

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
             ++D F     IKV    I  +    +   T  E+   S N G  QI   +G +   ++
Sbjct: 306 VNLEDQFFDPGYIKVEGERIKCWKNGGHGKQTFAEVVANSCNPGFVQIGQRVGKEDFYQY 365

Query: 406 LYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           +   G   K +  LP               +   T+SFGHG+S TP+Q   A +A+ ++G
Sbjct: 366 VKAFGFGQKTDINLPGEADGLVYDYDDIGPVELATMSFGHGISVTPMQLITAVSAVASDG 425

Query: 464 RLIPPTFMIRSREESE--------KVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
            L+ P  + R   E          K  R V+ + T KT R LL   VT GSG +A V G+
Sbjct: 426 VLLNPRLVDRIENEEGEVIKDFKSKEIRKVVSEETAKTTRDLLEGVVTDGSGEKAQVKGY 485

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            +GGKTGTA     K Y      +SF+ + P  +PQ +VL  M   K             
Sbjct: 486 RIGGKTGTA-----KHYGVQSYDSSFIGMLPIDNPQLVVLVVM---KGVSSYPYYGSQVA 537

Query: 576 APMVGNIIRRSASMLGVKP 594
           AP+  ++++ +   LG+ P
Sbjct: 538 APLFHDVVKDTVRYLGIPP 556


>gi|327194628|gb|EGE61478.1| cell division penicillin-binding protein [Rhizobium etli CNPAF512]
          Length = 578

 Score =  399 bits (1024), Expect = e-109,   Method: Composition-based stats.
 Identities = 265/546 (48%), Positives = 380/546 (69%), Gaps = 8/546 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
            +  R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPD
Sbjct: 26  IEGTRKKKSGQAKSRVGLLILGFMGVYVVIGGRLVEYAMKDQEVVSSILPPDRLMASRPD 85

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SETKFQW 177
           I+DRNGE+LATDI T SL+ EP+K++ PDE +EKL  VLP LD +   +KLS   + F W
Sbjct: 86  ILDRNGEVLATDIRTVSLFAEPNKIVDPDEAVEKLATVLPELDVKDTYKKLSVKTSHFAW 145

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           LRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EKF+D 
Sbjct: 146 LRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKFIDD 205

Query: 238 QGLTRV-FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           QGL  +       ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV
Sbjct: 206 QGLADLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEV 265

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD  
Sbjct: 266 LAMASAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMSDTFDAS 325

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
            PI +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L +LGLL+K++
Sbjct: 326 KPIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLNKLGLLTKMQ 385

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE++ P+ P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE
Sbjct: 386 TELPEVKMPTQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTRE 445

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           E++++++ V+KK+T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TL
Sbjct: 446 EADQIAKQVIKKSTSDEIRYLLDFNGFKGSGRVARVPGFAVGSKTGTADKVVNGRYSATL 505

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI----NVAPMVGNIIRRSASMLGV 592
           NFNSF+A FP  DP+Y V++F D PK  E+     G        P+   II R+A +LG+
Sbjct: 506 NFNSFIAAFPINDPKYAVITFCDEPKTGEKQ--YGGTISAGTAGPIAREIISRAAPILGI 563

Query: 593 KPVFLK 598
           +P F +
Sbjct: 564 EPKFGE 569


>gi|152976277|ref|YP_001375794.1| stage V sporulation protein D [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152025029|gb|ABS22799.1| stage V sporulation protein D [Bacillus cytotoxicus NVH 391-98]
          Length = 638

 Score =  398 bits (1023), Expect = e-108,   Method: Composition-based stats.
 Identities = 159/569 (27%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  L+++ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILICGLLVFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++ +P E  EKL  VL  ++ E I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQLENPAETAEKLAAVL-GVEKEEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+   + K + S  L GV    +  R YP   + +HV+G+   DN+G+ G+E + D +  
Sbjct: 126 KIPHDKAKEVRSLSLKGVYIAEDSIRHYPFGKYLAHVLGFAGSDNQGLMGLEAYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    +RL +D RIQ I+ +EL      YN + 
Sbjct: 186 GDKGYVRFFADAKGQRMPNVGDDFKKPEAGLNLRLTIDSRIQAIMERELNIADSTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQNVSPEVFNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NEKLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 KLFQYIRDFGFGQKTGIDLQGEGKGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +          S  V R V+ K T + +R  L   V  GSGR 
Sbjct: 426 AVNGGNLYQPYIAKEFVDPITKQVVSKKSPSVKRKVISKETSEKVRYALENVVAKGSGRS 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF++  P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFISFAPADDPQIVVYVAVDNPKGITQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R     +GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDVLPAMGVEPRKEQ 571


>gi|110634363|ref|YP_674571.1| penicillin-binding protein, transpeptidase [Mesorhizobium sp. BNC1]
 gi|110285347|gb|ABG63406.1| penicillin-binding protein, transpeptidase [Chelativorans sp. BNC1]
          Length = 574

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 266/550 (48%), Positives = 380/550 (69%), Gaps = 7/550 (1%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEY 112
           E    + Q RR+     +++RI + + + L IY  +  R++  G I  E           
Sbjct: 16  EQASIVLQGRRKATSGRAQSRIVLAMAMILGIYGAIGARLVHLGLIE-EAPVNLPQTRP- 73

Query: 113 GMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
             SRPD++DRNGE+LATDI T SL+ EP  +I  DE+IEKLQ VLP+LD E   R+L S+
Sbjct: 74  TASRPDLLDRNGEVLATDIKTSSLFAEPRHIIDIDEVIEKLQKVLPDLDYEQTYRRLDSD 133

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F WLRR+LSP+QQ  IL+ G+PG+GFR EK+RFYP  + ASH++G V+IDN+GI G+E
Sbjct: 134 AGFVWLRRQLSPRQQSDILALGIPGLGFRTEKTRFYPGGATASHILGLVNIDNKGIAGME 193

Query: 233 KFLDMQGLTRVFTTN-KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           +++D QGL  +      G   L+P+RL++DLR Q I+H EL +   +Y+A + G  ILN 
Sbjct: 194 QYVDDQGLADLQALGLAGPDTLEPVRLSIDLRAQYILHDELSQAMDRYHAIAAGGAILNA 253

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++MVS+PDYDP+  +   ++   NR++ G+FEMGS FK+FT AM +DSG   + D
Sbjct: 254 RTGEVVAMVSLPDYDPNNPYNALEKDRINRMTAGVFEMGSTFKLFTTAMALDSGHVKMTD 313

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
            FD   P+++G   I+D+H + R+L++PE+F YSSNIG A++AD +GI+GH+ FL ++GL
Sbjct: 314 RFDASRPLRLGGFTINDFHGKGRVLSVPEVFIYSSNIGTAKMADVVGIEGHRAFLKKVGL 373

Query: 412 LSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           L K++TELPE+  P+ P  WK+I+S+TISFGHG++TTPLQTAV+A A++N G+LIPPTF+
Sbjct: 374 LDKMKTELPEVAQPTEPKVWKKINSVTISFGHGVATTPLQTAVSAVAMVNGGKLIPPTFL 433

Query: 472 IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGS---GRRAFVPGFEVGGKTGTAQKVI 528
            R+ EE++ V+  V+   T   +R L R  V  G+   G RA VPGF VGGKTGTA+KV+
Sbjct: 434 PRTEEEAQAVATQVISPETSAQIRYLFRLNVQKGTGGSGSRADVPGFYVGGKTGTAEKVV 493

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSA 587
             RYS+   FN+FLA +P  DP+Y+V+  +D PK ++     T+G+N AP+VGN+IRR+A
Sbjct: 494 NGRYSNDKRFNAFLAAYPINDPEYVVVVILDEPKGEKPGMSATSGLNAAPVVGNVIRRTA 553

Query: 588 SMLGVKPVFL 597
            +LGV+P F 
Sbjct: 554 PLLGVEPDFS 563


>gi|220931746|ref|YP_002508654.1| stage V sporulation protein D [Halothermothrix orenii H 168]
 gi|219993056|gb|ACL69659.1| stage V sporulation protein D [Halothermothrix orenii H 168]
          Length = 695

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 136/562 (24%), Positives = 240/562 (42%), Gaps = 42/562 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             K RI    ++  ++   L +R+I            E +   +   +    R  I DRN
Sbjct: 7   KIKKRIVFLFIILFLLTFSLGLRLIWIQVINSEHYQEEALNQRLRHLKVEPKRGTIFDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G  LA    + ++   P +V  P +  +KL  VL +++ E I ++L+      +++RK+ 
Sbjct: 67  GGKLAVSASSETVMAIPLEVKEPRQTAQKLSRVL-DMEPEYIYKRLTKNASAVYIKRKVD 125

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----Q 238
            +   ++    LPG+ F  E  R+YP  S A H++G+  ID++G+ G+E F D       
Sbjct: 126 EKTANQVRKLNLPGITFTEESKRYYPKGSLACHILGFAGIDSQGLDGVELFYDRYLRGIP 185

Query: 239 GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G   V     G             +N   + L +D  IQ I  +EL    K ++      
Sbjct: 186 GRIEVERDASGQTIPGGIQEYVPPENGYNLYLTIDEVIQYIAERELDRALKDFSISGGTI 245

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           +++   TG ++++ + P YDP+      ++ W NR     FE GS FK+ T A  ++ G+
Sbjct: 246 IVMEPETGSILALANRPAYDPNNFGDFPQKYWRNRAISDGFEPGSTFKIITTATALEEGV 305

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYH-PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
               D F     I V    I  +    +   +  E+ + S N    Q+   +G +    +
Sbjct: 306 VNENDRFVDPGYIIVSGERIKCWKAGGHGSQSFAEVVKNSCNPSFVQVGMRIGKESFYNY 365

Query: 406 LYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           +   G       +LP       P       +   T+SFGHG++ TP+Q   A +A+ N+G
Sbjct: 366 INAFGFGKDTGIKLPGEAEGLLPGFDDIGPVELATMSFGHGITVTPIQLVTAVSAVANDG 425

Query: 464 RLIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
            L+ P  +   R    ++         R V+ + T +    LL + V  G+G +A + G+
Sbjct: 426 MLMKPRLVKEIRTPDGELVKEIKPVRVRQVISEETARRTLKLLEQVVADGTGVQAQIDGY 485

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            +GGKTGTA     K Y   +  +SF+ + P  +P++++L  +             G   
Sbjct: 486 RIGGKTGTA-----KHYGVQVYDSSFIGIVPVDNPRFVILVVLYDVTGFP---YYGGQTA 537

Query: 576 APMVGNIIRRSASMLGVKPVFL 597
           AP+  N+       L + P + 
Sbjct: 538 APLFRNVALDVIRYLDIPPQYS 559


>gi|77919802|ref|YP_357617.1| peptidoglycan synthetase [Pelobacter carbinolicus DSM 2380]
 gi|77545885|gb|ABA89447.1| peptidoglycan synthetase FtsI [Pelobacter carbinolicus DSM 2380]
          Length = 656

 Score =  398 bits (1022), Expect = e-108,   Method: Composition-based stats.
 Identities = 161/562 (28%), Positives = 247/562 (43%), Gaps = 40/562 (7%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDR 122
             SK RI +  VV  + ++ +  R      I  E            I      R  I DR
Sbjct: 7   KSSKIRIALMGVVFTLFFLAVVGRGYWLQVIQNEETVARARRQYKRIIPLTPRRGAIYDR 66

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           NG  LA      S++ EP +V   D     L   L  +    +R+KL+S+ +F WL+RK+
Sbjct: 67  NGAALARSTSVDSIFAEPFRVSDVDASARVLAKPL-GMTRAALRKKLASKRRFVWLQRKV 125

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--GL 240
            P Q   +    L G+ F  E  RFYP    A+ ++G+  +D +G+ G+EK+ D Q  G 
Sbjct: 126 QPDQSAMVRKLKLRGIAFTKEHQRFYPNGQLAAQLLGFTGLDPKGLEGLEKYYDSQLLGQ 185

Query: 241 TRVFTTNK---------------GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
                  K               G  +   + L +D  +Q +  +EL    K   A +  
Sbjct: 186 EGFLVAAKDGRRKGLGASDKVIQGGSHGNSLYLTIDRNLQYLAEKELAVALKDAKARAGS 245

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            V+L+  TGE+++M + P Y+P+   +       NR     FE GS  KVF  A  ++  
Sbjct: 246 VVMLDPVTGEILAMANQPTYNPNAYGRFPAAYRRNRAVCDEFEPGSTLKVFLTAAALNEN 305

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           L   + L D          +    H     LT+ E+   SSNIG+A+I   +  Q + ++
Sbjct: 306 LVQPQRLVDCEKGAFRVGGMTIHDHHPYEQLTVTEVLSKSSNIGSAKIGKILERQRYFDY 365

Query: 406 LYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           L   G   K   + P   +     P+QW       ISFG G++ T LQ A A AA+ N G
Sbjct: 366 LTHFGFGEKTGLDFPGEASGQLRRPNQWFEGDLAAISFGQGMTVTALQLARATAAIANGG 425

Query: 464 RLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPG 514
            L+    + +  ++        S KV+R V+ +     +R+++      GG+G  A VPG
Sbjct: 426 VLMEADLVKQVVDDRGEIVERRSPKVARRVVSQKAAAQVRAMMELVTQEGGTGTLAAVPG 485

Query: 515 FEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
           + VGGKTGTAQKV      YS      SF+   P   P+ ++L  +D PK     Q+  G
Sbjct: 486 YRVGGKTGTAQKVDPVTGGYSADKRVASFVGFAPANHPRIVILVVIDEPKT----QVYGG 541

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +  AP+   +  ++   LGV P
Sbjct: 542 LVAAPVFSRLAGQALLYLGVPP 563


>gi|228992651|ref|ZP_04152577.1| Stage V sporulation protein D [Bacillus pseudomycoides DSM 12442]
 gi|228998697|ref|ZP_04158284.1| Stage V sporulation protein D [Bacillus mycoides Rock3-17]
 gi|228761165|gb|EEM10124.1| Stage V sporulation protein D [Bacillus mycoides Rock3-17]
 gi|228766983|gb|EEM15620.1| Stage V sporulation protein D [Bacillus pseudomycoides DSM 12442]
          Length = 638

 Score =  397 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ E I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKEEIYKRVTKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K + +  L GV    +  R+YP   + SHV+G+   DN+G+ G+E + D +  
Sbjct: 126 KISHDKAKEVRALSLKGVYIAEDSIRYYPFGKYLSHVLGFAGSDNQGLMGLESYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    ++L +D RI  I+ +E+      YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLDLKLTIDSRINTIIEREMNIADSTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVFNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NEKLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 KLFQYIRDFGFGQKTGIDLQGEGKGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       + S             R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFVDPSNNQVVRKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R    ++GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDVLPVMGVEPRKEQ 571


>gi|311068037|ref|YP_003972960.1| penicillin-binding protein [Bacillus atrophaeus 1942]
 gi|310868554|gb|ADP32029.1| penicillin-binding protein [Bacillus atrophaeus 1942]
          Length = 639

 Score =  397 bits (1021), Expect = e-108,   Method: Composition-based stats.
 Identities = 150/566 (26%), Positives = 261/566 (46%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  +               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVLGDKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P    ++L  VL N+  E + + L+ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPVSTSKQLAAVL-NMSEEKVYKHLTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNKKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KYN + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE+++M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILAMSSRPDFDPADYQSVDSSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQYYDKGHTEVDGARLRCWKKGGHGLQTFLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKSFGFGQKTGIDLQGEGTGILFPLDKVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPVAKKQVISEETSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G   AP+VGNI+R S   +GVKP 
Sbjct: 543 FGGTVAAPIVGNIMRDSLPEIGVKPR 568


>gi|229006199|ref|ZP_04163885.1| Stage V sporulation protein D [Bacillus mycoides Rock1-4]
 gi|228755040|gb|EEM04399.1| Stage V sporulation protein D [Bacillus mycoides Rock1-4]
          Length = 638

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ E I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKEEIYKRVTKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K + +  L GV    +  R+YP   + SHV+G+   DN+G+ G+E + D +  
Sbjct: 126 KISHDKAKEVRALSLKGVYIAEDSIRYYPFGKYLSHVLGFAGSDNQGLMGLESYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    ++L +D RI  I+ +E+      YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLDLKLTIDSRINTIIEREMNIADSTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVFNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NEKLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 KLFQYIRDFGFGQKTGIDLQGEGKGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       + S             R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGALYQPYIAKEFVDPSNNQVVRKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R    ++GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDVLPVMGVEPRKEQ 571


>gi|15889384|ref|NP_355065.1| penicillin binding protein 2 [Agrobacterium tumefaciens str. C58]
 gi|15157234|gb|AAK87850.1| penicillin binding protein 2 [Agrobacterium tumefaciens str. C58]
          Length = 580

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 285/542 (52%), Positives = 392/542 (72%), Gaps = 2/542 (0%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
           F+  R+K  A +K+R+G+ I   +  Y ++  R++QYG    E ++     D    SRPD
Sbjct: 30  FEGARKKRAAQAKSRVGLLIFGFIAFYAVVGGRLVQYGMAEQETVSSIAPADRLMASRPD 89

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           ++DRNGE+LATDI T SL+ EPH+++  DE IEKL+ VLP+LD     +KL+S ++FQWL
Sbjct: 90  LLDRNGEVLATDIRTVSLFAEPHRIVDIDEAIEKLRTVLPDLDQRGTYQKLTSNSRFQWL 149

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           RR+L+P+QQ +IL+ G+PGVGFR EK RFYP    A+HVVG+V+IDNRG+ G+E+++D Q
Sbjct: 150 RRQLTPKQQSQILALGIPGVGFRPEKRRFYPGGPTAAHVVGHVNIDNRGVAGMERYVDSQ 209

Query: 239 GLTRVFTTNK-GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           GL  +       ++ L+P++L++DLR+Q+IV + +     K+ A   G V+L+V TGEV+
Sbjct: 210 GLADLTALGMTSDQPLEPVKLSIDLRVQSIVREVVTAAIAKFQAIGAGAVVLDVHTGEVL 269

Query: 298 SMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRN 357
           +M S+PDYDP+   +G KEGW NR+S G FEMGS FK FTIAMG+DSG   + D+FD R 
Sbjct: 270 AMASVPDYDPNNPAEGAKEGWLNRMSNGTFEMGSTFKSFTIAMGLDSGRVRLGDMFDARY 329

Query: 358 PIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLET 417
           PI++G   I D+H + R+L++PEIF++SSNIG A+IAD +G +GHKEFL RLGLL++++T
Sbjct: 330 PIRIGGFTIKDFHGKGRMLSVPEIFQFSSNIGTAKIADTVGTEGHKEFLTRLGLLTRMQT 389

Query: 418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           ELPE+  PS P +WK+I+S+TISFGHG+STTPLQTAVA AAL+N G+LI PTF+ R+RE+
Sbjct: 390 ELPEVALPSQPREWKKINSITISFGHGVSTTPLQTAVAGAALVNGGKLIEPTFLPRTREQ 449

Query: 478 SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN 537
           +++V++ VLK    K MR L       GSGR A V GF VGGKTGTA KV+  RY    N
Sbjct: 450 ADQVAKQVLKPGASKDMRFLFEWNGVNGSGRNARVDGFNVGGKTGTADKVVNGRYVHDKN 509

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT-AGINVAPMVGNIIRRSASMLGVKPVF 596
           FN+FL+ FP  DPQY+VLSF+D PK  + N    AG + APMV +II R+A++LGVKP F
Sbjct: 510 FNAFLSAFPMDDPQYVVLSFIDEPKTDKGNGAALAGTSAAPMVHDIITRTAAVLGVKPKF 569

Query: 597 LK 598
            K
Sbjct: 570 GK 571


>gi|206976757|ref|ZP_03237661.1| sporulation specific penicillin-binding protein [Bacillus cereus
           H3081.97]
 gi|217961337|ref|YP_002339905.1| sporulation specific penicillin-binding protein [Bacillus cereus
           AH187]
 gi|222097361|ref|YP_002531418.1| sporulation specific penicillin-binding protein [Bacillus cereus
           Q1]
 gi|229174582|ref|ZP_04302112.1| Stage V sporulation protein D [Bacillus cereus MM3]
 gi|229198027|ref|ZP_04324741.1| Stage V sporulation protein D [Bacillus cereus m1293]
 gi|206745067|gb|EDZ56470.1| sporulation specific penicillin-binding protein [Bacillus cereus
           H3081.97]
 gi|217064248|gb|ACJ78498.1| sporulation specific penicillin-binding protein [Bacillus cereus
           AH187]
 gi|221241419|gb|ACM14129.1| sporulation specific penicillin-binding protein [Bacillus cereus
           Q1]
 gi|228585506|gb|EEK43610.1| Stage V sporulation protein D [Bacillus cereus m1293]
 gi|228608887|gb|EEK66179.1| Stage V sporulation protein D [Bacillus cereus MM3]
          Length = 638

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|270157405|ref|ZP_06186062.1| peptidoglycan synthetase FtsI [Legionella longbeachae D-4968]
 gi|289164201|ref|YP_003454339.1| transpeptidase involved in septal peptidoglycan synthesis
           (penicillin-binding protein 3) [Legionella longbeachae
           NSW150]
 gi|269989430|gb|EEZ95684.1| peptidoglycan synthetase FtsI [Legionella longbeachae D-4968]
 gi|288857374|emb|CBJ11202.1| transpeptidase involved in septal peptidoglycan synthesis
           (penicillin-binding protein 3) [Legionella longbeachae
           NSW150]
          Length = 555

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 143/550 (26%), Positives = 254/550 (46%), Gaps = 32/550 (5%)

Query: 72  NRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           NR+ +      ++ +IL +R++         +  +  A S+ + +    R  I+DRNG  
Sbjct: 8   NRLIIVSAFFSLLLVILVLRMVDLTVLHRQFLQGQGNARSLRVVDIPAHRGMIMDRNGTP 67

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK---FQWLRRKLS 183
           LA   P  S++V P +     E    L   L     ++ R+ + +E K   F +L+R+L 
Sbjct: 68  LAISTPVESVWVNPKEFAPDKEQFMSLAAYLNFTPQQLSRKIVDAENKELEFVYLQRQLP 127

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P   K+I +  +PGV F+ E  R+YP +   S +VG+ ++D++G+ GIE           
Sbjct: 128 PPLAKQIKALKIPGVNFQKEFKRYYPDSDSISQLVGFTNVDDQGLEGIELAYQDWLKGVV 187

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  RV     G            +  + + L++D R+Q + + EL +  +++ A+S   V
Sbjct: 188 GKKRVIKDRLGRIIDELGVIKEPRPGRDMTLSIDRRLQYLAYSELGKTVEEFAAKSGSVV 247

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++   GE+++M ++P Y+P+   +  K+ + NR     FE GS+ K F+IA  +++GLF
Sbjct: 248 VVDTENGEILAMANVPSYNPNSRGRYDKDTYRNRAVTDTFEPGSVIKTFSIASALETGLF 307

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
               + DT     V             +L +  + ++SSN+G  ++  A   +     L 
Sbjct: 308 KPSTIIDTNPSWMVVHGHAVRDIHNYGVLDVTGVLQHSSNVGVTKMVLASPPEQLIGLLQ 367

Query: 408 RLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
           R G   + E+  P                   T+SFG+GLS T LQ A A     N+G+L
Sbjct: 368 RCGFGQRTESTYPGESEGGIVNAKDANPFVLATLSFGYGLSVTALQLAKANMIFANQGKL 427

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
           IP T +     +       V+K  T + + +++   +  G+GR A VPG+ V GKTGTA+
Sbjct: 428 IPVTLL---HNDPPTPGVQVIKPETAQQVLNMMEAVMKDGTGRAAKVPGYRVAGKTGTAR 484

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
              K  Y D     SF+ + P + P+++V+  +  P    R    A    AP+   ++  
Sbjct: 485 VAGKDGYKDKKYTASFVGIAPVSKPKFVVVVIIHEP---SRKGYYAAAVAAPLFTKVMSG 541

Query: 586 SASMLGVKPV 595
           +  +  +   
Sbjct: 542 ALRLFNIPTD 551


>gi|288553167|ref|YP_003425102.1| stage V sporulation protein [Bacillus pseudofirmus OF4]
 gi|288544327|gb|ADC48210.1| stage V sporulation protein (sporulation specific
           penicillin-binding protein) (spore cortex) [Bacillus
           pseudofirmus OF4]
          Length = 639

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/566 (27%), Positives = 252/566 (44%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + + + L ++ I+A+R+          +             +   R +I DRN
Sbjct: 7   TVRKRLVLVLFLGLAVFTIIALRLGYVQFALGDWLTDRAEDSWSRDVPFEAKRGEIKDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
             +LAT+I   S+ V P +V  P +  EKL  VL  +D +   + ++       L    R
Sbjct: 67  DIVLATNISAPSILVVPRQVKDPADTAEKLASVL-EMDVQKAYQLVTKSESIVRLNPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K++ ++   + +  LPGV    +  R YP  S+ SHV+G+  IDN+G+TG+E++ D +  
Sbjct: 126 KVNKEKASEVRALRLPGVYIAEDSKRHYPFGSYLSHVLGFAGIDNQGLTGLEQYYDEELK 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G    F+T KG              N   +RL +D ++Q I+   L   +  YN + 
Sbjct: 186 GEKGHVSFFSTAKGNRMPNLADEYTAPNNGFDLRLTIDSQVQTIMENHLDIAEATYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR-ISYGIFEMGSIFKVFTIAMGI 342
              + +N +TGE++ M S P YDP    +   E +      +  +E GS FK+ T+A  +
Sbjct: 246 AIAIAMNPNTGEILGMSSRPHYDPENFREVPPEIYNQNKPVWMQYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           + G          D       G  +       +   T  E+ + S N G   + + +G  
Sbjct: 306 EEGEVNLEKDSFHDPGFIEVSGHRLRCWKKGGHGSQTFLEVVQNSCNPGFVVLGERLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G++ TPLQ   A +A
Sbjct: 366 RLFDYIEDFGFGQKTGIDLQGEGKGILFNRDKVGPLELATTAFGQGVAVTPLQQVTAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            IN G L  P       +         ++  + R V+ + T + +R  L   V  G+G+ 
Sbjct: 426 AINGGYLYQPFLAKEWVDPMTNEVVDSQAPIMRRQVISQATSEKVRYALESVVAEGTGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQK    RY +  +  SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AFVDGYRVGGKTGTAQKAKDGRYLENNHIVSFIGFAPADDPQIVVYVAVDNPKDTLQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             GI  AP+VGNII  S   +GV+P 
Sbjct: 543 FGGIVAAPIVGNIIGDSLRAMGVEPR 568


>gi|291484068|dbj|BAI85143.1| penicillin-binding protein [Bacillus subtilis subsp. natto BEST195]
          Length = 646

 Score =  397 bits (1020), Expect = e-108,   Method: Composition-based stats.
 Identities = 149/564 (26%), Positives = 260/564 (46%), Gaps = 43/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P +  ++L  VL N+  E + + ++ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVL-NMSEEKVYKHVTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KY+ + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE++ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
             G   AP+VGNI+R S   LGVK
Sbjct: 543 FGGTVAAPIVGNIMRDSLPELGVK 566


>gi|324327815|gb|ADY23075.1| sporulation specific penicillin-binding protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 638

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKKNQVVSKKTPVAKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|47565787|ref|ZP_00236826.1| penicillin-binding protein 1, putative [Bacillus cereus G9241]
 gi|228987060|ref|ZP_04147185.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229157494|ref|ZP_04285571.1| Stage V sporulation protein D [Bacillus cereus ATCC 4342]
 gi|47557067|gb|EAL15396.1| penicillin-binding protein 1, putative [Bacillus cereus G9241]
 gi|228625944|gb|EEK82694.1| Stage V sporulation protein D [Bacillus cereus ATCC 4342]
 gi|228772654|gb|EEM21095.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
          Length = 638

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|42783009|ref|NP_980256.1| sporulation specific penicillin-binding protein [Bacillus cereus
           ATCC 10987]
 gi|42738936|gb|AAS42864.1| sporulation specific penicillin-binding protein [Bacillus cereus
           ATCC 10987]
          Length = 638

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVAKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|218899069|ref|YP_002447480.1| sporulation specific penicillin-binding protein [Bacillus cereus
           G9842]
 gi|228902421|ref|ZP_04066575.1| Stage V sporulation protein D [Bacillus thuringiensis IBL 4222]
 gi|228941004|ref|ZP_04103562.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228966869|ref|ZP_04127913.1| Stage V sporulation protein D [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228973935|ref|ZP_04134510.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980524|ref|ZP_04140834.1| Stage V sporulation protein D [Bacillus thuringiensis Bt407]
 gi|218543779|gb|ACK96173.1| sporulation specific penicillin-binding protein [Bacillus cereus
           G9842]
 gi|228779344|gb|EEM27601.1| Stage V sporulation protein D [Bacillus thuringiensis Bt407]
 gi|228785801|gb|EEM33805.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792968|gb|EEM40526.1| Stage V sporulation protein D [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228818683|gb|EEM64750.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228857165|gb|EEN01671.1| Stage V sporulation protein D [Bacillus thuringiensis IBL 4222]
 gi|326941685|gb|AEA17581.1| stage V sporulation protein D/sporulation specific
           D,D-transpeptidase [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 638

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|206971139|ref|ZP_03232090.1| sporulation specific penicillin-binding protein [Bacillus cereus
           AH1134]
 gi|228954192|ref|ZP_04116220.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229071415|ref|ZP_04204637.1| Stage V sporulation protein D [Bacillus cereus F65185]
 gi|229081168|ref|ZP_04213678.1| Stage V sporulation protein D [Bacillus cereus Rock4-2]
 gi|229180191|ref|ZP_04307535.1| Stage V sporulation protein D [Bacillus cereus 172560W]
 gi|229192085|ref|ZP_04319054.1| Stage V sporulation protein D [Bacillus cereus ATCC 10876]
 gi|206733911|gb|EDZ51082.1| sporulation specific penicillin-binding protein [Bacillus cereus
           AH1134]
 gi|228591411|gb|EEK49261.1| Stage V sporulation protein D [Bacillus cereus ATCC 10876]
 gi|228603400|gb|EEK60877.1| Stage V sporulation protein D [Bacillus cereus 172560W]
 gi|228702212|gb|EEL54688.1| Stage V sporulation protein D [Bacillus cereus Rock4-2]
 gi|228711706|gb|EEL63659.1| Stage V sporulation protein D [Bacillus cereus F65185]
 gi|228805512|gb|EEM52103.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 638

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GEV+ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEVLGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|30022004|ref|NP_833635.1| stage V sporulation protein D / sporulation specific
           D,D-transpeptidase [Bacillus cereus ATCC 14579]
 gi|218231282|ref|YP_002368715.1| sporulation specific penicillin-binding protein [Bacillus cereus
           B4264]
 gi|228922668|ref|ZP_04085968.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228960133|ref|ZP_04121797.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229047600|ref|ZP_04193190.1| Stage V sporulation protein D [Bacillus cereus AH676]
 gi|229111385|ref|ZP_04240938.1| Stage V sporulation protein D [Bacillus cereus Rock1-15]
 gi|229129193|ref|ZP_04258166.1| Stage V sporulation protein D [Bacillus cereus BDRD-Cer4]
 gi|229146487|ref|ZP_04274858.1| Stage V sporulation protein D [Bacillus cereus BDRD-ST24]
 gi|229152113|ref|ZP_04280308.1| Stage V sporulation protein D [Bacillus cereus m1550]
 gi|296504409|ref|YP_003666109.1| stage V sporulation protein D/sporulation specific
           D,D-transpeptidase [Bacillus thuringiensis BMB171]
 gi|29897560|gb|AAP10836.1| Stage V sporulation protein D / Sporulation specific
           D,D-transpeptidase [Bacillus cereus ATCC 14579]
 gi|218159239|gb|ACK59231.1| sporulation specific penicillin-binding protein [Bacillus cereus
           B4264]
 gi|228631462|gb|EEK88096.1| Stage V sporulation protein D [Bacillus cereus m1550]
 gi|228637120|gb|EEK93579.1| Stage V sporulation protein D [Bacillus cereus BDRD-ST24]
 gi|228654430|gb|EEL10295.1| Stage V sporulation protein D [Bacillus cereus BDRD-Cer4]
 gi|228672161|gb|EEL27452.1| Stage V sporulation protein D [Bacillus cereus Rock1-15]
 gi|228723847|gb|EEL75202.1| Stage V sporulation protein D [Bacillus cereus AH676]
 gi|228799649|gb|EEM46602.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228837097|gb|EEM82438.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|296325461|gb|ADH08389.1| stage V sporulation protein D/sporulation specific
           D,D-transpeptidase [Bacillus thuringiensis BMB171]
          Length = 638

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|83312941|ref|YP_423205.1| cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum magneticum AMB-1]
 gi|82947782|dbj|BAE52646.1| Cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum magneticum AMB-1]
          Length = 588

 Score =  397 bits (1019), Expect = e-108,   Method: Composition-based stats.
 Identities = 212/558 (37%), Positives = 312/558 (55%), Gaps = 22/558 (3%)

Query: 49  GCHMEDGQDL-FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIH---PEPIA 104
           G  ++ G  L     R + I   ++R+ +T +V L+ +  +  R++    +    P+  A
Sbjct: 16  GDDLQAGAALRLDGVRMQAIETGRSRLVVTAMVFLLAFAAIGARMVDVAVVDRNPPKAHA 75

Query: 105 P-SMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVI----SPDEIIEKLQIVLPN 159
                 DE  M R DI DR G +LA+ +PT SL+  P  +       +    +L  VLP 
Sbjct: 76  QPQARSDELQMERGDISDRTGVLLASSLPTVSLFARPEDLKIAKVDVENAAIRLVTVLPE 135

Query: 160 LDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVG 219
           LD E    +LSS  +F +L+R L+P+QQ  + S G+PG+ F   + R YP    ASH VG
Sbjct: 136 LDLEETIERLSSGRQFVYLKRNLTPRQQYDVNSLGIPGLLFEKGERRIYPHGPLASHAVG 195

Query: 220 YVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKY 279
             D+DN+G+ GIEK  +                  P+ L+LD+R+Q IV  EL  + +++
Sbjct: 196 VTDVDNKGVAGIEKRFENALKESRE----------PLALSLDIRVQTIVRNELARSIEEF 245

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
           +A     ++++V TGE+I+MVS+PD+DP++         FNR + G +EMGS FK+F  A
Sbjct: 246 SAVGGTGMVMDVRTGELIAMVSMPDFDPNDPPAPTDPSMFNRATKGAYEMGSTFKLFNTA 305

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           M +D+G   +   FD   P+    H IHD H  NR LTIPEI  +SSNIG+A++A   G 
Sbjct: 306 MVLDNGRANLNSSFDASKPLVFAGHTIHDDHALNRWLTIPEILIHSSNIGSARMALDAGT 365

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
           +  + F+ R+G+L     ELPE+ AP  PS W+ I+++TISFGHGLS TPLQ     AAL
Sbjct: 366 EVQRAFMARIGMLQAPPLELPEVGAPLVPSPWREINTVTISFGHGLSVTPLQLLAGTAAL 425

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
           +N G    PT + R+  ++      V+K  T + MR L+R  VT G+G++A VPG+EVGG
Sbjct: 426 VNGGEYHAPTLLARAPGDAVPAI-RVIKPKTSEAMRQLMRMVVTDGTGKKADVPGYEVGG 484

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAP 577
           KTGTA+KV    Y      +SF+A FP   P+Y VL  +D P+  ++     TAG   AP
Sbjct: 485 KTGTAEKVGNGGYRKKAVLSSFIAAFPMDAPRYAVLMMIDEPQGTKQTYGFITAGWTAAP 544

Query: 578 MVGNIIRRSASMLGVKPV 595
             G +I + A +LG+ P 
Sbjct: 545 AAGRVIAQIAPLLGLMPK 562


>gi|121533600|ref|ZP_01665427.1| Peptidoglycan glycosyltransferase [Thermosinus carboxydivorans
           Nor1]
 gi|121307591|gb|EAX48506.1| Peptidoglycan glycosyltransferase [Thermosinus carboxydivorans
           Nor1]
          Length = 661

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/573 (27%), Positives = 243/573 (42%), Gaps = 48/573 (8%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNID-----EYGMSRPDI 119
           K+    + RI   I   +V  + L  RI     +  + +A  +             R  I
Sbjct: 3   KLADTPRKRIFWFIFGVIVALVALGGRIAWIQFVQGDQLAEKVRYQLQDSLVLQSPRGAI 62

Query: 120 IDRNGEILATDIPTFSLYVEPHKVI----SPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
            DR+G  LA      SLYV P +        + +   L   L  L +  I+ +L+    F
Sbjct: 63  FDRSGRPLAISSMAKSLYVNPDQFKQAGQDAEAVAALLAPHL-GLPAAEIKERLTVNGSF 121

Query: 176 QWLRRKLSPQ----QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
            WL+R L P+        I   GL G  F  E  R+YP  S A+HV+G+V  D+RG+ GI
Sbjct: 122 IWLKRTLEPEAANAVAALIKEHGLKGFDFVEENRRYYPNDSLAAHVLGFVGTDDRGLEGI 181

Query: 232 EKFLDM-----QGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVE 274
           E  LD           + T + G             +  + + L +D  IQ IV Q L +
Sbjct: 182 EHALDKLIRGESQRQIIETDSYGTPIFKSIFALKPRQPGKSVYLTIDSTIQFIVEQSLDK 241

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
              K  A+    +++N  TGE+++M S P Y+P++ ++       NR    ++E GS FK
Sbjct: 242 AMAKTKAKGATVIVMNPRTGEILAMASRPTYNPNQFWRYSANERKNRAISIVYEPGSTFK 301

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQI 393
               A  +  GL    + F  +  I+V    I ++       +T  +I + S N G  Q+
Sbjct: 302 AVVAAAALQEGLVRPDERFVDQGYIEVAGRRIKNWSGDSYGSVTFTDIIKNSINTGFVQV 361

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQ 451
              +G     E+    G       ELP  +      P + +     T++ G  ++ TPLQ
Sbjct: 362 GMRLGAVRLTEYARHFGFGQATGIELPGEEEGILFNPREMRETDLATMAIGQSIAVTPLQ 421

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVT 503
              A AA+ N+G L+ P  +   R+ES  V         R V+  +T +T+ ++L + V 
Sbjct: 422 LLTAMAAIANDGVLLKPHIVKEIRDESGMVVSASPTMPVRQVIGPDTARTLTAMLEKVVA 481

Query: 504 GGSGRRAFVPGFEVGGKTGTAQ--KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
            G G++A VPG+   GKTGTA+  K     Y       SF    P  DPQ + L  +D P
Sbjct: 482 EGGGKKATVPGYRFAGKTGTAERLKEGGGGYEAGHYIASFAGFGPVEDPQVVALVVIDDP 541

Query: 562 KIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           +         G   AP+   I+ +    L ++P
Sbjct: 542 Q----GAYYGGEIAAPVFSEIMTQVMRHLNIRP 570


>gi|116253054|ref|YP_768892.1| penicillin binding protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115257702|emb|CAK08800.1| putative penicillin binding protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 586

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 264/546 (48%), Positives = 374/546 (68%), Gaps = 8/546 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
            +  R+K    +K+R+G+ I+  + +Y ++  R+++Y     E ++  +  D    SRPD
Sbjct: 34  IEGSRKKKSGQAKSRVGLLILGFMGVYAVIGGRLVEYAMKDQEVVSSILPPDRLMASRPD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SETKFQW 177
           I+DRNGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS   + F W
Sbjct: 94  ILDRNGEVLATDIRTVSLFAEPNKIVDADEAVEKLATVLPELDVRDTYKKLSVKTSHFAW 153

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           LRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  + A+H++GYV+IDNRG+ G+EKF+D 
Sbjct: 154 LRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGATAAHILGYVNIDNRGVAGMEKFIDD 213

Query: 238 QGLTRV-FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           QGL  +       ++ L+P+RL++DLR+QNIV   +V     + A+  G  +++V TGEV
Sbjct: 214 QGLADLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVTNFQAKGAGAAVIDVHTGEV 273

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +DSG   + D FD  
Sbjct: 274 LAMASAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDSGKVKMTDSFDAS 333

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             I +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L + GLL+K++
Sbjct: 334 KSIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLTKFGLLTKMQ 393

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE
Sbjct: 394 TELPEVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTRE 453

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           ++++++  V+KK T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TL
Sbjct: 454 QADEIATQVIKKTTSDEIRYLLDFNGYKGSGRVARVPGFSVGSKTGTADKVVNGRYSATL 513

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI----NVAPMVGNIIRRSASMLGV 592
           NFNSF+A FP  DP+Y V++F D PK  E+     G        P+   IIRR+A +LG+
Sbjct: 514 NFNSFIAAFPMNDPRYAVITFCDEPKSGEK--AYGGTISAGTAGPIAREIIRRAAPILGI 571

Query: 593 KPVFLK 598
           +P F +
Sbjct: 572 EPKFGE 577


>gi|158320406|ref|YP_001512913.1| peptidoglycan glycosyltransferase [Alkaliphilus oremlandii OhILAs]
 gi|158140605|gb|ABW18917.1| Peptidoglycan glycosyltransferase [Alkaliphilus oremlandii OhILAs]
          Length = 722

 Score =  396 bits (1018), Expect = e-108,   Method: Composition-based stats.
 Identities = 141/582 (24%), Positives = 247/582 (42%), Gaps = 58/582 (9%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNG 124
           SK R+        ++  +L IR+     +  E                   R  I DRNG
Sbjct: 8   SKRRLLFIFSAVSLVLFLLIIRLGWIQIVKGERYKELADKQQTRDIPIPAKRGVIYDRNG 67

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
           + LA    T +++  P+++  P++    L  +L NLD   +  KL++      +   +  
Sbjct: 68  KELAISASTNTVWGHPNEIAEPEKTASILAGIL-NLDEAEVLTKLTNRQYIVKIAPYIDD 126

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QG 239
              K + +  L G+    +  RFYP  + A++V+G+   DN+G++GIE   +       G
Sbjct: 127 DLAKAVRAERLKGISVAEDNKRFYPYGNFAAYVLGHTTNDNKGMSGIELEYEKYLSGIPG 186

Query: 240 LTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
                T   G +            N   + L +D  IQ+   + +        A+ V  +
Sbjct: 187 RWIKSTDGAGRQLSFSTEKYHQAENGLNVVLTIDEVIQHFSEKAVDNALAINKAKRVSVI 246

Query: 288 ILNVSTGEVISMVSIPDYDPHEAF--------------------KGKKEGWFNRISYGIF 327
           ++++ TGE++SM + PDYDP+E                      +     W N +    +
Sbjct: 247 VMDIRTGEILSMAAKPDYDPNEPRTPLNEELKLQIDQMDQDKKLEAWYAMWRNPLINDTY 306

Query: 328 EMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTIPEIFRYS 385
           E GS FK+ T A  ++ G+ T +  F     + V    I  +     +   T+ E  + S
Sbjct: 307 EPGSTFKLLTTAAALEEGVATPQSTFVDNGHVIVAGTRIRCWRWYNPHGHQTLVEAVQNS 366

Query: 386 SNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGH 443
            N    ++   MG+Q    ++   G+      +LP  +     +      +   TISFG 
Sbjct: 367 CNPVFVELGQRMGVQTFYNYIDGFGISDTTGIDLPGERKSLMYNIKNVGPVELATISFGQ 426

Query: 444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS--------RIVLKKNTVKTMR 495
            +S TP+Q   A +A+ N+G+L+ P  +    ++   V         R V+ + T K MR
Sbjct: 427 SISVTPIQLITAVSAIANDGKLMQPRIVKELTDQDGNVVHRFEETMVRQVISEKTSKVMR 486

Query: 496 SLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVL 555
            ++   V+ G G  A++PG+ VGGKTGTAQKV+  +Y+  L  +SF+ + P  DP+  +L
Sbjct: 487 EIMESVVSDGGGSHAYIPGYRVGGKTGTAQKVVGGKYAQGLYVSSFIGIAPADDPKLAIL 546

Query: 556 SFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           + +D P              AP+   ++  +   L VKP + 
Sbjct: 547 AIVDEP---GGFSTYGSTTAAPIAKEVLEETLRYLDVKPKYT 585


>gi|313200236|ref|YP_004038894.1| peptidoglycan glycosyltransferase [Methylovorus sp. MP688]
 gi|312439552|gb|ADQ83658.1| Peptidoglycan glycosyltransferase [Methylovorus sp. MP688]
          Length = 572

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 145/547 (26%), Positives = 243/547 (44%), Gaps = 31/547 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + ++V +  +  L  R I         +  E  A      +    R  I DR GE L
Sbjct: 13  RRRVLLIVVMAGFAALLGRSIYLQSMHKGFLQKEGDARYSRSMKLPAHRGMITDRFGEPL 72

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A   P  S++  P  V +  + I K+  +L    +E+ ++  ++  +F +++R++ P+  
Sbjct: 73  AISTPVESIWASPPDVQATPQQISKMATLLKMKPAELNKKLANNPREFVYIKRRIPPELA 132

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
           K+++  G+PGV  + E  R+YPA    +H+VG+  ID  G  G E           G  R
Sbjct: 133 KQVMQIGVPGVFMQREYRRYYPAGEVMAHLVGFTGIDENGQEGFELRYQDWLSGKSGSRR 192

Query: 243 VFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V    +G            ++   + L++D +IQ + ++EL    +++ A++   ++L+ 
Sbjct: 193 VIKDRQGHIVEDLEAVKVPQDGHDLVLSIDRKIQYLAYRELAHAVEQFKAKAGAAIVLDA 252

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++M ++P Y+P+           NR     FE GS  K FT A  ++SG FT   
Sbjct: 253 RTGEVLAMANLPTYNPNNPVNMAGRS-RNRAIVDTFEPGSTLKPFTAAAALESGHFTPDT 311

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
              T   I               +LT+ ++ + SSN+G+A++A  +  Q        +G 
Sbjct: 312 HIQTAPGILRIGPATIHDAHPQGMLTVAQVIQKSSNVGSAKMALTLEPQYLWGIYNHMGF 371

Query: 412 LSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
            S      P   +        W+ I   T+SFGHG+S T LQ A A     N+G L P +
Sbjct: 372 GSPTHIGFPGEASGRLRNYKNWRPIEQATMSFGHGISLTLLQLARAYTVFANDGELKPVS 431

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVI 528
            +     +   V + V    T   +R +L   V  GG+  RA + G+ V GKTGTA K+ 
Sbjct: 432 LLKL---KEAPVGQQVFSAKTALAVRDMLELVVQPGGTAPRAQIAGYRVAGKTGTAHKLG 488

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y      +SF+ + P ++P+ I+   +D P      Q   G   AP+   I+  +  
Sbjct: 489 PGGYLADKYVSSFVGLAPASNPRLIIAVMVDEPSS---GQYYGGTVAAPVFSAIMAGALR 545

Query: 589 MLGVKPV 595
           ML V   
Sbjct: 546 MLAVPQD 552


>gi|228909741|ref|ZP_04073564.1| Stage V sporulation protein D [Bacillus thuringiensis IBL 200]
 gi|228850030|gb|EEM94861.1| Stage V sporulation protein D [Bacillus thuringiensis IBL 200]
          Length = 638

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 152/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  E+L  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEELAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|229162851|ref|ZP_04290808.1| Stage V sporulation protein D [Bacillus cereus R309803]
 gi|228620733|gb|EEK77602.1| Stage V sporulation protein D [Bacillus cereus R309803]
          Length = 638

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRVTKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y +     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|253998166|ref|YP_003050229.1| peptidoglycan glycosyltransferase [Methylovorus sp. SIP3-4]
 gi|253984845|gb|ACT49702.1| Peptidoglycan glycosyltransferase [Methylovorus sp. SIP3-4]
          Length = 576

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 145/547 (26%), Positives = 243/547 (44%), Gaps = 31/547 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + ++V +  +  L  R I         +  E  A      +    R  I DR GE L
Sbjct: 17  RRRVLLIVVMAGFAALLGRSIYLQSMHKGFLQKEGDARYSRSMKLPAHRGMITDRFGEPL 76

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A   P  S++  P  V +  + I K+  +L    +E+ ++  ++  +F +++R++ P+  
Sbjct: 77  AISTPVESIWASPPDVQATPQQISKMATLLKMKPAELNKKLANNPREFVYIKRRIPPELA 136

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
           K+++  G+PGV  + E  R+YPA    +H+VG+  ID  G  G E           G  R
Sbjct: 137 KQVMQIGVPGVFMQREYRRYYPAGEVMAHLVGFTGIDENGQEGFELRYQDWLSGKSGSRR 196

Query: 243 VFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V    +G            ++   + L++D +IQ + ++EL    +++ A++   ++L+ 
Sbjct: 197 VIKDRQGHIVEDLEAVKVPQDGHDLVLSIDRKIQYLAYRELAHAVEQFKAKAGAAIVLDA 256

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++M ++P Y+P+           NR     FE GS  K FT A  ++SG FT   
Sbjct: 257 RTGEVLAMANLPTYNPNNPVNMAGRS-RNRAIVDTFEPGSTLKPFTAAAALESGHFTPDT 315

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
              T   I               +LT+ ++ + SSN+G+A++A  +  Q        +G 
Sbjct: 316 HIQTAPGILRIGPATIHDAHPQGMLTVAQVIQKSSNVGSAKMALTLEPQYLWGIYNHMGF 375

Query: 412 LSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
            S      P   +        W+ I   T+SFGHG+S T LQ A A     N+G L P +
Sbjct: 376 GSPTHIGFPGEASGRLRNYKNWRPIEQATMSFGHGISLTLLQLARAYTVFANDGELKPVS 435

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVI 528
            +     +   V + V    T   +R +L   V  GG+  RA + G+ V GKTGTA K+ 
Sbjct: 436 LLKL---KEAPVGQQVFSAKTALAVRDMLELVVQPGGTAPRAQIAGYRVAGKTGTAHKLG 492

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y      +SF+ + P ++P+ I+   +D P      Q   G   AP+   I+  +  
Sbjct: 493 PGGYLADKYVSSFVGLAPASNPRLIIAVMVDEPSS---GQYYGGTVAAPVFSAIMAGALR 549

Query: 589 MLGVKPV 595
           ML V   
Sbjct: 550 MLAVPQD 556


>gi|209550180|ref|YP_002282097.1| peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535936|gb|ACI55871.1| Peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 586

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 262/546 (47%), Positives = 374/546 (68%), Gaps = 8/546 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
            +  R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPD
Sbjct: 34  IEGSRKKKSGQAKSRVGLLILGFMGVYVVIGGRLVEYAMKDQEVVSSILPPDRLMASRPD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SETKFQW 177
           I+DRNGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS   + F W
Sbjct: 94  ILDRNGEVLATDIRTVSLFAEPNKIVDADEAVEKLATVLPELDVRDTYKKLSVKTSHFAW 153

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           LRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EK++D 
Sbjct: 154 LRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKYIDD 213

Query: 238 QGLTRV-FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           QGL  +       ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV
Sbjct: 214 QGLADLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEV 273

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD  
Sbjct: 274 LAMASAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMTDTFDAS 333

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             I +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L + GLL+K++
Sbjct: 334 KSIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLTKFGLLTKMQ 393

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ RSRE
Sbjct: 394 TELPEVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRSRE 453

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           ++++++  V+KK T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TL
Sbjct: 454 QADEIATQVIKKTTSDEIRYLLDFNGYKGSGRVARVPGFAVGSKTGTADKVVNGRYSATL 513

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI----NVAPMVGNIIRRSASMLGV 592
           NFNSF+A FP  DP+Y V++F D PK  E+     G        P+   II R+A +LG+
Sbjct: 514 NFNSFIAAFPINDPKYAVITFCDEPKTGEKQ--YGGTISAGTAGPIAREIISRAAPILGI 571

Query: 593 KPVFLK 598
           +P F +
Sbjct: 572 EPKFGE 577


>gi|119897169|ref|YP_932382.1| peptidoglycan glycosyltransferase [Azoarcus sp. BH72]
 gi|119669582|emb|CAL93495.1| probable peptidoglycan glycosyltransferase [Azoarcus sp. BH72]
          Length = 586

 Score =  396 bits (1017), Expect = e-108,   Method: Composition-based stats.
 Identities = 145/547 (26%), Positives = 240/547 (43%), Gaps = 31/547 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +V+ +   + L  R +         +  +       + E   +R  I DRNG++L
Sbjct: 23  RARFVLVMLMGCSLALIGRALYLQGVNNSFLQAKGEMRYARVLEVPATRGRISDRNGDML 82

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A   P  S++  P           +L  +L  +D   +  KL+    F +L+R+L P+  
Sbjct: 83  AVSTPVRSIWAIPADARLEPAAARQLATLL-EMDVRELNDKLAPGRDFVYLKRQLPPEVA 141

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTR 242
            RI +  LPGV  + E  R+YP     +H++G+  +++RG  GIE   +     M G  R
Sbjct: 142 DRIAALKLPGVHQQQEYRRYYPGGDVTAHMLGFTGVEDRGQEGIELAYEKMLAGMPGSRR 201

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V    +G            ++   I LA+D +IQ I +  L E  +   A++   V+L+ 
Sbjct: 202 VIKDRRGRIVEDVESIRPPRDGDDISLAMDGKIQYIAYSALREAMQLNKAKAGAAVVLDA 261

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV+++ + P Y+P+           NR+    FE GS+ K F   + +++G      
Sbjct: 262 RTGEVLALANAPTYNPNNRSNLTGAQLRNRVFTDSFEPGSVMKPFIAGLALETGKVKPTT 321

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT                ++  LT+ E+ + SSNIG  ++A         +  ++LG 
Sbjct: 322 VIDTSAGRMTIGTATISDSHRSGPLTVAEVIQKSSNIGTVKMALQFTPAEMWQLYHQLGF 381

Query: 412 LSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
            S L    P            W+ I   T+S+GHG+S T +Q A A      +G L+P +
Sbjct: 382 GSPLNLGFPGETGGRLRPAKTWRPIEQATMSYGHGISVTLIQMARAYLVFARDGELVPLS 441

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVI 528
                 +        +    TV+T+R++L      GG+  +A VPG+ VGGKTGTA K+ 
Sbjct: 442 LTKL--DGPPSGGTRIFSPQTVQTLRNMLETVTLPGGTATKAQVPGYRVGGKTGTALKLE 499

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y+      SF+ + P ++P+ +V   +D P         AG   AP+   I+  S  
Sbjct: 500 GGHYTK-RYIASFVGIAPISNPRLVVAVMIDEPSA---GNYYAGTVAAPVFARIMEGSLR 555

Query: 589 MLGVKPV 595
            LGV P 
Sbjct: 556 TLGVAPD 562


>gi|86358456|ref|YP_470348.1| cell division penicillin-binding protein [Rhizobium etli CFN 42]
 gi|86282558|gb|ABC91621.1| cell division penicillin-binding protein [Rhizobium etli CFN 42]
          Length = 585

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 265/546 (48%), Positives = 377/546 (69%), Gaps = 8/546 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
            +  R+K    +K+R+G+ I+  + +Y+++  R+++Y     E ++  +  D    SRPD
Sbjct: 33  IEGSRKKKTGQAKSRVGLLILGFMSVYVVVGGRLVEYAMKDQEVVSSILPPDRLMASRPD 92

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SETKFQW 177
           I+DRNGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS   + F W
Sbjct: 93  ILDRNGEVLATDIRTVSLFAEPNKIVDVDEAVEKLATVLPELDVRDTYKKLSVKSSHFAW 152

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           LRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  S A+H++GYV+IDNRG+ G+EKF+D 
Sbjct: 153 LRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGSTAAHILGYVNIDNRGVAGMEKFIDD 212

Query: 238 QGLTRV-FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           QGL  +       ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV
Sbjct: 213 QGLADLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVNNFQSKGAGAAVIDVHTGEV 272

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           + M S PD+DP+   +G KEGW NR++ G FEMGS FK F++AM +D+G   + D FD  
Sbjct: 273 LGMASAPDFDPNNPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDTGKVKMSDTFDAS 332

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
            PI +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   K++L +LGLL+K++
Sbjct: 333 KPIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKDYLTKLGLLTKMQ 392

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE++ P+ P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE
Sbjct: 393 TELPEVKMPTQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTRE 452

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           E++++++ V+KK+T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TL
Sbjct: 453 EADQIAKQVIKKSTSDEIRYLLDFNGFKGSGRVARVPGFAVGSKTGTADKVVNGRYSSTL 512

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI----NVAPMVGNIIRRSASMLGV 592
           NFNSF+A FP  DP+Y V++F D PK  E+     G        P+   IIRR+A +LG+
Sbjct: 513 NFNSFIAAFPINDPKYAVITFCDEPKTGEKQ--YGGTISAGTAGPIAREIIRRAAPILGI 570

Query: 593 KPVFLK 598
           +P F +
Sbjct: 571 EPKFGE 576


>gi|229086480|ref|ZP_04218652.1| Stage V sporulation protein D [Bacillus cereus Rock3-44]
 gi|228696797|gb|EEL49610.1| Stage V sporulation protein D [Bacillus cereus Rock3-44]
          Length = 638

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 155/569 (27%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  +  E I ++++ +     L    R
Sbjct: 67  GVALATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVQKEEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K + +  L G+    +  R+YP   + SHV+G+  IDN+G+ G+E + D +  
Sbjct: 126 KISHDKAKEVRALSLKGIYIAEDSIRYYPFGKYLSHVLGFAGIDNQGLMGLEAYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             ++   ++L +D RI  I+ +E+      YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPESGLDLKLTIDSRINTIIEREMNIADSTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVFNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NEKLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              E++   G   K   +L            +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 KLFEYIRDFGFGQKTGIDLQGEGKGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       + S             + V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFVDPSNNQVVRKKTPVAKKKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R    ++GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDVLPVMGVEPRKEQ 571


>gi|229075672|ref|ZP_04208654.1| Stage V sporulation protein D [Bacillus cereus Rock4-18]
 gi|229104478|ref|ZP_04235145.1| Stage V sporulation protein D [Bacillus cereus Rock3-28]
 gi|228678920|gb|EEL33130.1| Stage V sporulation protein D [Bacillus cereus Rock3-28]
 gi|228707448|gb|EEL59639.1| Stage V sporulation protein D [Bacillus cereus Rock4-18]
          Length = 638

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRVTKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNIGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ + T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVDKRKVISEETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|304404004|ref|ZP_07385666.1| stage V sporulation protein D [Paenibacillus curdlanolyticus YK9]
 gi|304346982|gb|EFM12814.1| stage V sporulation protein D [Paenibacillus curdlanolyticus YK9]
          Length = 658

 Score =  396 bits (1016), Expect = e-108,   Method: Composition-based stats.
 Identities = 145/568 (25%), Positives = 248/568 (43%), Gaps = 42/568 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + ++  ++ +  L  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRRRMFIALLCGIIAFGGLIGRLAYVQLVKGEDLSAKAENSWRREVPFTPKRGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMI--RRKLSSETKFQWLRRK 181
           G  LA +I + +++  P ++   +   + L  +L      ++   +K  +  K Q   RK
Sbjct: 67  GTRLAYNISSPTIWAIPVQIKDKEGTAKALAPLLGMTPERLLPMLKKKETNVKLQPGGRK 126

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           ++  + ++I +  LPG+    +  R+YP  S A+HV+G+  IDN+G+TGIE   D     
Sbjct: 127 VTLDKAQQIRALALPGIVIGEDNKRYYPYGSLAAHVLGFTGIDNQGLTGIEARYDENLKG 186

Query: 239 --GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G     +   G             K+   ++L +D +IQ I+ +EL +   K + + +
Sbjct: 187 IPGNIAYLSDAAGNLMPGSGDTYQAPKDGLSLQLTIDKQIQTIMERELDQAMAKLHPDHI 246

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGID 343
             + +N   GEV+ M S P Y P +      E +  N   +  +E GS FK+ T+A  I+
Sbjct: 247 IAIAMNPKNGEVLGMSSRPTYQPDQYRNVPTEVYNRNLPVWMTYEPGSTFKIITLAAAIE 306

Query: 344 SGLFT-VKDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
                   + F     ++VG           +   +  E+ + S N G   +   +G + 
Sbjct: 307 EKKVDLKNERFFDPGAVEVGGARLRCWKKGGHGSQSFLEVVQNSCNPGFVALGQRLGKES 366

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +++   G   K   ++   +        +   +   T +FG G+S TP+Q   A AA 
Sbjct: 367 LFDYIRNFGFGKKTGIDISGEENGILFKLSRVGPVELATTAFGQGVSVTPIQQITAVAAA 426

Query: 460 INEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRA 510
           IN G L  P                    +  R V+ ++T K +R  L   V  G+G  A
Sbjct: 427 INGGTLYKPHIAKGWINPDTGETVESIEPEAVRTVISESTSKQVREALESVVAQGTGGNA 486

Query: 511 FVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT 570
           F+ G+ VGGKTGTAQKVI  RYS   +  SF+   P  DPQ +V   +D+P+  +     
Sbjct: 487 FIDGYRVGGKTGTAQKVINGRYSANEHIVSFVGFAPADDPQIVVYLAVDNPQGIQ----F 542

Query: 571 AGINVAPMVGNIIRRSASMLGVKPVFLK 598
            G+  AP+V NI+  S   LGV P   +
Sbjct: 543 GGVVAAPIVRNILEDSLHYLGVPPRAQQ 570


>gi|229098386|ref|ZP_04229331.1| Stage V sporulation protein D [Bacillus cereus Rock3-29]
 gi|229117412|ref|ZP_04246788.1| Stage V sporulation protein D [Bacillus cereus Rock1-3]
 gi|228666022|gb|EEL21488.1| Stage V sporulation protein D [Bacillus cereus Rock1-3]
 gi|228685003|gb|EEL38936.1| Stage V sporulation protein D [Bacillus cereus Rock3-29]
          Length = 638

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRVTKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNIGDDFKKPEAGLNLGLTIDARITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFKLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ + T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVDKRKVISEETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|52141573|ref|YP_085256.1| sporulation specific penicillin-binding protein [Bacillus cereus
           E33L]
 gi|51975042|gb|AAU16592.1| sporulation specific penicillin-binding protein [Bacillus cereus
           E33L]
          Length = 638

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVDKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|15615135|ref|NP_243438.1| stage V sporulation protein (soprulation specific
           penicillin-binding protein) (spore cortex) [Bacillus
           halodurans C-125]
 gi|10175193|dbj|BAB06291.1| stage V sporulation protein (soprulation specific
           penicillin-binding protein) (spore cortex) [Bacillus
           halodurans C-125]
          Length = 644

 Score =  395 bits (1015), Expect = e-108,   Method: Composition-based stats.
 Identities = 154/564 (27%), Positives = 251/564 (44%), Gaps = 43/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++V L  ++I+ +R+          +  +          +   R +I DRN
Sbjct: 7   TVRRRLIFVLLVGLATFLIIMLRLGYVQFALGDWLTGQAQDSWSRDVPFEAKRGEITDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
             +LAT++   S+ V P +V  P E  EKL  VL  +D +     ++       L    R
Sbjct: 67  DVVLATNVSAPSILVVPRQVKDPAETAEKLANVL-QMDRQKAYELITKRESIVRLNPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  +   +    LPGV    +  R YP  S+ SHV+G+  IDN+G+TG+E + D Q  
Sbjct: 126 KISKDKANEVRKLRLPGVYIAEDSKRHYPFGSYLSHVLGFAGIDNQGLTGLELYYDEQLK 185

Query: 239 ---GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G    F+  KG++            N   +RL +D R+Q I+ +EL   +  Y+ + 
Sbjct: 186 GEKGHVSFFSDAKGQRLPNLADEYTAPINGLNLRLTIDSRVQTIIERELDIAEATYSPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR-ISYGIFEMGSIFKVFTIAMGI 342
              + +N +TGE++ M S P Y+P    +   E +      +  +E GS FK+ T+A  +
Sbjct: 246 AIAIAMNPNTGEILGMSSRPHYNPENFREVPPEVYNQNKPIWMQYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +        D F     I+V  H         +   T  E+   S N G   + + +G  
Sbjct: 306 EENEVDLTNDRFHDPGFIEVAGHRLRCWKKGGHGSQTFLEVVENSCNPGFVVLGERLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L         ++     +   T +FG G+S TP+Q   A +A
Sbjct: 366 RLFDYIEAFGFGQKTGIDLQGEAKGIIFNRDRIGPLEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +          + K+ R ++ + T K +R  L   V  G+G+ 
Sbjct: 426 AVNGGYLYEPYVAKDWVDPYTGEVVESSAPKMKRQIISEETSKEVRYALESVVARGTGQG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQK    RY +  +  SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AFVDGYRVGGKTGTAQKAKDGRYLENNHIVSFIGFAPADDPQIVVYVAIDNPKDTVQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
             G+  AP+VG II  S   LG++
Sbjct: 543 FGGVVAAPIVGKIIGDSLQALGIE 566


>gi|30263917|ref|NP_846294.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Ames]
 gi|47529347|ref|YP_020696.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49186765|ref|YP_030017.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Sterne]
 gi|118479135|ref|YP_896286.1| sporulation specific penicillin-binding protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|165872312|ref|ZP_02216949.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0488]
 gi|167636577|ref|ZP_02394871.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0442]
 gi|167641101|ref|ZP_02399356.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0193]
 gi|170688867|ref|ZP_02880070.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0465]
 gi|170709242|ref|ZP_02899663.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0389]
 gi|177655546|ref|ZP_02936956.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0174]
 gi|190565994|ref|ZP_03018913.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035846|ref|ZP_03103248.1| sporulation specific penicillin-binding protein [Bacillus cereus W]
 gi|196038610|ref|ZP_03105918.1| sporulation specific penicillin-binding protein [Bacillus cereus
           NVH0597-99]
 gi|196045950|ref|ZP_03113179.1| sporulation specific penicillin-binding protein [Bacillus cereus
           03BB108]
 gi|225865897|ref|YP_002751275.1| sporulation specific penicillin-binding protein [Bacillus cereus
           03BB102]
 gi|227813175|ref|YP_002813184.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. CDC 684]
 gi|228916553|ref|ZP_04080119.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928964|ref|ZP_04091996.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935231|ref|ZP_04098057.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947635|ref|ZP_04109925.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229092963|ref|ZP_04224095.1| Stage V sporulation protein D [Bacillus cereus Rock3-42]
 gi|229123429|ref|ZP_04252633.1| Stage V sporulation protein D [Bacillus cereus 95/8201]
 gi|229186156|ref|ZP_04313325.1| Stage V sporulation protein D [Bacillus cereus BGSC 6E1]
 gi|229603025|ref|YP_002868151.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0248]
 gi|254683374|ref|ZP_05147234.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. CNEVA-9066]
 gi|254721450|ref|ZP_05183239.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A1055]
 gi|254735956|ref|ZP_05193662.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Western North America USA6153]
 gi|254743851|ref|ZP_05201534.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Kruger B]
 gi|254754374|ref|ZP_05206409.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Vollum]
 gi|254756741|ref|ZP_05208770.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Australia 94]
 gi|301055406|ref|YP_003793617.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           CI]
 gi|30258561|gb|AAP27780.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Ames]
 gi|47504495|gb|AAT33171.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|49180692|gb|AAT56068.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. Sterne]
 gi|118418360|gb|ABK86779.1| sporulation specific penicillin-binding protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|164711988|gb|EDR17528.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0488]
 gi|167510881|gb|EDR86272.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0193]
 gi|167528000|gb|EDR90806.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0442]
 gi|170125849|gb|EDS94755.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0389]
 gi|170667222|gb|EDT17982.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0465]
 gi|172080075|gb|EDT65172.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0174]
 gi|190562913|gb|EDV16879.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991495|gb|EDX55461.1| sporulation specific penicillin-binding protein [Bacillus cereus W]
 gi|196023390|gb|EDX62068.1| sporulation specific penicillin-binding protein [Bacillus cereus
           03BB108]
 gi|196030333|gb|EDX68932.1| sporulation specific penicillin-binding protein [Bacillus cereus
           NVH0597-99]
 gi|225787426|gb|ACO27643.1| sporulation specific penicillin-binding protein [Bacillus cereus
           03BB102]
 gi|227006426|gb|ACP16169.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. CDC 684]
 gi|228597332|gb|EEK54983.1| Stage V sporulation protein D [Bacillus cereus BGSC 6E1]
 gi|228660205|gb|EEL15841.1| Stage V sporulation protein D [Bacillus cereus 95/8201]
 gi|228690417|gb|EEL44202.1| Stage V sporulation protein D [Bacillus cereus Rock3-42]
 gi|228812155|gb|EEM58486.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228824396|gb|EEM70202.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830771|gb|EEM76376.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843132|gb|EEM88214.1| Stage V sporulation protein D [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|229267433|gb|ACQ49070.1| sporulation specific penicillin-binding protein [Bacillus anthracis
           str. A0248]
 gi|300377575|gb|ADK06479.1| sporulation specific penicillin-binding protein [Bacillus cereus
           biovar anthracis str. CI]
          Length = 638

 Score =  395 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVDKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|49478890|ref|YP_037977.1| sporulation specific penicillin-binding protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|49330446|gb|AAT61092.1| sporulation specific penicillin-binding protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 638

 Score =  395 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVDKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|241205563|ref|YP_002976659.1| peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859453|gb|ACS57120.1| Peptidoglycan glycosyltransferase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 586

 Score =  395 bits (1015), Expect = e-107,   Method: Composition-based stats.
 Identities = 263/546 (48%), Positives = 373/546 (68%), Gaps = 8/546 (1%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPD 118
            +  R+K    +K+R+G+ I+  + +Y ++  R+++Y     E ++  +  D    SRPD
Sbjct: 34  IEGSRKKKSGQAKSRVGLLILGFMGVYAVIGGRLVEYAMKDQEVVSSILPPDRLMASRPD 93

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SETKFQW 177
           I+DRNGE+LATDI T SL+ EP+K++  DE +EKL  VLP LD     +KLS   + F W
Sbjct: 94  ILDRNGEVLATDIRTVSLFAEPNKIVDADEAVEKLATVLPELDVRDTYKKLSVKTSHFAW 153

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           LRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  + A+H++GYV+IDNRG+ G+EKF+D 
Sbjct: 154 LRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGATAAHILGYVNIDNRGVAGMEKFIDD 213

Query: 238 QGLTRV-FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           QGL  +       ++ L+P+RL++DLR+QNIV   +V     + ++  G  +++V TGEV
Sbjct: 214 QGLADLASVGMTSDQPLEPVRLSIDLRVQNIVRDAVVNAVTNFQSKGAGAAVIDVHTGEV 273

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M S PD+DP++  +G KEGW NR++ G FEMGS FK F++AM +DSG   + D FD  
Sbjct: 274 LAMASAPDFDPNDPQEGAKEGWLNRMTNGTFEMGSTFKTFSLAMALDSGKVKMTDSFDAS 333

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
             I +G   IHD+H Q R LT+PEIF+YSSNIG A++ D +GI   KE+L + GLL+K++
Sbjct: 334 KSIYIGGFTIHDFHGQRRWLTVPEIFQYSSNIGTARVIDIVGIDAQKEYLTKFGLLTKMQ 393

Query: 417 TELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE 476
           TELPE++ PS P  WK+I+S+TISFGHG+STT LQT VAAAAL+N G+LI PTF+ R+RE
Sbjct: 394 TELPEVKMPSQPRVWKKINSITISFGHGVSTTALQTGVAAAALVNGGKLIEPTFLPRTRE 453

Query: 477 ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTL 536
           ++++++  V+KK T   +R LL      GSGR A VPGF VG KTGTA KV+  RYS TL
Sbjct: 454 QADEIATQVIKKTTSDEIRYLLDFNGYKGSGRVARVPGFGVGSKTGTADKVVNGRYSATL 513

Query: 537 NFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI----NVAPMVGNIIRRSASMLGV 592
           NFNSF+A FP  DP+Y V++F D PK  E+     G        P+   II R+A +LG+
Sbjct: 514 NFNSFIAAFPINDPRYAVITFCDEPKTGEK--AYGGTISAGTAGPIAREIISRAAPILGI 571

Query: 593 KPVFLK 598
           +P F +
Sbjct: 572 EPKFGE 577


>gi|163941655|ref|YP_001646539.1| stage V sporulation protein D [Bacillus weihenstephanensis KBAB4]
 gi|229013100|ref|ZP_04170265.1| Stage V sporulation protein D [Bacillus mycoides DSM 2048]
 gi|229061521|ref|ZP_04198865.1| Stage V sporulation protein D [Bacillus cereus AH603]
 gi|229168656|ref|ZP_04296378.1| Stage V sporulation protein D [Bacillus cereus AH621]
 gi|163863852|gb|ABY44911.1| stage V sporulation protein D [Bacillus weihenstephanensis KBAB4]
 gi|228614812|gb|EEK71915.1| Stage V sporulation protein D [Bacillus cereus AH621]
 gi|228717755|gb|EEL69405.1| Stage V sporulation protein D [Bacillus cereus AH603]
 gi|228748354|gb|EEL98214.1| Stage V sporulation protein D [Bacillus mycoides DSM 2048]
          Length = 638

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + + ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDDVYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDSRITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVAKREVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVEPRKEQ 571


>gi|229031547|ref|ZP_04187547.1| Stage V sporulation protein D [Bacillus cereus AH1271]
 gi|228729836|gb|EEL80816.1| Stage V sporulation protein D [Bacillus cereus AH1271]
          Length = 638

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + + ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEVYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDDGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLASAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVEKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRTEQ 571


>gi|121535925|ref|ZP_01667721.1| stage V sporulation protein D [Thermosinus carboxydivorans Nor1]
 gi|121305496|gb|EAX46442.1| stage V sporulation protein D [Thermosinus carboxydivorans Nor1]
          Length = 696

 Score =  395 bits (1014), Expect = e-107,   Method: Composition-based stats.
 Identities = 139/560 (24%), Positives = 242/560 (43%), Gaps = 38/560 (6%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+ +  +    I   L  R+               +   +        R  I DRN
Sbjct: 9   TIRKRVAILFLCATAIMAGLVCRLAYLQFYKSAWLAENAVDQRVRDIPVEAKRGIIFDRN 68

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G  LA  I T S+Y  P ++ + +E   K    +  LD+  +  KL     F W++RK+ 
Sbjct: 69  GRELAISISTESVYAIPAEIRNHEETAAK-LAAILALDANNLAAKLKKRQAFMWVKRKID 127

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQ 238
               K +    LPG+G   E  R+YP  + A+H++G+  ID++G+ G+E   D       
Sbjct: 128 VNTAKAVKMLNLPGIGLTQESQRYYPQDNVAAHILGFTGIDSQGLDGVELTFDNYLRGRP 187

Query: 239 GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G   V    +G              +   I L +D+ IQ IV +EL    K   A++   
Sbjct: 188 GSIVVEYDARGQEIPQATHRFVPPTDGYNIYLTIDIVIQQIVERELERVMKDTQAKAATI 247

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           +I+   TGE++++ + PDY+P+   +   + W N      +E GS FK+ T A  +   +
Sbjct: 248 IIMKPDTGEILALANRPDYNPNRFAEYSPKLWRNVAVSNAYEPGSTFKIITSAAAMSEKV 307

Query: 347 FTVKDLFDTRNPIKVGKHVIHDY-HPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
             ++D F     ++V    I  + H  +      ++   S N+G   I   +G +   ++
Sbjct: 308 VKLEDRFFDPGSVEVQGRHIRCWKHGGHGSQNFTQVVENSCNVGFVNIGLRLGSEAFYDY 367

Query: 406 LYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           +   G       +LP          ++ K I+  T++ G  ++ TP+Q   A +A+ N+G
Sbjct: 368 IEEFGFGRLTGIDLPGEAKGILIDKTKVKPINIATMAIGQSIAVTPIQLLTAVSAVANDG 427

Query: 464 RLIPPTFMIRSREESEKVSR--------IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
           +L  P  +   R++S ++ R         V++ +  + ++ +L + V  G+GR A++ GF
Sbjct: 428 QLNRPQIVREVRDKSGQIIRGFQVDVINRVMEASVARELKGILEKVVEEGTGRNAYIEGF 487

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            +GGKTGTAQKV    Y       SF+   P   PQ  +L  +D P          G   
Sbjct: 488 RIGGKTGTAQKVGGGGYLPDKYVASFVGFAPADHPQVAMLVIIDEPVGL----YYGGQIA 543

Query: 576 APMVGNIIRRSASMLGVKPV 595
           AP+   +++     L V P 
Sbjct: 544 APVFAAVMKDVLPYLKVAPQ 563


>gi|209884376|ref|YP_002288233.1| peptidoglycan glycosyltransferase [Oligotropha carboxidovorans OM5]
 gi|209872572|gb|ACI92368.1| peptidoglycan glycosyltransferase [Oligotropha carboxidovorans OM5]
          Length = 581

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 227/533 (42%), Positives = 342/533 (64%), Gaps = 4/533 (0%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-MNIDEYGMSRPDIIDRNGEI 126
           A ++ R+G+ ++    ++ ++A+R++ YG +     A    + D    +RPDI+DRNGEI
Sbjct: 32  AKARARVGLVMLAFTAVFAVIALRLVMYGVVGDNHGARRGSSQDAIATARPDILDRNGEI 91

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+   SLY EP ++I  DE IE L   LP+LD   +R +LSS   F WL+R+L+P+Q
Sbjct: 92  LATDVKASSLYAEPRRLIDKDEAIELLTATLPDLDPGEVRDRLSSRKGFVWLKRELTPKQ 151

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q  +   GLPGVGF  E  R YP     SH++G V+IDN+GI G+EK+LD  GL  +   
Sbjct: 152 QHDVFKLGLPGVGFLRENKRVYPTGRDVSHLIGIVNIDNQGIAGMEKWLDGNGLADLHRA 211

Query: 247 NKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
               ++  +PI L++DLR+++ +  EL++ K+K+ A++   ++ NV TGE+++MVS+PD+
Sbjct: 212 GFATDRQQRPIELSVDLRVEHALRDELLKAKEKFRAKAASGIVSNVRTGEIVAMVSLPDF 271

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK FT+AM +DSG  T+  ++D R+ ++ G+  
Sbjct: 272 DPNNPKEANDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKATLNSMWDARSALQYGRFR 331

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD HP  R +   E+F YSSNIGAA+IA + GI+ HK FL ++G L++L TELPE  AP
Sbjct: 332 IHDDHPLGRAINTKEVFTYSSNIGAARIALSQGIEAHKAFLGKMGQLTRLRTELPESAAP 391

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P  W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ RS EE+ K+++ V
Sbjct: 392 LLPRHWGELNTVTIAFGHGIAVAPLQAVMGIDALVNGGYLIPPTFLKRSEEEAMKLAKRV 451

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +KK T   MR L+R     G+ R+A VPG+ +GGKTGTA+KVI  RY+     N+F A+ 
Sbjct: 452 IKKETSDKMRFLMRLNAEIGTARKADVPGYYIGGKTGTAEKVINGRYAKKKVLNAFTAIL 511

Query: 546 PTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
           P  +P++ +L  +D P+         T+G N  P  G +I R A +LGV+P F
Sbjct: 512 PADNPRFQLLVMLDEPQALPETHGFITSGWNAVPTGGKVIARIAPLLGVEPRF 564


>gi|209963952|ref|YP_002296867.1| peptidoglycan synthetase FtsI [Rhodospirillum centenum SW]
 gi|209957418|gb|ACI98054.1| peptidoglycan synthetase FtsI [Rhodospirillum centenum SW]
          Length = 597

 Score =  394 bits (1012), Expect = e-107,   Method: Composition-based stats.
 Identities = 185/538 (34%), Positives = 316/538 (58%), Gaps = 20/538 (3%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIH--PEPIAPSMNIDEYGMSRPDIIDRN 123
            +   ++R+ +T  +  + +  + ++++    +    EP        +   SR DI+DRN
Sbjct: 37  ALEQGRHRLVVTAAMFALAFGAVGLKLLDATVLSRGGEPQVARAAGAKAPTSRADIVDRN 96

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLS 183
           G +LA+ + T SL+ +P  VI P E   +L  VL ++  + +  +L S+ +F W++R L+
Sbjct: 97  GVLLASSLTTESLFADPKLVIDPKEAARRLTEVL-DIKEQDVLAELQSDKRFVWIKRNLT 155

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRV 243
           P+Q   +   G+PG+ F+ E+ R YP  S A+HVVG+  +DN G+ GIE+          
Sbjct: 156 PRQVYEVNRLGIPGLAFQREERRIYPQGSLAAHVVGFSGVDNVGLMGIEQAF-------- 207

Query: 244 FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
               + ++N +P+RL++D+R+Q+I+ +E+      + A     ++++V TGE+++MVS+P
Sbjct: 208 --DRRLKENQEPLRLSIDVRLQHILRREVQTAIDDFQAIGGAGMVMDVKTGELLAMVSLP 265

Query: 304 DYDPHEAF----KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPI 359
           D+DPH       +   +  FNR + G++EMGS FK+F  A+ ++SG   ++D+FD   PI
Sbjct: 266 DFDPHNPPPPQEQQDLDPRFNRNTLGVYEMGSTFKIFNTALALESGRVKLRDMFDATRPI 325

Query: 360 KVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETEL 419
           ++G+  I D+H +NR + + ++F++SSNIG+ ++A+ +G    KEF+ +LG       EL
Sbjct: 326 RIGRFTISDFHAENRWMDVVDVFKHSSNIGSVRMAEQVGPVAQKEFMTKLGFARPASLEL 385

Query: 420 PEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE 479
           PE+  P  P+ W+ ++ +TISFGHG+S +P+    AAA ++N G + P T + R R+ +E
Sbjct: 386 PEMGWPIIPNPWRDVNMMTISFGHGMSVSPVHLVTAAAGVVNGGIMHPATLLKRDRD-AE 444

Query: 480 KVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFN 539
                ++ + T  T+R L+R  VT G+ R A  PG+ VGGKTGTA+KV    Y+     +
Sbjct: 445 IPGTRIVSEQTSDTLRKLMRIVVTEGTARMADAPGYLVGGKTGTAEKVKNGGYARKALIS 504

Query: 540 SFLAVFPTTDPQYIVLSFMDSPKIKER--NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           SFL VFP  DP+Y+V   +D PK  ++     T G   AP  G I+ ++  +LGV+P 
Sbjct: 505 SFLGVFPMNDPKYVVYVMVDEPKGNKKSFGYATGGWVGAPTGGRIVAQAGPLLGVRPQ 562


>gi|229134725|ref|ZP_04263534.1| Stage V sporulation protein D [Bacillus cereus BDRD-ST196]
 gi|228648771|gb|EEL04797.1| Stage V sporulation protein D [Bacillus cereus BDRD-ST196]
          Length = 638

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + + ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDDVYQRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDSRITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVAKREVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVEPRKEQ 571


>gi|78221627|ref|YP_383374.1| penicillin-binding protein, transpeptidase [Geobacter
           metallireducens GS-15]
 gi|78192882|gb|ABB30649.1| peptidoglycan synthetase FtsI [Geobacter metallireducens GS-15]
          Length = 657

 Score =  394 bits (1011), Expect = e-107,   Method: Composition-based stats.
 Identities = 155/558 (27%), Positives = 235/558 (42%), Gaps = 40/558 (7%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNGEIL 127
           RI       ++++ +   R      I  +            I      R  I D NG  L
Sbjct: 12  RIRFIGGFFVLLFALTFCRAFYLQVIKRDYLLKLADRQHQKIIPLTPVRGTIYDANGAAL 71

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  +   S Y EP  +    E   +L  VL  +  E I +KL     F WL+R+L+P   
Sbjct: 72  AVSVEMDSCYAEPKSMEDLGEASAQLAPVL-GMPKESILKKLQGNKNFVWLQRRLTPDVV 130

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTR 242
           KRI    L G+GF  E  RFYP +  A+HV+G+  +D  G+ G+E+  D       G   
Sbjct: 131 KRIRDLDLEGIGFVKETKRFYPNSEVAAHVIGFTGLDPEGLEGVERRYDSTILGGTGYLV 190

Query: 243 VFTTNKGEKN------------LQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
                 G                  + L LD  IQ I  +EL +  +K  A +   ++++
Sbjct: 191 TERDALGRNVALKGTVIQNGAMGHDVTLTLDKNIQYIAEKELAQAVEKSGARAGTALVMD 250

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TG+V++M + P ++ +       + W NR     +E GS FK F +A  ++  +    
Sbjct: 251 PHTGKVLAMANYPTFNLNSHASYSPQVWRNRAVADSYEPGSTFKTFLVAAALEEKVIRPG 310

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
           D  +                 +   L+I E+ +YSSNIGAA+I   +G      +L   G
Sbjct: 311 DGINCEGGSYAIGGRTIHDTHKYGRLSIAEVLKYSSNIGAAKIGSRLGPSRLYTYLKNFG 370

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +  +   +LP     S      W  I   TISFG G++T+ LQ A A +A+ N G L+ P
Sbjct: 371 IGDRSGVDLPGEVGGSLRPWSQWYGIDLATISFGQGVTTSSLQLASAVSAIANGGVLMKP 430

Query: 469 TFMIRSREE--------SEKVSRIVLKKNTVKTMRSLLREG-VTGGSGRRAFVPGFEVGG 519
             + +  +           +V R V+   T KT+  ++      GG+G  A V G+ V G
Sbjct: 431 YLVEKITDSEGNVVTSFEPQVRRRVISPETAKTVSRMMEGVAAEGGTGTNASVEGYRVAG 490

Query: 520 KTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           KTGTAQKV      YS T    SF+   P   P+  +L  +D PK         G+  AP
Sbjct: 491 KTGTAQKVDPVTHGYSATKRTASFIGFVPADRPRITILVVIDEPKTSP----YGGVVAAP 546

Query: 578 MVGNIIRRSASMLGVKPV 595
              +I  ++   L V P 
Sbjct: 547 AFSSIALQTLCYLKVPPD 564


>gi|253576125|ref|ZP_04853457.1| stage V sporulation protein D [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251844468|gb|EES72484.1| stage V sporulation protein D [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 654

 Score =  393 bits (1010), Expect = e-107,   Method: Composition-based stats.
 Identities = 144/569 (25%), Positives = 255/569 (44%), Gaps = 44/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++V  +++  LA+R+          +  +          Y   R +I DRN
Sbjct: 7   TVRRRLFWLLMVLCLLFAALAVRLAYVQIGKGAELSAKAEDSWRRNIPYSAKRGEISDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
           G +LA +I T ++   P ++ +P++  + L  +L  +  E + + ++       L+   R
Sbjct: 67  GTVLAYNITTPTVMAIPVQIKNPEQTAKSLAPLL-GMTEESVLKTITKRQSIVRLQPGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K++ ++ ++I    LPG+    +  R+YP    A+H++G+    N+G+TG+E   D    
Sbjct: 126 KITMEKAQQIRDLALPGIVVAEDNKRYYPFGGLAAHILGFTGGYNQGLTGVESKYDNLLS 185

Query: 237 -MQGLTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
            M G     +   G             K+   + L +D  IQ+I+ +EL +   +  A+S
Sbjct: 186 GMNGSVSYLSDAGGRLMPGSSEKYVEPKDGLNLTLTIDKTIQSIIERELDQAMDRLQADS 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
             T+ +N  TGE++ M + P Y+P    +   E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 ALTIAMNPKTGEILGMAARPGYEPEAYQEYDAEVYNRNLPIWMTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFTV-KDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +     +  + F     +KVG           +   T  ++   S N G   +   +G +
Sbjct: 306 EEKKVDLLNERFFDPGYVKVGGATLRCWKKGGHGSQTFLQVVENSCNPGFVALGQRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G  SK   +L   +        Q   +   T SFG G+S TP+Q   A +A
Sbjct: 366 TLFQYIKNFGFGSKTGIDLNGEENGILFKLSQVGPVELATTSFGQGVSVTPIQQITAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            IN G+L  P                    ++ R V+ + T K +R  L   V  G+G  
Sbjct: 426 AINGGKLYKPYVAKAWTNPETGEVVSENKPQLVRQVISEETSKQIRMALESVVANGTGGN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV+  RYS   +  SF+   P  DPQ +V + +D+P+  +    
Sbjct: 486 AFIDGYRVGGKTGTAQKVVNGRYSQNEHIVSFIGFAPADDPQIVVYTAVDNPQGIQ---- 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+V NI+  +   + V P   +
Sbjct: 542 FGGVVAAPIVRNIMEDALEYMKVPPREQQ 570


>gi|23014462|ref|ZP_00054277.1| COG0768: Cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum magnetotacticum MS-1]
          Length = 588

 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 209/558 (37%), Positives = 315/558 (56%), Gaps = 22/558 (3%)

Query: 49  GCHMEDGQDL-FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIH---PEPIA 104
           G  ++ G  L     R + I   ++R+ +T ++ L+ +  +  R++    I    P+P A
Sbjct: 16  GDDLQAGAALRLDGVRMQAIETGRSRLLITAMIFLLAFFAIGARMVDVAVIDRNPPKPNA 75

Query: 105 P-SMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVI----SPDEIIEKLQIVLPN 159
                 DE  M R DI DR G +LA+ +PT SL+  P  +       +    +L  VLP 
Sbjct: 76  QPQARTDELQMERADISDRTGVLLASSLPTVSLFARPEDLKLAKVDVENAAIRLVTVLPE 135

Query: 160 LDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVG 219
           LD E    +LSS  +F +L+R L+P+QQ  + S G+PG+ F   + R YP    ASH VG
Sbjct: 136 LDLEETIERLSSGRQFVYLKRNLTPRQQYDVNSLGIPGLLFEKGERRIYPHGPLASHAVG 195

Query: 220 YVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKY 279
             D+DN+G+ GIEK  +              ++ +P+ L++D+R+Q IV  EL  + +++
Sbjct: 196 VTDVDNKGVAGIEKRFENAL----------RESSEPLALSIDIRVQTIVRNELARSVEEF 245

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
           +A     ++++V TGE+I+MVS+PD+DP++         FNR + G +EMGS FK+F  A
Sbjct: 246 SAVGGTGMVMDVRTGELIAMVSLPDFDPNDPPAPTDSSMFNRATKGAYEMGSTFKLFNTA 305

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           M +D+G   +   FD   P+    H IHD H  NR LTIPEI  +SSNIG+A++A   G 
Sbjct: 306 MVLDNGRANLNSTFDATRPLVFAGHTIHDDHALNRWLTIPEILIHSSNIGSARMALDAGT 365

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
           +  + F+ R+G+L     ELPE+  P  P+ W+ I+++TI+FGHGLS TPLQ     AAL
Sbjct: 366 ETQRAFMARIGMLQAPPLELPEVGGPLVPNPWREINTVTIAFGHGLSVTPLQLLAGTAAL 425

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
           +N G    PT + RS  ++      V+K  T + MR L+R  VT G+G++A VPG+EVGG
Sbjct: 426 VNGGEYHTPTLLARSPGDAVP-GIRVIKPKTSENMRQLMRMVVTEGTGKKADVPGYEVGG 484

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER--NQLTAGINVAP 577
           KTGTA+K     Y      +SF+A FP   P+Y VL  +D P+  ++    +TAG   AP
Sbjct: 485 KTGTAEKAGAGGYRKKAVLSSFIAAFPMDAPRYAVLMMIDEPQATKQTFGFITAGWTAAP 544

Query: 578 MVGNIIRRSASMLGVKPV 595
             G +I + A +LG+ P 
Sbjct: 545 AAGRVIAQIAPLLGLMPK 562


>gi|229019119|ref|ZP_04175953.1| Stage V sporulation protein D [Bacillus cereus AH1273]
 gi|229025362|ref|ZP_04181780.1| Stage V sporulation protein D [Bacillus cereus AH1272]
 gi|228735947|gb|EEL86524.1| Stage V sporulation protein D [Bacillus cereus AH1272]
 gi|228742135|gb|EEL92301.1| Stage V sporulation protein D [Bacillus cereus AH1273]
          Length = 638

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 154/569 (27%), Positives = 254/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I  +++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDDIYTRVTKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDKGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDSRITRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G  
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLRCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKD 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAKEFIDPKNNQVVSKKTPVAKREVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A++ G+ VGGKTGTAQKV   +Y D     SF+   P  DPQ +V   +D+PK   +   
Sbjct: 486 AYIDGYRVGGKTGTAQKVKDGKYLDNNYIVSFIGFAPADDPQIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GV+P   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVEPRKEQ 571


>gi|225175503|ref|ZP_03729497.1| Peptidoglycan glycosyltransferase [Dethiobacter alkaliphilus AHT 1]
 gi|225168832|gb|EEG77632.1| Peptidoglycan glycosyltransferase [Dethiobacter alkaliphilus AHT 1]
          Length = 705

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 140/571 (24%), Positives = 242/571 (42%), Gaps = 43/571 (7%)

Query: 62  RRRKVIA--HSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
            RR  ++    K R+       ++  + L +R+          +  +        D    
Sbjct: 1   MRRNTVSNVTVKKRLIFLFFCMVLAIVALLLRLFWLQIVVAGELQAKAWDQWTRGDPVRA 60

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
            R DI+DRN ++LA    + S+   P ++   +E   KL  VL +++ E +  +L  ++ 
Sbjct: 61  PRGDILDRNEQLLAGSASSVSILAYPAQIEDKEEAARKLAPVL-DMEEEAVLERLQRQSS 119

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
             +L+RK+  +    I    + G+ F LE  R+YP    AS ++G+  ID  G++G+E  
Sbjct: 120 SVYLKRKMDEEDVLEIRKLEIRGIRFSLEPKRYYPHERLASQLLGFSGID-EGLSGLEYR 178

Query: 235 LDMQ-----GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKK 277
            + +     G     T   G +            +   + L +D  IQ I+ QE+     
Sbjct: 179 YEEELKGRDGRAEFQTDGLGRQIPQGVQTFNPPIDGHDLILTVDQNIQFIMEQEMERAML 238

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
            +  E +  V ++ +TG ++ +   PD+DP+       E W         E GS FK+ T
Sbjct: 239 DWEPEEIIAVAVDPNTGGILGIAGKPDFDPNNYADYPPEQWQLTPVSSSIEPGSTFKLVT 298

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKH---VIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
           +A  I+ G F  ++ F     ++V              +  +   E+   S N G   + 
Sbjct: 299 LAAAIEEGEFHAEEGFFCSGSMQVAGSTIGCWTRSRGGHGAINFTEVVLGSCNPGFITLG 358

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQT 452
             +G + H  +L   G   +   ++          P Q+  + + T SFG G+S TP+Q 
Sbjct: 359 QRIGSEKHMHYLEAFGFGRRTGIDVMGEGLGIMFTPEQFGPVEAATTSFGQGVSVTPIQQ 418

Query: 453 AVAAAALINEGRLIPPTFMIRSRE--------ESEKVSRIVLKKNTVKTMRSLLREGVTG 504
            +A AA+IN G L+ P  +   R+           +V R V+ + T + +R ++   VT 
Sbjct: 419 LMAVAAMINGGYLMTPYVVDEIRDSEGNVVRKTEPQVVRRVVSEETSQEVRRIMELVVTE 478

Query: 505 GSGRRAFVPGFEVGGKTGTAQKVIKKR-YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           GSG  A V G+ +GGKTGTAQKV     Y       SF+   P  DPQ ++   +D+P+ 
Sbjct: 479 GSGMNAHVEGYRIGGKTGTAQKVGPGGVYISGEYILSFIGFVPAEDPQILLYIAVDNPQG 538

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
             +         AP+   +  R    L + P
Sbjct: 539 VPQ---WGSQVSAPLFKRMAERMLKYLNIPP 566


>gi|218905046|ref|YP_002452880.1| sporulation specific penicillin-binding protein [Bacillus cereus
           AH820]
 gi|218535900|gb|ACK88298.1| sporulation specific penicillin-binding protein [Bacillus cereus
           AH820]
          Length = 638

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 155/569 (27%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            IN G L  P       +               R V+ K T + +R  L   V  GSG+ 
Sbjct: 426 AINGGTLYQPYIAKEFIDPKNNQVVSKKTPVDKRKVISKETSEKVRYALENVVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|89099602|ref|ZP_01172477.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Bacillus sp. NRRL B-14911]
 gi|89085755|gb|EAR64881.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Bacillus sp. NRRL B-14911]
          Length = 627

 Score =  392 bits (1008), Expect = e-107,   Method: Composition-based stats.
 Identities = 151/563 (26%), Positives = 264/563 (46%), Gaps = 42/563 (7%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEILA 128
           + + ++  ++I+ I+ IR+             E          +   R +I+DRNG  LA
Sbjct: 1   MTIALLAGILIFFIIDIRLGYVQFFLGSMLTDEAKELWSRDIPFEPERGEIVDRNGVALA 60

Query: 129 TDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRKLSPQQ 186
           T++   ++YV P +V  PDE  EKL  +L N+  E   + ++ +     +   RK+S ++
Sbjct: 61  TNVSAPTVYVVPRQVKDPDETAEKLAAIL-NMSEEKALQLITKQASSVKIPEGRKISHEK 119

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLT 241
              I + G+ GV    +  R YP  ++ SHV+G+  IDN+G+ G+E + D      +G  
Sbjct: 120 ATEIRAEGMAGVYIAEDSKRHYPFGNYLSHVLGFAGIDNQGLMGLELYYDKDLKGEKGSV 179

Query: 242 RVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
           + +   KG              +   ++L +D ++Q IV +EL   +  YN + +  + +
Sbjct: 180 KFYANAKGQRMNDMADDYKPPVDGMDLKLTIDSKVQTIVERELDIAEAAYNPDGIIAIAM 239

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           N +TGE+++M S PD+DP        + +  N   +  +E GS FK+ T+A  ++ G   
Sbjct: 240 NPNTGEILAMSSRPDFDPANFRNVAPDIYNRNLPVWSSYEPGSTFKIITLAAALEEGKVD 299

Query: 349 -VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
             +D F      +VG   +  +    +   +  E+ + S N G  ++ + +G +   +++
Sbjct: 300 LAEDHFHDPGYTEVGGAKLRCWKRGGHGSQSFLEVVQNSCNPGFVELGERLGKETLFKYI 359

Query: 407 YRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  +K   +L                +   T +FG G+S TP+Q   A +A +N G 
Sbjct: 360 KDFGFGAKTGIDLQGESKGILFDLENVGPVELATTAFGQGVSVTPIQQVAAISAAVNGGT 419

Query: 465 LIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
           L  P       +          + +  R V+ + T K +R  L   V  GSG++AFV G+
Sbjct: 420 LYTPFIAKELIDPASGEIVMRKTPEAKRKVISEETSKEIRLALESVVAQGSGKKAFVDGY 479

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            VGGKTGTAQK    RY +  +  SF+   P  DP+ +V   +D+PK   +     G+  
Sbjct: 480 RVGGKTGTAQKAENGRYLENNHIVSFIGFAPADDPELVVYVAVDNPKGTIQ---FGGVVA 536

Query: 576 APMVGNIIRRSASMLGVKPVFLK 598
           AP+VGNI+  S   +GV+P   +
Sbjct: 537 APIVGNIMGDSLRAMGVEPRKEQ 559


>gi|154252857|ref|YP_001413681.1| peptidoglycan glycosyltransferase [Parvibaculum lavamentivorans
           DS-1]
 gi|154156807|gb|ABS64024.1| Peptidoglycan glycosyltransferase [Parvibaculum lavamentivorans
           DS-1]
          Length = 587

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 201/530 (37%), Positives = 313/530 (59%), Gaps = 5/530 (0%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
              S+ RI + + + +  + ++  R++    +     +  +      + RPD++DRNGE+
Sbjct: 37  RTPSQRRIFLALTIFVACFTLVGARLVGLAIVGNSMESTIIAAGPTQIHRPDVVDRNGEV 96

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           +ATDI T SL+ +   VI P E  ++L  VLP+LD+  + RKL+S   F WL+R L+P+Q
Sbjct: 97  MATDIATASLFADGRYVIDPVETAQQLVSVLPDLDAADVARKLASGKAFIWLKRDLTPKQ 156

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q  +   GLPG+ FR EK R YP     S+V+G VD+DNRG  GIE+++D +   R    
Sbjct: 157 QYAVHYLGLPGLDFRNEKRRVYPNGKTGSNVLGMVDLDNRGTAGIERYMDRELARRDEFD 216

Query: 247 NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYD 306
                    + L+LDL +Q+ +  EL +  ++++A     VI++V TGEV++M S+PD+D
Sbjct: 217 LPRFDRGTTVMLSLDLHVQHALRDELEKAMREFSALGAAGVIMDVHTGEVVAMTSLPDFD 276

Query: 307 PHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVI 366
           P++      E  FNR + G++EMGS+FK  T+A  +DSG   +   FD   P+KV +  I
Sbjct: 277 PNDPMSSPDETRFNRATLGVYEMGSVFKAVTLAAALDSGKVDLNGSFDATKPLKVARFTI 336

Query: 367 HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS 426
           HD+H +NR L++PE+F +SSNIG A+IA  +G + H+ +L R GLL++ + ELPE  AP 
Sbjct: 337 HDFHAENRWLSVPEVFIHSSNIGTAKIALQLGGEEHRAYLGRFGLLTRPDIELPEAGAPL 396

Query: 427 YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVL 486
            P++W  + ++T S+GHG++ TPLQ   A + ++N G  + PTF+        ++   V+
Sbjct: 397 LPARWGELATITTSYGHGIAVTPLQVVSAVSTIVNGGFKVKPTFLRH---NEPRLGERVV 453

Query: 487 KKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFP 546
              T   MR LLR  V  G+G++A VPGF V GKTGTA+K    RY+      SF++ FP
Sbjct: 454 STETSNVMRGLLRMVVAEGTGKKADVPGFPVMGKTGTAEKPENGRYARNKLITSFISAFP 513

Query: 547 TTDPQYIVLSFMDSPKIKERNQLT--AGINVAPMVGNIIRRSASMLGVKP 594
             DP+Y ++   D PK  +       AG N AP+   ++ R A +LG++P
Sbjct: 514 ANDPRYAMIVMFDEPKATKDTYGYATAGWNAAPVTARVVSRVAPLLGIRP 563


>gi|317121702|ref|YP_004101705.1| peptidoglycan glycosyltransferase [Thermaerobacter marianensis DSM
           12885]
 gi|315591682|gb|ADU50978.1| Peptidoglycan glycosyltransferase [Thermaerobacter marianensis DSM
           12885]
          Length = 718

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 149/567 (26%), Positives = 247/567 (43%), Gaps = 49/567 (8%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-----SMNIDEYGMSRPDIIDRNGE 125
           + RI +  +V  +   +LA R++    +  E +        +        R DI+DRNG 
Sbjct: 19  RRRILLVFLVFSLALAVLAGRLVTIQVVRGEALRQKALDMRLWQVPVQARRGDIVDRNGR 78

Query: 126 ILATDIPTFSLYVEPHKVI--------SPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
            LA      ++YV P ++           +E  ++L  VL  +D E +  KL+    F +
Sbjct: 79  PLAISTDVDTVYVAPAELQEAARKGQVDIEEAAQQLARVL-KMDPEEVYEKLTVPHAFWY 137

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           ++R+++  + + +    +PGV    E  RFYP    A+HV+G+  +DN+G+ GIE + D 
Sbjct: 138 VKRRVTDAESRAVRQLDIPGVHITQEARRFYPKGELAAHVLGFAGLDNQGLEGIEAYYDR 197

Query: 238 Q-----GLTRVFTTNKG--------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
           +     G         G                    +RL +D  IQ I  +EL     +
Sbjct: 198 KLAGKDGYIATEYDALGRPIRLPTVQARYVRPTPGLTLRLTIDETIQYIAERELERAVVQ 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
             A+    V+++  TG ++++ S P YDP+      ++ W  +     F  GSIFK+ T 
Sbjct: 258 NGAKGGVIVVMDPKTGGILALASRPTYDPNRFADFPRQNWRIKPVADAFPPGSIFKIITG 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAM 397
           +  +D+G  T   + D    + VG   I +++      +   + F +SSN+   ++A A+
Sbjct: 318 SAAVDAGKVTPDTIVDDPGFLTVGGESISNWNQAGLGSVPFRDGFAHSSNVVFGKMALAL 377

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRI--HSLTISFGHGLSTTPLQTAVA 455
           G      +L +  +      +LP       P   +        + FG  L+TTP+Q A A
Sbjct: 378 GKPVFYRYLDQFHIGRPTGIDLPGEATGIVPPMDQATLLDLAIMGFGQTLTTTPIQMAAA 437

Query: 456 AAALINEGRLIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVTGGSG 507
            AA+ N+G    P       +    V         R V+K  T +T+R L+R  V  G+G
Sbjct: 438 VAAVANDGLWQTPHLADAWLDPEGNVVEQVQPAERRQVIKPETARTIRELMRGVVEQGTG 497

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
           RRA +PG++VGGKTGTA KV   R        SF  + P  +P+  ++  +D P      
Sbjct: 498 RRAQIPGYDVGGKTGTANKVEGGRVVQ-KYIGSFAGLVPVEEPRLAIVVSIDEPSGI--- 553

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G   AP+   + R     LGV P
Sbjct: 554 -YYGGYVAAPVFQAVARDVLRYLGVPP 579


>gi|212639661|ref|YP_002316181.1| stage V sporulation protein D [Anoxybacillus flavithermus WK1]
 gi|212561141|gb|ACJ34196.1| Stage V sporulation protein D (penicillin-binding protein)
           [Anoxybacillus flavithermus WK1]
          Length = 624

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 150/559 (26%), Positives = 259/559 (46%), Gaps = 43/559 (7%)

Query: 79  VVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRNGEILATDIPT 133
           ++   I+ I+ IR+     +  + +             +   R +I+DRNG  LAT++  
Sbjct: 1   MIGFFIFAIIDIRLGYVQFVLGDMLTERAKDLWSRNIPFEPERGEIVDRNGVPLATNMSA 60

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RRKLSPQQQKRI 190
            S+ V P ++ +P E+ ++L  +L N+  E   + ++ +T  + +    RK+S +Q K+I
Sbjct: 61  PSVLVVPRQIENPSEVAKELARIL-NMPVEKAYKHVTKKTSIERIHPEGRKISNEQAKQI 119

Query: 191 LSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFT 245
              G+ GV    +  R+YP  S+ SHV+G+  IDN+G+ G+E + D Q     G  + ++
Sbjct: 120 RDLGMKGVYIAEDSKRYYPFGSYLSHVLGFAGIDNQGLMGLELYYDKQLSGKPGSVQFYS 179

Query: 246 TNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
             KG++            +   ++L +D R+Q I+ +EL   +  Y  + +  + +N + 
Sbjct: 180 DAKGKRMPGMADAYTPPVDGLDLKLTIDTRVQTILERELTIAEATYRPDGIIAIAMNPNN 239

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFT--VK 350
           GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  ++        +
Sbjct: 240 GEILGMASRPTFDPADFQNVPPEIFNRNLPIWSTYEPGSTFKIITLAAALEEKKVDLLKE 299

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
             +D       G  +       +   T  E+ + S N G  ++ + +G     E++   G
Sbjct: 300 HFYDPGYVKVAGATLHCWKRGGHGDQTFLEVVQNSCNPGFVELGNRLGKDKLFEYIRAFG 359

Query: 411 LLSKLETELPEIQAPSYPSQW--KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
              K   +L                +   T +FG G++ TP+Q   A AA +N G L  P
Sbjct: 360 FGEKTGIDLQGEGKGILFPLHRVGPVEQATTAFGQGVAVTPIQQVAAVAAAVNGGILYQP 419

Query: 469 TFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGG 519
                  +         ++ K  R V+ + T K +R  L   V  G+G+ AFV G+ VGG
Sbjct: 420 YIAKEWLDPVTGEVIQRQTPKAKRRVISEETSKQIRYALESVVAQGTGKGAFVDGYRVGG 479

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMV 579
           KTGTAQK    +Y    +  SF+   P  DPQ +V   +D+PK   +     G+  AP+V
Sbjct: 480 KTGTAQKAKDGQYLKDNHIVSFIGFAPADDPQIVVYVAVDNPKGTVQ---FGGVVAAPIV 536

Query: 580 GNIIRRSASMLGVKPVFLK 598
           GNI+  S   LGVKP   +
Sbjct: 537 GNIMEDSLRALGVKPRKQQ 555


>gi|222086450|ref|YP_002544984.1| cell division penicillin-binding protein [Agrobacterium radiobacter
           K84]
 gi|221723898|gb|ACM27054.1| cell division penicillin-binding protein [Agrobacterium radiobacter
           K84]
          Length = 583

 Score =  392 bits (1006), Expect = e-106,   Method: Composition-based stats.
 Identities = 275/546 (50%), Positives = 387/546 (70%), Gaps = 2/546 (0%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGM 114
           G   F+  R++    +K+R+ + +    ++Y I+  R+ Q+    P+  +  +  D    
Sbjct: 29  GSSTFEGVRKRKSNQAKSRVVLLVASFTIVYCIIGGRLAQFAMTAPDTTSSILPPDRLMA 88

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS-SET 173
           SRPDI+DRNG +LATDI T SL+ EP+K+I PDE +E+L+ VLP+LD++   +KL+   +
Sbjct: 89  SRPDIVDRNGALLATDIRTVSLFAEPNKIIDPDEAVEELRTVLPDLDTKGTYKKLAVKTS 148

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F WLRR+L+P+QQ +IL+ G+PG+GFR EK RFYP  S ASH++GYV+IDNRG+ G+EK
Sbjct: 149 HFAWLRRQLTPKQQSQILALGIPGIGFRPEKRRFYPGGSTASHILGYVNIDNRGVAGMEK 208

Query: 234 FLDMQGLTRVFTTNK-GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVS 292
           ++D QGL  +        + LQP++L++DLR+Q+IVH  +V     + A+  G V+L+V 
Sbjct: 209 YIDDQGLADLAAAGMTNSQPLQPVKLSIDLRVQDIVHDAVVNAVNNFQAKGAGAVVLDVH 268

Query: 293 TGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDL 352
           TGEV++M S PD+DP+   +   EGW NR++ G FEMGS FK FT+AM  DSG  T++D 
Sbjct: 269 TGEVLAMASAPDFDPNYPNESASEGWLNRMTNGTFEMGSTFKTFTMAMAFDSGKVTLRDA 328

Query: 353 FDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
           FD  NPI++G   I D+H Q R+LT+PEIF+YSSNIG A+IAD +GI GHKEFL R+GLL
Sbjct: 329 FDATNPIRIGGFTIKDFHGQRRVLTVPEIFQYSSNIGTAKIADLVGIDGHKEFLTRIGLL 388

Query: 413 SKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
           SK+ TELPE++ PS P  WK+I+S+TISFGHG+STTPLQTAVA AAL+N G+LI PTF+ 
Sbjct: 389 SKMHTELPEVKMPSQPRVWKKINSITISFGHGVSTTPLQTAVAGAALVNGGKLIDPTFLP 448

Query: 473 RSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRY 532
           R+R E++ +++ V+KK+T   +R LL    + GSGR A VPG++VG KTGTA KV+  RY
Sbjct: 449 RNRSEADDIAKTVIKKSTSDNVRFLLDFNGSKGSGRAARVPGYDVGSKTGTADKVVHGRY 508

Query: 533 SDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGV 592
           S+TLNFN+FLA FP  +PQYI+++F D PK  E     +    AP+  +II R+A +LG+
Sbjct: 509 SNTLNFNTFLAAFPIDNPQYIIMTFCDEPKTGEHGGTISAFTAAPIARDIIARAAPILGI 568

Query: 593 KPVFLK 598
           +P F K
Sbjct: 569 QPSFGK 574


>gi|313901508|ref|ZP_07834956.1| Peptidoglycan glycosyltransferase [Thermaerobacter subterraneus DSM
           13965]
 gi|313468221|gb|EFR63687.1| Peptidoglycan glycosyltransferase [Thermaerobacter subterraneus DSM
           13965]
          Length = 718

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 149/567 (26%), Positives = 252/567 (44%), Gaps = 49/567 (8%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAP-----SMNIDEYGMSRPDIIDRNGE 125
           + RI +  ++  +   +LA R++    +  E +        +        R DI+DRNG 
Sbjct: 19  RRRILLVFLLFTLALAVLAGRLVTIQVVRGEALRQKALDMRLWQVPVQARRGDIVDRNGR 78

Query: 126 ILATDIPTFSLYVEPHKVI--------SPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
            LAT     ++YV P ++           ++  ++L  VL ++D + +  KL+    F +
Sbjct: 79  PLATSTDVDTVYVAPAELQEAARKGQVDIEQAAQELARVL-HMDPQEVYEKLTVPHAFWY 137

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           ++R+++  + + +    +PGV    E  RFYP    A+HV+G+  +DN+G+ GIE + D 
Sbjct: 138 VKRRVTDAESRAVRQLDIPGVHITQEARRFYPKGELAAHVLGFAGVDNQGLEGIEAYYDG 197

Query: 238 Q-----GLTRVFTTNKGE--------------KNLQPIRLALDLRIQNIVHQELVENKKK 278
           +     G         G                    +RL +D  IQ I  +EL     +
Sbjct: 198 KLSGKDGYIATEYDALGRPIRLPTVQARYVRPVPGLTLRLTIDETIQYIAERELERAVIQ 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A+    V+++  TG ++++ S P YDP+      ++ W  +     F  GSIFK+ T 
Sbjct: 258 HGAKGGVIVVMDPRTGGILALASRPTYDPNRFADFPRQSWRTKPVADAFPPGSIFKIITG 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAM 397
           +  +D+G  T   + D    + VG   I +++      +   E F +SSN+   ++A A+
Sbjct: 318 SAAVDAGKVTPDTIVDDPGFLTVGGETISNWNQAGLGSVPFREGFAHSSNVVFGKMALAL 377

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHSLTISFGHGLSTTPLQTAVA 455
           G     ++L R  +      +LP       P       +    + FG  L+TTP+Q A A
Sbjct: 378 GKPLFYQYLDRFHIGRLTGIDLPGEATGIVPPMDRASPLDLAIMGFGQTLTTTPIQMAAA 437

Query: 456 AAALINEGRLIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVTGGSG 507
            AA+ N+G    P       +   +V         R V+K  T +T+R L+R  V  G+G
Sbjct: 438 VAAVANDGMWQTPHLAQAWLDPEGQVVEEVQPAERRQVIKPETARTIRELMRGVVEQGTG 497

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
            RA +PG++VGGKTGTA KV K R        SF  + P  +P+  ++  +D P      
Sbjct: 498 SRARIPGYDVGGKTGTANKVEKGRVVQ-KYIGSFAGLVPVEEPRLAIVVSIDEPSGI--- 553

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G   AP+   + R     LGV P
Sbjct: 554 -YYGGYVAAPVFQAVARDVLRYLGVPP 579


>gi|127514387|ref|YP_001095584.1| peptidoglycan glycosyltransferase [Shewanella loihica PV-4]
 gi|126639682|gb|ABO25325.1| peptidoglycan synthetase FtsI [Shewanella loihica PV-4]
          Length = 578

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 138/565 (24%), Positives = 252/565 (44%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R++       R+ + +    +++  L  R           +  E    ++      +
Sbjct: 4   QAKRKQKPQLIHWRLYVVVGFVCLLFTSLVGRAAYIQIIEPEKLRHESDMRTLRTTSNEV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRR-K 168
            R  I DRNGE+LA  +P  ++Y +P  V   +   +      L  VL     E++ R +
Sbjct: 64  HRGMITDRNGEMLAVSVPVKAVYADPKVVHDRNGFADMRRWQALADVLHEPKEEILARVQ 123

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            + + +F +L+R+++P   + I    LPGV  + E  R+YP +  ++ +VG  +ID++GI
Sbjct: 124 TNPKKRFTYLKRQVTPAVAEYIKQLKLPGVYLKAESRRYYPTSEISAQLVGLTNIDDKGI 183

Query: 229 TGIEKFLDMQGLT-----RVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            GIE   +          +V  +  G            ++   + L++D RIQ + ++E+
Sbjct: 184 EGIESTYNDWLTGTPTKHKVRKSRDGHVVERLDTVQTGESSNDLVLSIDQRIQQLAYREI 243

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +   A S   V+L+V TGEV++M + P Y+P+     +     NR     +E GS 
Sbjct: 244 KRATEINQATSASIVVLDVHTGEVLAMANTPSYNPNSRDNLQSYRMRNRALTDAYEPGST 303

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G      +F T          I         +++ ++  +SSN+G  Q
Sbjct: 304 IKPFVVAAALEAGTIKEDQIFKTHPGRVRIGGKIVRDGRNYGDMSLGDVLVHSSNVGMTQ 363

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           IA +M +Q    +   +GL +     LP   A       +W      T+SFG+ L+ TPL
Sbjct: 364 IALSMPVQELLGYYQAMGLGNYSGINLPGESAGLIHDRRRWSDFERATLSFGYALTVTPL 423

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L + G L P + +     + E     V+     +++  +L      GG+ ++
Sbjct: 424 QIARMYAMLGSGGVLYPSSILKL---KKEPEGEQVISPEVARSVMQMLIGVTEPGGTAKK 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA+K +   Y +      F  V P  +P+  ++  ++ PK    ++ 
Sbjct: 481 AHIDGYPVAGKTGTARKAVAGGYGED-YVALFAGVAPVHNPRLAMVVVVNEPK---GDRY 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+   ++  +  ML V+P
Sbjct: 537 YGGDVAAPVFAKVMSGALQMLNVEP 561


>gi|253997375|ref|YP_003049439.1| peptidoglycan glycosyltransferase [Methylotenera mobilis JLW8]
 gi|253984054|gb|ACT48912.1| Peptidoglycan glycosyltransferase [Methylotenera mobilis JLW8]
          Length = 574

 Score =  391 bits (1005), Expect = e-106,   Method: Composition-based stats.
 Identities = 142/547 (25%), Positives = 246/547 (44%), Gaps = 31/547 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + ++  L+ +  L  R +         +  +  A           R  I DR GE+L
Sbjct: 16  RRRLLLIAVLLGFAALLGRGVYLQSFHKRFLQEKGDARYSRTLVLPAQRGKITDRYGELL 75

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A   P  S++  P  V       +KL  +L      + ++  ++  +F +L+R++SP+  
Sbjct: 76  AISSPVESVWANPSDVKITAAQTKKLAELLSFKKDTIDKKLANNTREFVYLKRRVSPELA 135

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTR 242
             I+  G+PGV  + E  R+YPA    +H+VG+ DID++G  G E  ++       G  +
Sbjct: 136 AEIMQLGIPGVYLQREYKRYYPAGDVTAHLVGFTDIDDKGQEGFELAMNSSLSGKNGSRK 195

Query: 243 VFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L++D RIQ +  +EL +  +K+ A +   V+L+ 
Sbjct: 196 VIKDRAGRIIEDLEAVKVPQDGADITLSIDRRIQYLAQRELTKAVEKFKANAGAAVVLDA 255

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++MV++P Y+P+     + +   NR    IFE GS  K  T+A  +++G +T   
Sbjct: 256 KTGEVLAMVNVPTYNPNNPINIQGKT-RNRAITDIFEPGSTMKTVTVAAALETGKYTPDT 314

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           +  T                 + ++++ E+ + SSN+G+A++A ++  Q        +G 
Sbjct: 315 MIQTAPGYMSIGPATIHDAHPHGLMSVSEVIQKSSNVGSAKMALSLEPQYLWGVFNLIGF 374

Query: 412 LSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
            +K     P   +        W+ I   T+S+GHG+S T LQ A A     N+G L P +
Sbjct: 375 GAKTRIGFPGEVSGKLRGYKTWRPIEQATMSYGHGISVTLLQMARAYTVFANDGELKPVS 434

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVI 528
            +     +   V   V    T   ++S+L   V  GG+  RA V G+ V GKTGT  K+ 
Sbjct: 435 LLKL---KDAPVGTQVFSAKTANEVKSMLELVVLPGGTALRAQVLGYRVAGKTGTTLKLG 491

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y       SF+ + P ++P+ I+   +D P      +   G   AP+   ++  +  
Sbjct: 492 DHGYEKNKYVGSFVGMAPASNPRLIMAVMIDDPSS---GEYYGGTVAAPVFSAVMADALR 548

Query: 589 MLGVKPV 595
           ML V   
Sbjct: 549 MLSVPQD 555


>gi|326795776|ref|YP_004313596.1| penicillin-binding protein transpeptidase [Marinomonas mediterranea
           MMB-1]
 gi|326546540|gb|ADZ91760.1| penicillin-binding protein transpeptidase [Marinomonas mediterranea
           MMB-1]
          Length = 586

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 148/563 (26%), Positives = 248/563 (44%), Gaps = 42/563 (7%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           K RI    ++  V++ +   R+          +  +    ++       +R  I+DRNGE
Sbjct: 12  KWRIYFIYLIAAVLFAVAGGRLFYLSVVKKDFLQNQGEIRAVRTVSIPATRGMILDRNGE 71

Query: 126 ILATDIPTFSLYVEPHKV----------ISPDEIIEKLQIVLPNLDSEMIRRKL--SSET 173
            LA   PT+++   P K+           +P   +++L  V   L    ++ K   +   
Sbjct: 72  PLAVSTPTWTIIANPRKLWELEQDPNAKTTPQTEMDRLAKV-TGLGRSWLQEKFEVNRNK 130

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F +LRR++ PQ    I++  + GV  R E  RFYP+    SHVVG+ +ID+ G  G+E 
Sbjct: 131 AFMYLRRQIPPQDADEIMAANVVGVSKRKEYKRFYPSGEVTSHVVGFTNIDDAGQEGLEL 190

Query: 234 FLD-----MQGLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKK 277
                     G        KG           E   + I L++DLR+Q + ++EL     
Sbjct: 191 AYQSSLQGTPGKRSYLKDLKGNEILRIGQDVSEHPGENIELSIDLRLQYLAYRELKAAVT 250

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           +  A S   VIL+V TGE+++MV+ P Y+P++    + +   NR    +FE GS  K FT
Sbjct: 251 QNRAASASAVILDVKTGEILAMVNQPSYNPNDRSNIEYDQLRNRAVIDLFEPGSTMKPFT 310

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           I+  + SG +T + + DT                    + +  +   SSN+  ++I  ++
Sbjct: 311 ISAALRSGQYTTESIIDTHPGYLRFGRQTIRDLGNYGKIDLETVLVKSSNVATSKITLSL 370

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
                    Y LG+ S +    P           +W      T+S+G+GLS + LQ A A
Sbjct: 371 PQDTVWNLDYELGIGSPVGIGFPGESTGVLPSRPKWHPAEIATLSYGYGLSVSALQLAQA 430

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
              L N+G  +P T + +   E     R VL     K++  +L   V  GSG+RA +PG+
Sbjct: 431 YMVLANDGYKVPVTLLKQ---ELPLDGRQVLPPRVAKSVVKMLESVVERGSGKRARIPGY 487

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V GKTGT  +V  K Y        F  + P +DP+  ++  ++ PK ++      G   
Sbjct: 488 RVAGKTGTVHRVGSKGYEYDQYNAIFAGIAPASDPRLAMVVIVNDPKGRK---YYGGEVA 544

Query: 576 APMVGNIIRRSASMLGVKPVFLK 598
           AP+   ++  + + L + P   +
Sbjct: 545 APVFSRVMEGALTTLNITPDLPE 567


>gi|39998165|ref|NP_954116.1| penicillin-binding protein [Geobacter sulfurreducens PCA]
 gi|39985111|gb|AAR36466.1| penicillin-binding protein [Geobacter sulfurreducens PCA]
 gi|298507103|gb|ADI85826.1| peptidoglycan transglycosylase and transpeptidase FtsI [Geobacter
           sulfurreducens KN400]
          Length = 657

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 154/558 (27%), Positives = 236/558 (42%), Gaps = 40/558 (7%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNGEIL 127
           RI       ++ + ++  R      +  +            I     +R  I D NG  L
Sbjct: 12  RIRFIGGFFVLFFSLVVCRAFYLQVVKRDHLLKLADRQHQKIVPLTPARGTIYDANGSAL 71

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  +   S + EP  +   D+   +L  VL     E + RKL     F WL+R+L+P   
Sbjct: 72  AVSVEMDSCFAEPKSIADLDDAAARLSPVL-GFPKETLLRKLQGNKNFVWLQRRLTPDVV 130

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTR 242
           KRI +  + G+GF  E  RFYP +  A+HV+G+  +D  G+ GIE   D       G   
Sbjct: 131 KRIRALNIDGIGFVKETKRFYPNSEVAAHVIGFTGVDPEGLEGIELRYDSTILGGTGYLV 190

Query: 243 VFTTNKGEKN------------LQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
                 G                  + L LD  IQ I  +EL +      A +   ++++
Sbjct: 191 TERDALGRDVALKGTVIQDGAMGHNVVLTLDKNIQYIAEKELAKAVDGSGARAGTAIVMD 250

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TG V++M + P ++ +      +  W NR     +E GS FKVF IA  ++  +    
Sbjct: 251 PHTGRVLAMANYPTFNLNAHGAYHQSLWRNRAVADSYEPGSTFKVFLIASALEEKVIRPG 310

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
           D  +                 +   L+IPEI +YSSNIG+A+I   +G      +L   G
Sbjct: 311 DRINCEGGSFSIGGRTIHDTHKYGSLSIPEILKYSSNIGSAKIGSRLGASRLYSYLRNFG 370

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
             ++   +LP     +      W  I   T+SFG G++ + +Q A A +A+ N G L+ P
Sbjct: 371 FGARTGIDLPGEAGGTLRDWNQWYGIDLATVSFGQGVTASSIQLAAAFSAIANGGTLMKP 430

Query: 469 TFMIRSRE--------ESEKVSRIVLKKNTVKTMRSLLREG-VTGGSGRRAFVPGFEVGG 519
             + R  +         S +  R V+ + T K +  ++    V GG+G  A V GF V G
Sbjct: 431 YLVERVVDSEGNVIKSSSPQPLRRVVSETTAKNVARMMEGVAVEGGTGTNAAVEGFRVAG 490

Query: 520 KTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           KTGTAQKV    + YS T    SF+   P   P+  +L  +D PK         G+  AP
Sbjct: 491 KTGTAQKVDPVTRGYSLTKRTASFIGFVPADRPRLTILVMVDEPKTSP----YGGVVAAP 546

Query: 578 MVGNIIRRSASMLGVKPV 595
              +I  +S   L V P 
Sbjct: 547 AFSSIALQSLCYLKVPPD 564


>gi|157692191|ref|YP_001486653.1| stage V sporulation protein D [Bacillus pumilus SAFR-032]
 gi|157680949|gb|ABV62093.1| stage V sporulation protein D [Bacillus pumilus SAFR-032]
          Length = 639

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 154/564 (27%), Positives = 255/564 (45%), Gaps = 43/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+  R+     I  E               +   R DI+DRN
Sbjct: 7   TVRKRLLFVLLFGVIIFFIIDTRLGYVQFIMGEKLTSLAKDSWSRNLPFEPERGDILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
           G  LAT+    S+ V P ++  P E  +KL  VL N+  E   + ++ +T  + +    R
Sbjct: 67  GVELATNKSAPSILVVPRQIKDPAETSKKLAAVL-NMSEEKAYKHVTKKTSIERISPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K +    L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KVSHEKAKEVRELDLEGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + ++  KG             K+   ++L +D ++Q I+ +EL   + KYN + 
Sbjct: 186 GEKGSVKFYSDAKGQKMPDEADDYTPPKDGLDMKLTVDAKVQTIIERELDNAQAKYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GEV+ M S PD+DP +      + +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEVLGMSSRPDFDPADYQSVDSKVFNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           FD+ +    G  +       +   +  E+ + S N G  ++ D +G +
Sbjct: 306 EEKKVNLKRDSFFDSGSVTVDGARLRCWKKGGHGSQSFLEVVQNSCNPGFVELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
               ++   G   K   +L            +   +   T +FG G+S TP+Q   A AA
Sbjct: 366 KLFSYIKNFGFGQKTGIDLQGEGRGILFPLDRVGPVEQATTAFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+   T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPITKEVVKKQSPIAKKKVISAETSKEIRYALESVVAQGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYMENNHIVSFIGFAPADDPSIVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
             G   AP+VG+I+R S   +GVK
Sbjct: 543 FGGTVAAPIVGHIMRDSLPEMGVK 566


>gi|91776627|ref|YP_546383.1| peptidoglycan synthetase FtsI [Methylobacillus flagellatus KT]
 gi|91710614|gb|ABE50542.1| peptidoglycan synthetase FtsI [Methylobacillus flagellatus KT]
          Length = 583

 Score =  391 bits (1004), Expect = e-106,   Method: Composition-based stats.
 Identities = 144/537 (26%), Positives = 241/537 (44%), Gaps = 30/537 (5%)

Query: 83  VIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLY 137
             + IL +R +         +  +  A           R  I DR GE LA   P  S++
Sbjct: 33  CGFAILLVRSVYLQSVHKSFLQQKGEARYSRTLSLPAHRGKITDRYGEPLAISTPVESIW 92

Query: 138 VEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPG 197
             P  V    E + +L  +L      +  +  +++ +F +L+R+L P+   +++  G+PG
Sbjct: 93  ASPPDVKMTPEQLSRLAGILKLKPEAIQSKFDNTQREFVYLKRRLPPEVAAQVMRIGIPG 152

Query: 198 VGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKG--- 249
           V  + E  R+YPAA   +H+VG+  ID+ G  G E           G  RV    +G   
Sbjct: 153 VFMQREYRRYYPAAEVTAHIVGFTGIDDNGQEGFELHFQQWLSGKPGSRRVIKDRQGRIV 212

Query: 250 --------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
                    ++ + + L++D +IQ + ++EL     ++ A++   V+L+  TGEV++MV+
Sbjct: 213 EDLEAVKVPQDGRDLTLSIDRKIQYLAYRELAAAVTEHKAKAGSAVVLDAKTGEVLAMVN 272

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +P Y+P+           NR     FE GS  K FT A  +DSG +    L DT   +  
Sbjct: 273 VPSYNPNNPVNLAGGRSRNRAIVDTFEPGSTLKPFTAAAALDSGQYKPNTLIDTSAGVMR 332

Query: 362 GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
                     Q  +LT+ ++ + SSNIG+A++A ++  Q       ++GL +      P 
Sbjct: 333 IGRATIRDAHQQGMLTVAQVIQKSSNIGSAKMALSLEPQYMWSIYSQIGLGAPTRIGFPG 392

Query: 422 IQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESE 479
             +        W+ I   T+S+GHGLS T LQ A A     N+G L+P + +     +  
Sbjct: 393 EASGKLRNYKTWRPIEQATMSYGHGLSLTLLQLARAYTVFTNDGALLPVSLLKL---KEP 449

Query: 480 KVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNF 538
            V   V    T + +R ++   +  GG+  RA V G+ V GKTGTA K     Y      
Sbjct: 450 PVGHQVYTPETARHLRDMMETVIQPGGTAPRAQVLGYRVAGKTGTAHKPGVGGYQANHYV 509

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           +SF+   P ++P+ I+   +D P      +   G   AP+   ++  +  ML V   
Sbjct: 510 SSFVGFAPASNPRLIIAVMIDDPSA---GKYYGGTVAAPVFSQVMSGALRMLAVPQD 563


>gi|295706373|ref|YP_003599448.1| stage V sporulation protein D [Bacillus megaterium DSM 319]
 gi|294804032|gb|ADF41098.1| stage V sporulation protein D [Bacillus megaterium DSM 319]
          Length = 638

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 144/569 (25%), Positives = 257/569 (45%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ + + V  ++++I+  R+     +  + +             +   R  I+DRN
Sbjct: 7   TVRKRLAIVLFVGFIVFLIIDTRLGYVQLLTGDTLTEKAKDLWSRNIPFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
              LAT+    ++ V P +V +P    EKL  VL     E +  +++  +   +LR   R
Sbjct: 67  DVALATNKSAPTVLVMPRQVENPAVTAEKLAKVL-GASKEKVYEQITKASSSVYLRPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  +   + +  L GV    +  R+YP  S+ SHV+G+  +DN+G+TG+E + D +  
Sbjct: 126 KISHAKANEVRNLNLKGVYIAEDSKRYYPFGSYLSHVLGFAGVDNQGLTGLELYYDKELK 185

Query: 239 ---GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  ++++  KG+K            +   +RL +D R+Q I+ +EL   +  YN + 
Sbjct: 186 GQKGSVKLYSDAKGKKMPNIADDYTAPVDGLDLRLTIDSRVQTIMERELDNAQTAYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +    K E +  N   + ++E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPGFDPTDFKNVKPEVYNRNLPIWSVYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D       G  +       +   +  E+ + S N G  ++ + +G +
Sbjct: 306 EEKKVDLLKDQFYDDGAAEVGGARLRCWKKGGHGQQSFLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G++ TP+Q   A +A
Sbjct: 366 KLFKYIKEFGFGQKTGIDLQGEAKGILFPLERVGPVEQATTAFGQGVAVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ + T K +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYEPYIAKEWVDPTTGKVVSSHKPVAKRKVISEETSKQVRFALESVVAQGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQK    +Y    +  SF+ V P  +P+ +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKAQNGKYLKNNHIVSFIGVAPADNPEIVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VG +I  S  ++ VKP   +
Sbjct: 543 FGGVVAAPIVGKMIEDSLRVMDVKPRKGQ 571


>gi|307944900|ref|ZP_07660237.1| penicillin-binding protein, transpeptidase [Roseibium sp.
           TrichSKD4]
 gi|307771824|gb|EFO31048.1| penicillin-binding protein, transpeptidase [Roseibium sp.
           TrichSKD4]
          Length = 571

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 248/533 (46%), Positives = 352/533 (66%), Gaps = 3/533 (0%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNID-EYGMSRPDIIDRNGEIL 127
             K+R+   +    +IY+ +  R++Q   +   P +  ++       SRPD++DRNGEIL
Sbjct: 30  QMKSRVFFAMAAFAMIYVAMGARLVQLAQMEEAPSSAWISAQDTIAASRPDLLDRNGEIL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           ATDI T SLY EP +++  DE  E +  +LP LD+  IRR+L S+  F WL+R+++P Q 
Sbjct: 90  ATDIKTASLYAEPRRILDIDETYEGITRILPELDTPTIRRRLESKAGFVWLKREITPAQA 149

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVF-TT 246
            +I   GLPGVGF  E  RFYP    A H+VG V++DN+G+ G+EK++D QGL  +    
Sbjct: 150 DQIHDLGLPGVGFLSENQRFYPGGPTAGHIVGSVNVDNQGLAGVEKYIDGQGLADLQSVG 209

Query: 247 NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYD 306
              +K ++P+ LA+DLR+Q++V  ELV+  ++Y A +   ++L+V TGEVI+M S+PDYD
Sbjct: 210 FTTDKAMEPVSLAVDLRVQHVVRDELVKAMERYKAIAAVGIVLDVHTGEVIAMSSLPDYD 269

Query: 307 PHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVI 366
           P++  +  ++   NR + G+FEMGS+FK FT AM +DSG  +V D FD   PI+     I
Sbjct: 270 PNDRAQALEKDRLNRATGGVFEMGSVFKAFTTAMALDSGRVSVNDSFDATRPIRAAGRTI 329

Query: 367 HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS 426
            D+H +NRIL++PEIF YSSNIG A++  A G+   +EFL R+GL ++L+TELPE  AP 
Sbjct: 330 SDFHGKNRILSVPEIFIYSSNIGTAKMMLATGVSKQQEFLGRIGLTNRLKTELPENAAPL 389

Query: 427 YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVL 486
            P +W  + ++TISFGHG+S TP+QTAVAAAA++N G+LIPPTF  R + E+E++   V+
Sbjct: 390 LPPRWNDLAAMTISFGHGISVTPMQTAVAAAAMVNGGKLIPPTFFPREQAEAEELGTQVI 449

Query: 487 KKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFP 546
                K MR L R  V  GSG+R+ VPG+ VGGKTGTA+K+   RY      NSFL+ FP
Sbjct: 450 SPQVSKVMRYLFRLNVLSGSGKRSEVPGYVVGGKTGTAEKIENGRYVSNKRRNSFLSAFP 509

Query: 547 TTDPQYIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             DP+Y+VL  +D PK + +    TAG+N AP VG IIRR+A MLGV P F +
Sbjct: 510 MNDPKYVVLVVIDEPKPERKGIGATAGLNAAPTVGAIIRRAAPMLGVLPRFGE 562


>gi|147678202|ref|YP_001212417.1| cell division protein FtsI/penicillin-binding protein 2
           [Pelotomaculum thermopropionicum SI]
 gi|146274299|dbj|BAF60048.1| cell division protein FtsI/penicillin-binding protein 2
           [Pelotomaculum thermopropionicum SI]
          Length = 669

 Score =  390 bits (1002), Expect = e-106,   Method: Composition-based stats.
 Identities = 141/524 (26%), Positives = 220/524 (41%), Gaps = 33/524 (6%)

Query: 99  HPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLP 158
             E     M        R  I DRNG  L   +   S Y  P ++    +   K+  VL 
Sbjct: 2   RAEAQEVRMRDVPVEARRGTIYDRNGNELVASVSVDSAYAFPPQIKDKRDAANKIADVL- 60

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
            +D E +  +L+    F WL+R++  +  +R+ +  L GV    E  RFY   S A+HV+
Sbjct: 61  GMDREDVYNRLNQNVGFVWLKRRIDYESAQRLKALNLSGVELVEESRRFYRQGSLAAHVL 120

Query: 219 GYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE------------KNLQPIRLALD 261
           G+   DN+G+TGIE   D +     G   +     G                  + L +D
Sbjct: 121 GFAGDDNQGLTGIESVYDRELRGIPGRIVIEKDAVGRNIPEALHKFIPPVPGNNLVLTID 180

Query: 262 LRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FN 320
             IQ  V +EL +    ++ +    +++N  TGE+++M + P ++P E  K  +  W  N
Sbjct: 181 QTIQYFVERELDKIMDVHHPKLAVIIVMNPKTGEILAMGNRPTFNPGEWMKYPQSIWDHN 240

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV-IHDYHPQNRILTIP 379
              +  +E GS FK+ T A  ++ G     D F     IKV        Y   +   T  
Sbjct: 241 PSIWYNYEPGSTFKIITAAAALEEGAVRPGDTFYDPGYIKVADRFIRCWYDGGHGSQTFA 300

Query: 380 EIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHS--L 437
           E+ + S N G   +   +G +   +++   G   +    LP  +      Q +       
Sbjct: 301 EVAQNSCNPGFIMVGLRLGKEKFYKYINAFGFGQRTNISLPGEEVGIQIPQEEATELNIA 360

Query: 438 TISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV--------SRIVLKKN 489
           T+S G  ++ TP+Q   AA+A+ N G L+ P+ +    +   KV         R VL KN
Sbjct: 361 TMSIGQSIAVTPIQLITAASAVANGGVLLKPSLVKAITDAEGKVLKEFKPEPVRQVLSKN 420

Query: 490 TVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTD 549
           T +T+  LL + V  G+GR AFV G+   GKTGTAQ V    Y++     SF+   P  D
Sbjct: 421 TARTLMELLTDVVLKGTGRNAFVDGYGAAGKTGTAQVVDAGGYAEGKYVASFVGFAPADD 480

Query: 550 PQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
           PQ   L  +  P              AP    I++ +   L V 
Sbjct: 481 PQVAALVMVAEP---SGPVYFGSQVAAPAFKAIVQDTLRYLKVP 521


>gi|30248988|ref|NP_841058.1| penicillin binding protein transpeptidase domain-containing protein
           [Nitrosomonas europaea ATCC 19718]
 gi|30138605|emb|CAD84896.1| Penicillin binding protein transpeptidase domain [Nitrosomonas
           europaea ATCC 19718]
          Length = 580

 Score =  390 bits (1001), Expect = e-106,   Method: Composition-based stats.
 Identities = 153/565 (27%), Positives = 271/565 (47%), Gaps = 34/565 (6%)

Query: 56  QDLFQKRRRKVI-AHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNI 109
           + LF   R+       + R  +     L+  IIL  R +         +  +  +  + +
Sbjct: 2   KILFNPSRKSAAVDLPEWRSRLIQGFLLISLIILVARAVYLQALNKDFLQQQGQSRHLRV 61

Query: 110 DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL 169
            E    R  I DRNGEILA   P  S++V+P +V +  E I +L  +L +++   ++ +L
Sbjct: 62  IEQNSQRGSIKDRNGEILAISAPVKSVWVDPKRVSATSEQIGQLADLL-DMNKATVQERL 120

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
           SS+ +F +L+R+L P++  +I    + G+  + E  R+YP+   A+H++G+ D+D RG  
Sbjct: 121 SSDKRFVYLKRQLPPERANKIAELNIKGLYLKHEFYRYYPSRELAAHILGFTDVDGRGQE 180

Query: 230 GIEKFLD-----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELV 273
           G+E           G  RV     G            K+ Q + L++D +IQ + ++EL 
Sbjct: 181 GVELAWQDVLTGEDGKRRVIKDRIGRVVEDVGQIRSPKSGQDVVLSIDSKIQYLAYRELA 240

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIF 333
              K+ +A++   V L+V TGEV++M + P ++P++      E   NR+    FE GS  
Sbjct: 241 RAVKEQHAKAGSIVALDVKTGEVLAMANYPAFNPNQRASMNNEVIRNRVLVDTFEPGSTL 300

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K F IA+ +++G      L +T   +      +         LT+ ++ + SSN+GAA+I
Sbjct: 301 KPFAIAVALETGRVKANTLMETSGGMMRIGRAVIRDVRDKGNLTVSQVIQTSSNVGAAKI 360

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQ 451
           A  +  +   E L R G  ++     P   +      ++W+ I   T+S+GHG+S + +Q
Sbjct: 361 ALLLPPKTFWEMLNRSGFGTETGIGFPGEASGQLRAYNKWRPIEQATMSYGHGISVSLMQ 420

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRA 510
              A      +G L P T + R   ++  V + V+ + T +++R +L   V   G+G  A
Sbjct: 421 LVRAYTLFATDGELKPITLLKR---DTPAVGQKVISRETAQSVRKMLELAVQPEGTGSGA 477

Query: 511 FVPGFEVGGKTGTAQK--VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
            + G+ V GKTGTA K    +K Y+     +SF+   P +DP+ I+   +D P      +
Sbjct: 478 RINGYRVAGKTGTAHKRLEKRKGYASDRYISSFVGFAPASDPRVIMAIMIDEP---SDGR 534

Query: 569 LTAGINVAPMVGNIIRRSASMLGVK 593
              G   AP+   ++  +  +L V 
Sbjct: 535 YYGGTVAAPVFSRVMEGTLRILNVP 559


>gi|158426168|ref|YP_001527460.1| putative penicillin-binding protein [Azorhizobium caulinodans ORS
           571]
 gi|158333057|dbj|BAF90542.1| putative penicillin-binding protein [Azorhizobium caulinodans ORS
           571]
          Length = 655

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 215/529 (40%), Positives = 335/529 (63%), Gaps = 3/529 (0%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           ++ R+ + I     +++ +A+R+   G             +    +RPDI+DRNGEI+A 
Sbjct: 107 TRARLKLIIAAFSFVFLAIALRLAFLGVTSDPNGVRGGGSEAVASARPDIVDRNGEIIAI 166

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           D+ + SL+ EP ++I PDE +E L  VLP+LD   +R +L+S+  F WL+R+++P QQ+ 
Sbjct: 167 DVKSPSLFAEPKRLIDPDETLEGLLKVLPDLDVNEVRNRLNSKKGFAWLKREITPAQQRA 226

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           I   G PG+GF  E  R YP     SHVVG V++DN+GI G+EK++D +GL  +      
Sbjct: 227 IYRLGFPGIGFVRENRRIYPDGPSFSHVVGNVNVDNQGIAGLEKYIDGRGLAELHLAGLA 286

Query: 250 -EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            ++  +P+ L++D+R+Q+ +  EL++ ++K+ A++   ++ NV TGE+++MVS+PD+DP+
Sbjct: 287 TDRQQEPVALSMDVRVQHTLRDELLKAREKFKAKAAMGLVTNVRTGEIVAMVSLPDFDPN 346

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD 368
                + + + NR++ G+FEMGS FK  + AM +DSG  ++ + FD R P+  G+  IHD
Sbjct: 347 LNGDPRSDAYLNRLTTGVFEMGSTFKSLSFAMALDSGKISLSNSFDARAPLSFGRFAIHD 406

Query: 369 YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP 428
           +HP+ R+L++PEIF YSSNIG A++  ++G+  HK FL ++G + +L TELPE   P  P
Sbjct: 407 FHPEGRVLSLPEIFIYSSNIGTAKMVLSLGVDAHKAFLKKMGQMDRLRTELPESAEPIVP 466

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
            +W  ++S TI+FGHG++  PLQ  +A  +++N G LIPPTF+ R+ +++ KV+  VLK 
Sbjct: 467 KRWGELNSATIAFGHGIAVAPLQAVMAVNSMVNGGYLIPPTFLKRTEDDAMKVATRVLKP 526

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
            T   MR LLR  V  GSG++A + G+ VG KTGTA+KV+  RY+      SF AVFP  
Sbjct: 527 ETSDKMRYLLRLNVEKGSGKKADMVGYNVGAKTGTAEKVVGGRYAKNKLLTSFTAVFPMD 586

Query: 549 DPQYIVLSFMDSPKIKERNQLTA--GINVAPMVGNIIRRSASMLGVKPV 595
            PQY++L  +D P+        A  G N AP+ G I+ R A ML V P 
Sbjct: 587 RPQYLLLVMLDEPQPTPETHGYATSGWNAAPVAGKIVERIAPMLNVAPR 635


>gi|149377268|ref|ZP_01895015.1| penicillin-binding protein 2 [Marinobacter algicola DG893]
 gi|149358456|gb|EDM46931.1| penicillin-binding protein 2 [Marinobacter algicola DG893]
          Length = 579

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 148/550 (26%), Positives = 257/550 (46%), Gaps = 32/550 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R G  + V L++   LA R++         +  +    ++ ++     R  + DR+GE L
Sbjct: 22  RYGTVLGVFLLVVGALAWRLVDLHVVDNEFLRKQGDVRTIRVESIDAHRGVVTDRHGESL 81

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQWLRRKLSPQ 185
           A   P  +++  P ++ + +  +  +  +L  L    +R +L      +F +LRRKL P+
Sbjct: 82  AVSTPVQTIWANPSEIDADEPRLTNVARLL-GLQEARLRERLRKYSGREFIYLRRKLQPE 140

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             +++L+ G+PGV  R E  R+YPA    +HVVG+ +ID  G  GIE   +       G 
Sbjct: 141 IARQVLAMGIPGVYSRQEYRRYYPAGEVTAHVVGFTNIDESGQEGIELAYNQWLSGESGR 200

Query: 241 TRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV   N+G            K  + + L++DLR+Q + ++EL      ++A     V+L
Sbjct: 201 KRVLKDNRGRVIKDLTLIRDAKPGRNLELSIDLRLQYLAYRELKAVVGAHDARGGTLVML 260

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV++MV+   Y+P++  +   +   N+    +FE GS  K  ++A  ++SG F  
Sbjct: 261 DVDTGEVLAMVNQGSYNPNDRSQLSPDRLRNKAITDLFEPGSTMKPVSMAAALESGKFKA 320

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               DT    +         H    ++++ ++   SSN+G ++IA  +G    ++   RL
Sbjct: 321 SSTIDTAPGYRRFGRFTIRDHRNYGVISLTDVIAKSSNVGISKIATELGGDTIRDLYARL 380

Query: 410 GLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL        P         P +W+ +   T+S+G+G+S   LQ A A   L N G   P
Sbjct: 381 GLGQPTGIGFPGEAVGVLPAPPKWRPVEEATLSYGYGMSVNALQLAQAYMVLANGGIRYP 440

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV 527
            + +     E + V   VL +     +R +LRE V  G+G+RA    +  GGKTGT   V
Sbjct: 441 LSLLKA---EEKPVGERVLSEEVSFQIRGMLREVVENGTGKRAQPGFYSAGGKTGTVHLV 497

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
            K  Y D+     F  + P  +P+ + +  +D+P+     +   G   AP+   ++  + 
Sbjct: 498 GKNGYEDSQYKAIFAGMAPIDNPRIVTVVAVDAPQS---GEYYGGEVAAPVFARVMGDAL 554

Query: 588 SMLGVKPVFL 597
            +L VKP   
Sbjct: 555 RLLNVKPELE 564


>gi|54293891|ref|YP_126306.1| peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           str. Lens]
 gi|53753723|emb|CAH15181.1| Peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           str. Lens]
          Length = 553

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 141/552 (25%), Positives = 251/552 (45%), Gaps = 30/552 (5%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDR 122
            H   R+    V   +I  IL  R++         +  +  A S+ + +    R  I DR
Sbjct: 4   THHFARLVTVAVFFSLILAILIWRMVDLTVLHRQFLQGQGDARSIRVIDIPAYRGMITDR 63

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRK 181
           NG  LA   P  S++V P +    +E   +L   L     E+ R+ + +E++ F +L+R+
Sbjct: 64  NGTPLAVSTPVESVWVNPKEFSPDEEQFMQLAKYLNLAPKELSRKIVRAESREFVYLQRQ 123

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           L P   K+I +  +PGV F+ E  R+YP +   S ++G+ ++D++G+ GIE         
Sbjct: 124 LPPPLSKKIEALKIPGVNFQKEFKRYYPDSDSISPLIGFTNVDDQGLEGIELAYQDWLMG 183

Query: 239 --GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
             G  RV     G            +    + L++D R+Q + + EL +  ++++A+S  
Sbjct: 184 VVGKKRVIKDRLGRVVEDLGVLKEPRPGHELTLSIDRRLQYLAYSELGKTVEEFSAKSGS 243

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            V+++   GE++++ ++P Y+P+      KE + NR     FE GS+ K F+IA  +++G
Sbjct: 244 VVVIDAENGEILAVANVPSYNPNARGHYDKETYRNRAFTDTFEPGSVIKSFSIASALETG 303

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           LFT   + DT                   +L +  I ++SSN+G  ++  +   +    F
Sbjct: 304 LFTPDTIIDTNPGWMTVHGRTVRDIHNYGVLDVTGILQHSSNVGVTKMVLSTPAEQLIGF 363

Query: 406 LYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           L + G   + E   P                   T+ FG+GLS T LQ A A     N+G
Sbjct: 364 LQKCGFGQRSELAYPGESEGGIVKAKDANPFVLATLGFGYGLSVTALQLAKANLIFANKG 423

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
           RLIP T +     ++      V++  T + +  ++   +  G+G+ A VPG+ V GKTGT
Sbjct: 424 RLIPVTLI---HNDTPSNGIQVMEPKTAENVLLMMEAVMNKGTGKGARVPGYRVAGKTGT 480

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           A+   K  Y D     SF+ + P + P+++V+  +  P    R    A     P+   ++
Sbjct: 481 ARVAGKNGYKDRKYTASFIGIAPVSKPKFVVVVIIHEP---SRKGYYAASVAGPLFAKVM 537

Query: 584 RRSASMLGVKPV 595
             +  +  +   
Sbjct: 538 SGALRLFNIPTD 549


>gi|52841151|ref|YP_094950.1| peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
 gi|54296936|ref|YP_123305.1| peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           str. Paris]
 gi|52628262|gb|AAU27003.1| penicillin binding protein 3 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750721|emb|CAH12128.1| Peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           str. Paris]
          Length = 553

 Score =  389 bits (999), Expect = e-106,   Method: Composition-based stats.
 Identities = 140/552 (25%), Positives = 248/552 (44%), Gaps = 30/552 (5%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDR 122
            H   R+    V   +I  IL  R++         +  +  A S+ + +    R  I DR
Sbjct: 4   THHFARLVTVAVFFSLILAILIWRMVDLTVLHRQFLQGQGDARSIRVIDIPAYRGMITDR 63

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS-ETKFQWLRRK 181
           NG  LA   P  S++V P +    +E   +L   L     E+ R+ + +   +F +L+R+
Sbjct: 64  NGTPLAVSTPVESVWVNPKEFSPDEEQFMQLAKYLNLAPKELSRKIVRAENREFVYLQRQ 123

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           L P   K+I +  +PGV F+ E  R+YP +   S ++G+ ++D++G+ GIE         
Sbjct: 124 LPPPLSKKIEALKIPGVNFQKEFKRYYPDSDSISPLIGFTNVDDQGLEGIELAYQDWLMG 183

Query: 239 --GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
             G  RV     G            +    + L++D R+Q + + EL +  ++++A+S  
Sbjct: 184 VVGKKRVIKDRLGRVVEDLGVLKEPRPGHELTLSIDRRLQYLAYSELGKTVEEFSAKSGS 243

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            V+++   GE++++ ++P Y+P+      KE + NR     FE GS+ K F+IA  +++G
Sbjct: 244 VVVIDAENGEILAVANVPSYNPNARGHYDKETYRNRAFTDTFEPGSVIKSFSIASALETG 303

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           LFT   + DT                   +L +  I ++SSN+G  ++  +   +    F
Sbjct: 304 LFTPDTIIDTNPGWMTVHGRTVRDIHNYGVLDVTGILQHSSNVGVTKMVLSTPAEQLIGF 363

Query: 406 LYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           L + G   + E   P                   T+ FG+GLS T LQ A A     N+G
Sbjct: 364 LQKCGFGQRSELAYPGESEGGIVKAKDANPFVLATLGFGYGLSVTALQLAKANLIFANKG 423

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
           RLIP T +     ++      V++  T + +  ++   +  G+G+ A VPG+ V GKTGT
Sbjct: 424 RLIPVTLI---HNDTPSNGIQVMQPKTAENVLLMMEAVMNKGTGKGARVPGYRVAGKTGT 480

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           A+   K  Y D     SF+ + P + P+++V   +  P    R    A     P+   ++
Sbjct: 481 ARVAGKNGYKDRKYTASFIGIAPVSKPKFVVAVIIHEP---SRKGYYAASVAGPLFAKVM 537

Query: 584 RRSASMLGVKPV 595
             +  +  +   
Sbjct: 538 SGALRLFNIPTD 549


>gi|65321242|ref|ZP_00394201.1| COG0768: Cell division protein FtsI/penicillin-binding protein 2
           [Bacillus anthracis str. A2012]
          Length = 638

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 153/569 (26%), Positives = 255/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I+ I+ IR+                        +   R  I+DRN
Sbjct: 7   TVRKRLIFILISGILIFTIIDIRLGYVQFFLGNMLTDRAKDSWSRNITFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P ++  P E  EKL  VL  ++ + I ++++ +     L    R
Sbjct: 67  GVELATNKSAPTVFVVPRQIEKPAETAEKLAAVL-GVEKDEIYKRITKKESIVRLDKGGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  + K +    L GV    +  R+YP  +  SHV+G+   DN+G+ G+EK+ D +  
Sbjct: 126 KISHDKAKEVRGLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGSDNQGLMGLEKYYDKELN 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  R F   KG             +    + L +D RI  I+ +E+   +  YN + 
Sbjct: 186 GDEGHVRFFADAKGQRMPNVGDDFKKPEAGLNLGLTIDARINRIMEREMNIAESTYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  + +N   GE++ M S P +DP +      E +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +  L    KD F      +VG   +  +    +   T  E+ + S N G  ++ D +G +
Sbjct: 306 NENLVDLEKDTFYDDGAAEVGGARLKCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L    +       +   +   T SFG G+S TP+Q   A AA
Sbjct: 366 RLFKYIRNFGFGQKTGIDLQGEGSGILFNLDKVGPVEQATTSFGQGVSVTPIQQVAAVAA 425

Query: 459 LINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+   T + +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYQPYIAXEFIDPKNNQVVSKKTPVDKRKVISXETSEKVRYALENXVAKGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AF+ G+ VGGKTGTAQKV   +Y +     SF+   P  DP+ +V   +D+PK   +   
Sbjct: 486 AFIDGYRVGGKTGTAQKVKDGKYLENNYIVSFIGFAPADDPEIVVYVAVDNPKGVTQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VGNI+R +  ++GVKP   +
Sbjct: 543 FGGVVAAPIVGNILRDALPVMGVKPRKEQ 571


>gi|148360436|ref|YP_001251643.1| peptidoglycan synthetase FtsI [Legionella pneumophila str. Corby]
 gi|296106498|ref|YP_003618198.1| cell division protein FtsI (penicillin binding protein 3)
           [Legionella pneumophila 2300/99 Alcoy]
 gi|148282209|gb|ABQ56297.1| Peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           str. Corby]
 gi|295648399|gb|ADG24246.1| cell division protein FtsI (penicillin binding protein 3)
           [Legionella pneumophila 2300/99 Alcoy]
 gi|307609709|emb|CBW99219.1| peptidoglycan synthetase FtsI precursor [Legionella pneumophila
           130b]
          Length = 553

 Score =  389 bits (998), Expect = e-106,   Method: Composition-based stats.
 Identities = 139/552 (25%), Positives = 248/552 (44%), Gaps = 30/552 (5%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDR 122
            H   R+    V   +I  +L  R++         +  +  A S+ + +    R  I DR
Sbjct: 4   THHFARLVTVAVFFSLILAVLIWRMVDLTVLHRQFLQGQGDARSIRVIDIPAYRGMITDR 63

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS-ETKFQWLRRK 181
           NG  LA   P  S++V P +    +E   +L   L     E+ R+ + +   +F +L+R+
Sbjct: 64  NGTPLAVSTPVESVWVNPKEFSPDEEQFMQLAKYLNLAPKELSRKIVRAENREFVYLQRQ 123

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           L P   K+I +  +PGV F+ E  R+YP +   S ++G+ ++D++G+ GIE         
Sbjct: 124 LPPPLSKKIEALKIPGVNFQKEFKRYYPDSDSISPLIGFTNVDDQGLEGIELAYQDWLMG 183

Query: 239 --GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
             G  RV     G            +    + L++D R+Q + + EL +  ++++A+S  
Sbjct: 184 VVGKKRVIKDRLGRVVEDLGVLKEPRPGHELTLSIDRRLQYLAYSELGKTVEEFSAKSGS 243

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            V+++   GE++++ ++P Y+P+      KE + NR     FE GS+ K F+IA  +++G
Sbjct: 244 VVVIDAENGEILAVANVPSYNPNARGHYDKETYRNRAFTDTFEPGSVIKSFSIASALETG 303

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           LFT   + DT                   +L +  I ++SSN+G  ++  +   +    F
Sbjct: 304 LFTPDTIIDTNPGWMTVHGRTVRDIHNYGVLDVTGILQHSSNVGVTKMVLSTPAEQLIGF 363

Query: 406 LYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           L + G   + E   P                   T+ FG+GLS T LQ A A     N+G
Sbjct: 364 LQKCGFGQRSELAYPGESEGGIVKAKDANPFVLATLGFGYGLSVTALQLAKANLIFANKG 423

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
           RLIP T +     ++      V++  T + +  ++   +  G+G+ A VPG+ V GKTGT
Sbjct: 424 RLIPVTLI---HNDTPSNGIQVMQPKTAENVLLMMEAVMNKGTGKGARVPGYRVAGKTGT 480

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           A+   K  Y D     SF+ + P + P+++V   +  P    R    A     P+   ++
Sbjct: 481 ARVAGKNGYKDRKYTASFIGIAPVSKPKFVVAVIIHEP---SRKGYYAASVAGPLFAKVM 537

Query: 584 RRSASMLGVKPV 595
             +  +  +   
Sbjct: 538 SGALRLFNIPTD 549


>gi|75675238|ref|YP_317659.1| penicillin-binding protein, transpeptidase [Nitrobacter
           winogradskyi Nb-255]
 gi|74420108|gb|ABA04307.1| Penicillin-binding protein, transpeptidase [Nitrobacter
           winogradskyi Nb-255]
          Length = 579

 Score =  389 bits (998), Expect = e-105,   Method: Composition-based stats.
 Identities = 221/545 (40%), Positives = 346/545 (63%), Gaps = 4/545 (0%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-HPEPIAPSMNIDEYGM 114
           ++L   R     A ++ R+G+ I++  +IY ++A R++ +           + + D    
Sbjct: 18  RNLLYGRNVDRAAKARVRVGLVIILFALIYTVVAARLVMFAAFPDDRGGRRTASQDAIAT 77

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDIIDRNG++LATDI + SL+ EP ++I  DE +E L   LP+L++  +R++L +   
Sbjct: 78  ARPDIIDRNGQVLATDIKSPSLFGEPRRLIDRDEAVELLTATLPDLETSEVRQRLGTRKG 137

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL+R+++P QQK I S G+PG+GF  E  R YP+    +H++G V+IDN+GI G+EK+
Sbjct: 138 FVWLKREITPAQQKEIHSLGIPGIGFLRENKRVYPSGREVAHLIGLVNIDNQGIAGMEKW 197

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           LD  GL  +       ++  +P+ L++DLR+++ +  EL++ K  Y A++   ++ NV T
Sbjct: 198 LDSNGLADLHRAGFATDRLQKPVELSIDLRVEHALRDELLKAKDHYRAKAASGIVSNVRT 257

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+++MVS+PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG + +  ++
Sbjct: 258 GEIVAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGRYGLNSMW 317

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D R P++ G+  IHD H   R + + E+F YSSNIGAA+IA A G++ HK FL R+G + 
Sbjct: 318 DARAPLRYGRFTIHDDHSMGRFINMKEVFTYSSNIGAARIALAQGVEAHKAFLRRMGQMD 377

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           +L TELPE  +P  P +W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ R
Sbjct: 378 RLRTELPESASPILPRKWGELNTVTIAFGHGMAVAPLQAVMGIDALVNGGWLIPPTFLKR 437

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + EE+  V+R V+K+ T   MR LLR     G+ R+A V G+ VGGKTGT++KVI  RY+
Sbjct: 438 TEEEAMAVARRVIKQETSDKMRFLLRLNAEVGTARKADVKGYYVGGKTGTSEKVINGRYA 497

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLG 591
                NSF A+ P  +P+Y +L  +D P+  +      T+G N  P  G +I R A +LG
Sbjct: 498 KKRVLNSFTAILPADNPRYQILVMLDEPQPLKETHGFITSGWNAVPTGGKVIARIAPLLG 557

Query: 592 VKPVF 596
           V+P F
Sbjct: 558 VQPRF 562


>gi|253699151|ref|YP_003020340.1| peptidoglycan glycosyltransferase [Geobacter sp. M21]
 gi|251774001|gb|ACT16582.1| Peptidoglycan glycosyltransferase [Geobacter sp. M21]
          Length = 654

 Score =  389 bits (998), Expect = e-105,   Method: Composition-based stats.
 Identities = 153/560 (27%), Positives = 247/560 (44%), Gaps = 39/560 (6%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNG 124
           ++ R+    ++  V+++  A R      ++ +            I     +R  I DR  
Sbjct: 9   ARVRMRFVALLFAVVFVATAGRAFYLQVLNNDRLVKLAEKQHQRIVALTPARGAIYDRTN 68

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
              A  I   S Y E   + +  +   +L  +L    ++ +  KL     F WL R++ P
Sbjct: 69  APFAVSIEMDSCYAETRNMDNIPQEAAQLAPLL-GYGAQELEAKLKGAKNFVWLARRIPP 127

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQG 239
           +Q +++ + GL GVGF  E  RFYP +  A+HVVG+  ID  G+ G+EK  D       G
Sbjct: 128 EQARKVKALGLEGVGFVKESKRFYPNSQVAAHVVGFTGIDPGGLEGVEKKYDATILGNTG 187

Query: 240 LTRVFTTNKGE-------------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
                    G                   + L LD  +Q I  +EL     K  A++   
Sbjct: 188 FLVTERDALGRDIALKKGSEGKSGSKGNNVVLTLDKNVQYIAEKELANAVVKNGAKAGIA 247

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           +++   TG V++M + P ++P+     ++    NR     FE GS FK+F +A  +++G+
Sbjct: 248 IVMEPDTGRVLAMANYPSFNPNSFADYEQAALRNRAIADSFEPGSTFKIFLVASALEAGV 307

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
               D+F+  N              +   L++P+I +YSSNIGAA+I   +G +     L
Sbjct: 308 IRPGDMFNCENGSYRMFGRTIHDTHKYGALSVPQILKYSSNIGAAKIGSRLGPERLYAAL 367

Query: 407 YRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G   K   +LP   +      S+W  I   TISFG G++TT LQ   A + + N G 
Sbjct: 368 TGFGFGEKSSIDLPGEASGMLRPQSKWYGIDLATISFGQGVTTTALQITNAVSVVANGGN 427

Query: 465 LIPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGF 515
           L+ P  + R  +++         +V R ++   T KT+  +L   V  GG+G  A V G+
Sbjct: 428 LMKPYLVDRIVDDNGVVLQQFAPQVKRRIISPETAKTVARMLEGVVVEGGTGTGAAVEGY 487

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V GKTGTAQKV  + YS +    SF+   P   P+  ++  +D P          G+  
Sbjct: 488 RVAGKTGTAQKVEGRGYSASKRTASFVGFVPLNKPRLAIMVVIDEPTTSS----YGGVVA 543

Query: 576 APMVGNIIRRSASMLGVKPV 595
           AP    I +++   L V P 
Sbjct: 544 APAFSAIAQQTLCYLNVPPD 563


>gi|85712539|ref|ZP_01043587.1| Cell division protein FtsI [Idiomarina baltica OS145]
 gi|85693673|gb|EAQ31623.1| Cell division protein FtsI [Idiomarina baltica OS145]
          Length = 588

 Score =  389 bits (998), Expect = e-105,   Method: Composition-based stats.
 Identities = 137/560 (24%), Positives = 246/560 (43%), Gaps = 33/560 (5%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIA-----PSMNIDEYGMSRP 117
           +++  A ++ R    + V   ++ IL  R      I+PE  +      S+  D  G+ R 
Sbjct: 15  KKQNPAGARWRFITALSVLFFVFSILVARAAYIQVINPEQYSLQGDLRSLRSDSLGVQRG 74

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEK-----LQIVLPNLDSEMIRRKLSSE 172
            I+DRNG  LA  +P  +++ +P ++     + ++     L         E++ +  + E
Sbjct: 75  MIVDRNGRELAVSVPVETVWADPKRIAESGALADQRRWQALAETFRMNRDELVAKVDNPE 134

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
            +F +L+RK+SP +   +    +PGV  + E  R+YP    ++H+VG  +ID +G  G+E
Sbjct: 135 RRFVYLQRKVSPSEADYVRQLSIPGVYLKTESRRYYPTGEISAHLVGITNIDGQGQEGLE 194

Query: 233 KFLD-----MQGLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKK 277
              D       G        +G           +  + + L++D RIQ   + EL +  +
Sbjct: 195 LLYDDHLTGTPGKRVYRKDAQGRVIEEISQTDAQPPKQLTLSIDQRIQATAYTELKKAVR 254

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
              A S   V++NV TGE+++MV+ P Y+P+     +     NR     +E GS  K   
Sbjct: 255 YNQATSGSAVVVNVKTGELLAMVNSPSYNPNNRADLQSFKMRNRAITDAYEPGSTVKPLV 314

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           +   ++ G   V D+ DT              H     +++ E+  +SSN+G   +A  +
Sbjct: 315 VLSALEHGTHKVGDIIDTNPGWLRIGGRRVSDHRNLGKISLTEVLEHSSNVGVTTMALEL 374

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
           G+    E  +  G  S     L            +W      T+S+G+GLS T LQ A A
Sbjct: 375 GVDELLETYFGAGFGSDTGVSLLGESYGLLTTRRRWSDFELATLSYGYGLSVTTLQLAKA 434

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
              + N GR +P   +   R ES+  S  V   +  + +  ++   V+ G+   A VPG+
Sbjct: 435 YTMIANGGRDMP---LTVFRRESKPESEQVFNPDNTRAVMHMMERVVSDGTATAAQVPGY 491

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            + GKTGT++K              F  + P ++P+ +V+  ++ P   +      G   
Sbjct: 492 RIAGKTGTSRKARATGGYGDEYVALFAGIAPASNPEIVVVVTINEPGTDD---YYGGTAA 548

Query: 576 APMVGNIIRRSASMLGVKPV 595
           AP+  +I+ ++  +L V P 
Sbjct: 549 APVFSSIVSQTMRLLNVPPD 568


>gi|237654090|ref|YP_002890404.1| peptidoglycan glycosyltransferase [Thauera sp. MZ1T]
 gi|237625337|gb|ACR02027.1| Peptidoglycan glycosyltransferase [Thauera sp. MZ1T]
          Length = 588

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 139/554 (25%), Positives = 255/554 (46%), Gaps = 29/554 (5%)

Query: 64  RKVIAHSKNRIGMTIVV---CLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDII 120
           ++ +   + RI M  ++     ++   L ++ +    +  +  +    + E   +R  I 
Sbjct: 16  KRELPAWRPRIIMLALMGCSLALVGRALYLQGVNNDFLQAKGESRYARVLEVPATRGRIT 75

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DR+G+ILA   P  +++  P         + +L  +L  ++   +  +L++   F +L+R
Sbjct: 76  DRHGDILAVSTPVRAVWALPADARLEPAQVRELARLL-EMNVGELNARLAAGRDFVYLKR 134

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           ++ P+  + +    LPG+    E  R+YP     +H++G+ D+++RG  GIE   D +  
Sbjct: 135 QVPPEVAQAVADLRLPGIHQEKEYRRYYPGGEVMAHILGFTDLEDRGQEGIELAFDKRLS 194

Query: 239 ---GLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
              G  RV    +G            ++   + L++D +IQ +    L E  +++  ++ 
Sbjct: 195 GRAGARRVIKDRRGQIVEDVEAIRPPRDGDEVALSIDGKIQYLAWSALREAMEEHKPKAA 254

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TGEV+++V+ P ++P+           NR+    FE GS+ K F  A+ ++ 
Sbjct: 255 AAVVLDVRTGEVLALVNAPTFNPNNRANLTGAQLRNRVFTDAFEPGSVMKPFIAALALER 314

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G   +    DT N              ++ ++T+ ++ + SSNIG  ++A  +G +    
Sbjct: 315 GKVKLNTPIDTGNGRMTIGTATISDTKRHGVITMAQVVQKSSNIGTVKMAQQLGAEEMWH 374

Query: 405 FLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
              +LG  + L    P   +        W+ I   T+S+GHG+ST+ +Q A A      E
Sbjct: 375 LFDQLGFGTPLNLGFPGETSGRLRPAKTWRPIEQATMSYGHGISTSLIQMARAYLVFARE 434

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKT 521
           G L+P +      + +    R V   +T + MR++L      GG+  RA VPG+ V GKT
Sbjct: 435 GELVPLSLTR--VDGTPSSGRRVFSADTARQMRTVLAMAAGPGGTAIRAQVPGYTVAGKT 492

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GTA K+   RY+     +SF+   P +DP+ +V   +D P      Q   G   AP+   
Sbjct: 493 GTAHKLEDGRYAR-KYISSFVGFAPASDPRIVVAVMVDEPSA---GQHYGGTVAAPVFSR 548

Query: 582 IIRRSASMLGVKPV 595
           I   +   LGV P 
Sbjct: 549 ITEGTLRTLGVAPD 562


>gi|144897241|emb|CAM74105.1| Cell division protein FtsI/penicillin-binding protein 2
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 586

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 214/551 (38%), Positives = 316/551 (57%), Gaps = 21/551 (3%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM----NID 110
           G       R + I  S+ R+ +T +V L I+ I+  R+I    +   P  P         
Sbjct: 24  GALRLDGVRSRAIETSRTRLLVTALVFLAIFGIIGGRMIDVAVLDANPAKPRALPQARTQ 83

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVI----SPDEIIEKLQIVLPNLDSEMIR 166
              M R DI DR+G +LAT +PT SLY  P  +I       E  +KL   LP++D++ +R
Sbjct: 84  GLEMGRADITDRDGAVLATSLPTVSLYARPQDMIEARVDVAEAAKKLAAALPDMDADDVR 143

Query: 167 RKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR 226
            ++     F +LRR L+P+QQ  + + G+PG+ F   + R YP  +  +HVVG  DIDN+
Sbjct: 144 ARIQGAKTFVYLRRNLTPRQQYDVNALGIPGLHFEKGERRVYPHGNLVAHVVGMTDIDNK 203

Query: 227 GITGIEKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           GI GIE+F D +            ++  P+ L+LD+ +QN+V  EL ++ +++NA     
Sbjct: 204 GIAGIERFFDGRLT----------EDSAPLALSLDVGVQNVVRTELQKSVQQFNALGATG 253

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           ++ +V TGE+++MVS+PD+DP++   G  E  FNR + G +EMGS FK+F  AM ++SG 
Sbjct: 254 MVADVQTGEMLAMVSLPDFDPNDPPAGTNEAMFNRATKGAYEMGSTFKLFNTAMALESGR 313

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
             +   FD   P+K G H IHD H QNR +++PEI  +SSNIG+A++A   G    + F+
Sbjct: 314 VNINSSFDATKPLKFGSHTIHDDHAQNRWMSVPEILIHSSNIGSARMALEAGSDFQRRFM 373

Query: 407 YRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
            RLG+L     ELPE+ AP  PS W+ I+++TISFGHGLS TP Q      AL+N G   
Sbjct: 374 GRLGMLDSPSLELPEVGAPQVPSPWREINTITISFGHGLSVTPAQLMAGTVALVNGGVFH 433

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQK 526
           P T +    + +     IVLK+ T   MR+L+R  VT G+G++A VPG+EVGGKTGTA+K
Sbjct: 434 PLTLI-HRADGAPVPGEIVLKQKTSAHMRNLMRMVVTEGTGKKADVPGYEVGGKTGTAEK 492

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAPMVGNIIR 584
                Y      +SF+A FP  +P+Y+V++ +D P+  +       AG   AP  G II 
Sbjct: 493 AAHGGYRKKAVLSSFVAAFPMDNPRYVVIAMIDEPQGTKETYGYITAGWTAAPAAGRIIA 552

Query: 585 RSASMLGVKPV 595
           + A MLG+ P 
Sbjct: 553 QIAPMLGIAPK 563


>gi|146342504|ref|YP_001207552.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. ORS278]
 gi|146195310|emb|CAL79335.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. ORS278]
          Length = 582

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 214/533 (40%), Positives = 335/533 (62%), Gaps = 4/533 (0%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGN-IHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           A ++ RIG+ I+    +Y ++  R++ +           +   D    +RPDIIDRNG +
Sbjct: 33  AKARARIGLAIIAFAAVYAVIGGRLVMFAVGSDGPSARRAAQQDAIATARPDIIDRNGAV 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP ++I  DE IE L   LP+LD+  +R ++ S   F WL+R+++P+Q
Sbjct: 93  LATDVKTPSLFAEPRRLIDKDEAIELLTATLPDLDTNEVRERMMSRKGFVWLKREMTPKQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ I   GLPGVGF  E  R YP  +  +H++G V+IDN+GI G+EK+LD QGL  +   
Sbjct: 153 QQDIHRLGLPGVGFLRENKRVYPTGNEVAHLIGLVNIDNQGIAGMEKWLDNQGLADLHRA 212

Query: 247 NKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
               ++  +PI L++DLR+++ +  EL++ K+K+  ++   +++NV TGE+I+MVS+PD+
Sbjct: 213 GFATDRLQRPIELSVDLRVEHALRDELLKAKEKFKTKAASGLVVNVRTGEIIAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK FT+AM +D+G + +  ++D R  +  GK  
Sbjct: 273 DPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDTGKYDLNSMWDARGALHYGKFA 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD  P+ R L++ E+F +SSN+GAA+IA   G++ HK FL ++G   +L TELPE  +P
Sbjct: 333 IHDDEPKGRFLSMKEVFYFSSNVGAARIALTQGVEAHKAFLRKMGQFDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TISFGHG++  PLQ  +  +AL+N G LIPPTFM R+  E+ ++++ V
Sbjct: 393 ILPKRWSELNTITISFGHGMAVAPLQGVMGVSALVNGGYLIPPTFMKRTEAEAMQIAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +K  T + MR L+R     G+ R+A V G+ +GGKTGTA+KVI  RY+       F AV 
Sbjct: 453 IKPETSEKMRYLMRLNAEVGTARKADVKGYYIGGKTGTAEKVINGRYAKKKVLTLFTAVI 512

Query: 546 PTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
           P   P+Y +L  +D P+  +      T+G N  P  GN+I R   +LG++P F
Sbjct: 513 PADKPKYQLLIMLDEPQPLKETYGFITSGWNAVPTAGNVISRIGPLLGIEPRF 565


>gi|242278173|ref|YP_002990302.1| peptidoglycan glycosyltransferase [Desulfovibrio salexigens DSM
           2638]
 gi|242121067|gb|ACS78763.1| Peptidoglycan glycosyltransferase [Desulfovibrio salexigens DSM
           2638]
          Length = 648

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/563 (26%), Positives = 257/563 (45%), Gaps = 30/563 (5%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS----- 115
           KR+++ +  S+N++   +V+  +++  L  R           ++  ++            
Sbjct: 3   KRKKESLKASRNKLLFVMVLFALVWTGLLGRAAWLQLFKGADLSRMVSRQHLAAELERGE 62

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R  I DRNG +LAT +   S+Y+ P KV   D    KL  +L  +    +R+KLS ++ F
Sbjct: 63  RGSIYDRNGNLLATSVEASSVYIRPVKVTDVDGTAYKLSKIL-GISQAKLRKKLSRKSNF 121

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            W++R+++ +  +++    LPGV    E  R YP    A  ++G+  ID  G+ G+EK  
Sbjct: 122 IWIKRQINDRIAQKVEQAKLPGVYLTTEYIRLYPNNYLAGQLLGFSGIDGNGLEGLEKEF 181

Query: 236 DMQGLTR-----VFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKK 278
           + +   R     V     G +              + I L +D  +Q++    L E  KK
Sbjct: 182 NDRLAGRKAQFVVQRDASGRRLYLDAMGREMDVRGKDIHLTIDSHLQSVTENALAEAVKK 241

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           YN +    +++  ++G+V++M + P ++P+         W NR +  + E GS FK F +
Sbjct: 242 YNGKWGSAIVVEAASGDVLAMANFPLFNPNIFRTSAPNIWRNRAALDVHEPGSTFKPFLM 301

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  ++  + T + LFD  N              +   L + +I RYSSNIG A+I   +G
Sbjct: 302 AAALEHKVVTPEKLFDCENGRWKINGKYIKDTHKEGWLPVHKILRYSSNIGCAKIGLELG 361

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAA 456
           +Q + +F+  LG   K    +P  +        +W  I     SFG G+  T +Q A A 
Sbjct: 362 VQNYHKFITDLGFGHKTGLPIPGDRKGLIRPAAKWNEIDLAAGSFGQGVGVTTVQMAKAF 421

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGF 515
             + N+G   P   +   R + E   + +   +  + + +++RE V   G+GR+A + G 
Sbjct: 422 LTIANKGVEKPLRLVQYPRSDQEDQPKRIFSADVAEKVLAMMREVVQDDGTGRKARISGT 481

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V GKTGTAQK  +K    T    SF+A+ P  +P YIV   +D PK             
Sbjct: 482 TVAGKTGTAQKAHRKGGYGTEYIASFVALVPGYNPDYIVYMMVDDPKPN----HYGSTVA 537

Query: 576 APMVGNIIRRSASMLGVKPVFLK 598
           AP V  I+ ++ +  G  P   K
Sbjct: 538 APAVKEIMTQTLAYYGKLPEHRK 560


>gi|299131931|ref|ZP_07025126.1| Peptidoglycan glycosyltransferase [Afipia sp. 1NLS2]
 gi|298592068|gb|EFI52268.1| Peptidoglycan glycosyltransferase [Afipia sp. 1NLS2]
          Length = 579

 Score =  388 bits (997), Expect = e-105,   Method: Composition-based stats.
 Identities = 229/534 (42%), Positives = 340/534 (63%), Gaps = 4/534 (0%)

Query: 67  IAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-NIDEYGMSRPDIIDRNGE 125
            A ++ R+G+ ++    ++ ++A+R++ YG +            D    +RPDI+DRNGE
Sbjct: 29  AAKARARVGLAMLAFSAVFAVIALRLVMYGVMGDTHNGRRGGAQDAVATARPDILDRNGE 88

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           ILATDI   SLY EP K+I  DE IE L   LP+LD   +R +LSS   F WL+R+L+P+
Sbjct: 89  ILATDIKAASLYAEPRKLIDKDEAIELLTATLPDLDPGEVRDRLSSRKGFVWLKRELTPK 148

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           QQ+ +   GLPGVGF  E  R YP     SH++G V+IDN+GI G+EK+LD  GL  +  
Sbjct: 149 QQRDVFKLGLPGVGFLRENKRVYPTGRDVSHLIGLVNIDNQGIAGMEKWLDGNGLADLHR 208

Query: 246 TNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPD 304
                ++  +PI LA+DLR+++ +  ELV+ K+K++A++   ++ NV TGE+++MVS+PD
Sbjct: 209 AGFATDRQQEPIELAVDLRVEHALRDELVKAKEKFHAKAASGIVSNVHTGEIVAMVSLPD 268

Query: 305 YDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKH 364
           +DP+   +       NR++ G++EMGS FK FT+AM +DSG  T+  ++D R P++ G+ 
Sbjct: 269 FDPNNPKEANDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKTTLNSMWDVRTPLQYGRF 328

Query: 365 VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
            IHD HP  R +   E+F YSSNIGAA+IA + GI+ HK FL ++G L++L TELPE  +
Sbjct: 329 RIHDDHPLGRAINTKEVFTYSSNIGAARIALSQGIEAHKAFLAKMGQLTRLRTELPESAS 388

Query: 425 PSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRI 484
           P  P  W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ RS  ++ K+++ 
Sbjct: 389 PILPRHWGELNTVTIAFGHGIAVAPLQAVMGIDALVNGGYLIPPTFLKRSEADAMKLAKR 448

Query: 485 VLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
           V+K  T   MR L+R     G+ R+A VPG+ +GGKTGTA+KVI  RY+     N+F A+
Sbjct: 449 VIKPETSDKMRFLMRLNAEVGTARKADVPGYYIGGKTGTAEKVINGRYAKKKVLNAFTAI 508

Query: 545 FPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
            P  +PQY +L  +D P+         T+G N  P  G +I R A +LG+KP F
Sbjct: 509 MPADNPQYQLLVMLDEPQALPETHGFITSGWNAVPTGGKVIARIAPLLGIKPRF 562


>gi|294501024|ref|YP_003564724.1| stage V sporulation protein D [Bacillus megaterium QM B1551]
 gi|294350961|gb|ADE71290.1| stage V sporulation protein D [Bacillus megaterium QM B1551]
          Length = 638

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/569 (25%), Positives = 256/569 (44%), Gaps = 43/569 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPDIIDRN 123
             + R+ + + V  ++++I+  R+     +  + +             +   R  I+DRN
Sbjct: 7   TVRKRLAIVLFVGFIVFLIIDTRLGYVQLLTGDTLTEKAKDLWSRNIPFEPERGKILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
              LAT+    ++ V P +V +P    EKL  VL     E +  +++  +   +LR   R
Sbjct: 67  DVALATNKSAPTVLVMPRQVENPAVTAEKLAKVL-GASKEKVYEQITKASSSVYLRPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S  +   + +  L GV    +  R+YP  S+ SHV+G+  +DN+G+TG+E + D +  
Sbjct: 126 KISHAKANEVRNLNLKGVYIAEDSKRYYPFGSYLSHVLGFAGVDNQGLTGLELYYDKELK 185

Query: 239 ---GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  ++++  KG+K            +   +RL +D R+Q I+ +EL   +  YN + 
Sbjct: 186 GQKGSVKLYSDAKGKKMPNIADDYTAPVDGLDLRLTIDSRVQTIMERELDNAQTAYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  +  N   GE++ M S P +DP +    K E +  N   + ++E GS FK+ T+A  +
Sbjct: 246 MIAIATNPKNGEILGMSSRPGFDPTDFKNVKPEVYNRNLPIWSVYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D       G  +       +   +  E+ + S N G  ++ + +G +
Sbjct: 306 EEKKVDLLKDQFYDDGAAEVGGARLRCWKKGGHGQQSFLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G++ TP+Q   A +A
Sbjct: 366 KLFKYIKEFGFGQKTGIDLQGEAKGILFSLERVGPVEQATTAFGQGVAVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +               R V+ + T K +R  L   V  GSG+ 
Sbjct: 426 AVNGGTLYEPYIAKEWVDPTTGKVVSSHKPVAKRKVISEETSKQVRFALESVVAQGSGKG 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQK    +Y    +  SF+ V P  +P+ +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKAQNGKYLKNNHIVSFIGVAPADNPEIVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
             G+  AP+VG +I  S  ++ VKP   +
Sbjct: 543 FGGVVAAPIVGKMIEDSLRVMDVKPRKGQ 571


>gi|254448976|ref|ZP_05062430.1| peptidoglycan glycolsyltranferase FtsI [gamma proteobacterium
           HTCC5015]
 gi|198261370|gb|EDY85661.1| peptidoglycan glycolsyltranferase FtsI [gamma proteobacterium
           HTCC5015]
          Length = 564

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 138/550 (25%), Positives = 243/550 (44%), Gaps = 34/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIH-----PEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +    V  + L  R +Q   +       +  A           R  I+DRNG+ L
Sbjct: 3   RRRLVLGALAVAGLCLVGRAVQLQVLDREFYVGQGDARQQRTVPLPAHRGMIVDRNGQPL 62

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQWLRRKLSPQ 185
           A   P  S++V P  V++    + +L  +L ++ +E +  +++     +F +L+R L P 
Sbjct: 63  AMSTPVDSVWVNPKDVLNEMHRLPELARIL-DVPAENLAERIARGKSREFVYLKRHLPPH 121

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
             +  L   +PGV  + E  R+YP    + H++G+ +ID+ G  G+E   +      +G 
Sbjct: 122 IAQAALDLEVPGVSLQREYRRYYPTGEVSGHLLGFTNIDDVGQEGLELAFNDWLSGKEGA 181

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            R+     G            +  + + L++D R+Q + ++ L    +KY A +   V+L
Sbjct: 182 KRILQDRLGQTVSDLGQIEAARPGRDLALSIDRRVQYLAYRVLKSTVQKYQANAGSVVLL 241

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           + +TGEVI++ + P ++P+         + NR    +FE GS  K  T+A  +++G   V
Sbjct: 242 DATTGEVIALANQPGFNPNNRRGLVGSHYRNRAVTDVFEPGSTMKPITVAAALEAGKIAV 301

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
                T        +          +L    +   SSN+GAA+IA +M  + H + L R 
Sbjct: 302 DSKIRTAPGYLRVGNNDVRDTRDYGVLDPAGVIMKSSNVGAAKIALSMETEYHWDVLTRF 361

Query: 410 GLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G      +  P            W      TISFG+GLS++ LQ A A   L N+G L P
Sbjct: 362 GFGQPTGSGFPGETTGYLHGYHTWSEFEQATISFGYGLSSSALQLARAYTVLANDGVLYP 421

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFEVGGKTGTAQK 526
            +F     +        V+   T +T+R +++  VT  G+  +A +PG+ V GKTGTA K
Sbjct: 422 VSFQKGGLD--GVRPSRVISSQTAQTVRDMMQTVVTRQGTAFKARIPGYTVAGKTGTAYK 479

Query: 527 VIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
             +   Y      + F  + P T+P+++ +  +D P+         G+  AP    ++  
Sbjct: 480 YSRSGGYDKDRYTSVFAGMAPATNPRFVAVVMIDEPQ----RGHYGGVVAAPAFAELVGD 535

Query: 586 SASMLGVKPV 595
           +  +  V P 
Sbjct: 536 ALRLFDVAPD 545


>gi|149181750|ref|ZP_01860242.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Bacillus sp. SG-1]
 gi|148850598|gb|EDL64756.1| penicillin-binding protein (sporulation specific penicillin-binding
           protein) [Bacillus sp. SG-1]
          Length = 620

 Score =  388 bits (996), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/552 (26%), Positives = 252/552 (45%), Gaps = 42/552 (7%)

Query: 82  LVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSL 136
           ++I+ ++ +R+        +               +   R  I+D+NG  LAT+    ++
Sbjct: 3   ILIFAVIDVRLGYVQFFMGDKLTSWAKDSWSRNIPFEPERGKILDKNGVELATNQSAPTV 62

Query: 137 YVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL--RRKLSPQQQKRILSFG 194
           +V P ++  P +  EKL   L NL  E I + ++       +   RK+S ++ K +    
Sbjct: 63  FVVPRQITDPAQTAEKLAAAL-NLPLEDIYKYVTKSASMVRINEARKISYEKAKEVRDLD 121

Query: 195 LPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKG 249
           L GV    +  R+YP  S+ SHV+G+  IDN+G+ G+E F D +     G  + F+  KG
Sbjct: 122 LKGVYIAEDSKRYYPFGSYLSHVLGFAGIDNQGLMGLELFYDKELSGEGGSVKFFSDAKG 181

Query: 250 EK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVI 297
           ++            +   ++L +D ++Q I+ +EL   +  YN + +  + ++ + GE++
Sbjct: 182 KRMPDMADDYEAPVDGLDLKLTIDTKVQTIIERELDIAEAAYNPDGIIAIAMDPNNGEIL 241

Query: 298 SMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLF--TVKDLFD 354
           +M S P +DP       +E +  N   +  +E GS FK+ T+A  ++        +   D
Sbjct: 242 AMSSRPTFDPANFRNVPQEIYNRNLPIWSTYEPGSTFKIITLAAALEENKVDLQKEKFHD 301

Query: 355 TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSK 414
           + +    G  +       +   T  E+ + S N G  ++ + +G +   +++   G   K
Sbjct: 302 SGHVEVAGSTLHCWKRGGHGTQTFLEVVQNSCNPGFVELGERLGKETLFKYIKDFGFGQK 361

Query: 415 LETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMI 472
              +L            +   +   T +FG G++ TP+Q   A +A IN G L  P    
Sbjct: 362 TGIDLQGEGKGLLFNLDRVGPVEQATTAFGQGVAVTPIQQVAAVSAAINGGTLYQPYVAK 421

Query: 473 RSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
              +          + +  + V+ K T + +R  L   V  G+GR AFV G+ VGGKTGT
Sbjct: 422 ELVDPETGEVVMRNTPQAKKQVISKETSEQIRYALESVVAQGTGRGAFVEGYRVGGKTGT 481

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           AQKV   RY +  +  SFL   P   P+ +V   +D+PK   +     G+  AP+VGNII
Sbjct: 482 AQKVKDGRYMENNHIVSFLGFAPADKPEIVVYLAVDNPKGTVQ---FGGVVAAPIVGNII 538

Query: 584 RRSASMLGVKPV 595
             S   +GV P 
Sbjct: 539 GDSLRAMGVPPR 550


>gi|157373545|ref|YP_001472145.1| peptidoglycan glycosyltransferase [Shewanella sediminis HAW-EB3]
 gi|157315919|gb|ABV35017.1| Peptidoglycan glycosyltransferase [Shewanella sediminis HAW-EB3]
          Length = 578

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 134/565 (23%), Positives = 253/565 (44%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R++     + R+ + +    +++  L  R           +  E    ++      +
Sbjct: 4   QAKRKQKPQLIEWRLYVVVAFVCLLFTSLIGRAAYIQIIEPEKLRHESDMRTLRTTSREV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRR-K 168
            R  I DRNGE+LA  +P  ++Y +P  V   +        + L  +L     ++++R +
Sbjct: 64  QRGLITDRNGEMLAVSVPVKAVYADPKVVHDRNGFVDMRRWQALADILHEPKEKILKRVQ 123

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            + + +F +L+R+++P   + I    LPGV  + E  R+YP +  ++ +VG  +ID+ GI
Sbjct: 124 SNPKKRFTYLKRQVTPAVAEYISKLKLPGVYLKSESRRYYPTSEISAQLVGITNIDDIGI 183

Query: 229 TGIEKFLDMQG-----LTRVFTTNKGE--------KNL---QPIRLALDLRIQNIVHQEL 272
            GIE   +          +V  +  G         ++      + L+LD RIQ + ++EL
Sbjct: 184 EGIENSYNDWLTGTPSKQKVRKSRDGHVVERLDIVQDGDSPNDLVLSLDQRIQQLAYREL 243

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
            +  +   A S   V+L+V TGEV++M + P Y+P+     +     NR     +E GS 
Sbjct: 244 KKATEINQATSASIVVLDVHTGEVLAMANTPSYNPNSRDNLQAFRMRNRALTDSYEPGST 303

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G      +  T          +         L++ ++  +SSN+G A+
Sbjct: 304 IKPFVVAAALEAGTIKSDQVIKTYPGRMRIGGKVVRDSRYYGDLSLADVLVHSSNVGMAK 363

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           I+ +M +Q        +GL +     L    A       +W      T+SFG+GL  TPL
Sbjct: 364 ISLSMPVQELLGAYQTMGLGNYSGINLAGESAGLIHDRRRWSEFERATLSFGYGLMVTPL 423

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L ++G L P + +   ++        V+     +++  +L      GG+  +
Sbjct: 424 QLARLYATLGSKGVLYPVSILKLKQQ---PEGEQVISPEIAQSVMEMLIGVTEKGGTATK 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA+K +   Y +      F  V P  +P+  ++  ++ PK    ++ 
Sbjct: 481 AHIEGYPVAGKTGTARKAVAGGYGED-YVAIFAGVAPVHNPELAIVVVVNEPK---GDRY 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+  +++  +  ML ++P
Sbjct: 537 YGGDVAAPVFASVMSGALQMLNIEP 561


>gi|119773489|ref|YP_926229.1| peptidoglycan glycosyltransferase [Shewanella amazonensis SB2B]
 gi|119765989|gb|ABL98559.1| peptidoglycan synthetase FtsI [Shewanella amazonensis SB2B]
          Length = 578

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/565 (25%), Positives = 249/565 (44%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGM 114
           Q +R +       R+ + +    +++  L  R      I P     E    ++      +
Sbjct: 4   QAKRNQKAQPIPWRLYVVVGFVCLLFTSLVGRAAYIQLIEPDKLRRESDMRTLRTSSSDV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRR-K 168
            R  I DRNGE+LA  +P  ++Y +P +V   +   +      L  VL      +I R +
Sbjct: 64  QRGLITDRNGEMLAVSVPVQAVYADPKEVHDKNGFADMRRWQALADVLHEKPDALISRVQ 123

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P   + I    LPGV  + E  R+YPA    + ++G  +ID+ GI
Sbjct: 124 DNPSKRFTYLKRQITPAVAEYIRQLKLPGVYLKPESRRYYPAGEITAQLIGVTNIDDVGI 183

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            GIE   +          +V  +  G            ++   + L++D RIQ + ++EL
Sbjct: 184 EGIESTYNNWLTGTPAKQKVRKSRDGHVVERLDIVQEGESPNDLVLSIDQRIQQLAYREL 243

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               + + A S   V+++V TGEV++M + P Y+P+     +     NR     FE GS 
Sbjct: 244 KRATEMHQATSGSVVVIDVLTGEVLAMANTPSYNPNSRDDWQSFKMRNRAVTDTFEPGST 303

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  ++SG     D+  T                    +++ +I   SSN+G A+
Sbjct: 304 VKPFVVAAALESGTVKASDIIPTSPGWMRLGGRQVRDSNNYGDMSLTKILVKSSNMGVAK 363

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           ++  M ++      Y +GL +     LP   A       +W      T++FG+GL+TT L
Sbjct: 364 LSLGMPVEQLLGTYYSIGLGNYSGIGLPGESAGLIQEKHRWSDFERATLAFGYGLTTTTL 423

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L N G L P + +   +   +   + VL       + ++L      GG+ R+
Sbjct: 424 QLARMYATLGNGGVLYPASILKLKQ---KPEGQQVLSPQVANNVMNMLVGVTEQGGTARK 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGT++K +   Y D     +F  V P  +P+  +   ++ PK    ++ 
Sbjct: 481 AHIDGYPVAGKTGTSRKAVAGGYGDD-YLATFAGVAPVNNPRLAIAVVINEPK---GDRY 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+   ++  +  ML V+P
Sbjct: 537 YGGDVSAPVFSKVMAGALQMLNVEP 561


>gi|110833453|ref|YP_692312.1| penicillin-binding protein 3 [Alcanivorax borkumensis SK2]
 gi|110646564|emb|CAL16040.1| penicillin-binding protein 3 [Alcanivorax borkumensis SK2]
          Length = 573

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 154/559 (27%), Positives = 260/559 (46%), Gaps = 31/559 (5%)

Query: 61  KRRRKVIAHSKNRIGMTI---VVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRP 117
           ++ R+     + R  +       CL++   + +++IQ+  +  +    ++ ++     R 
Sbjct: 6   RKIRQPNHLMRWRFVLGFWSVCACLLLIRAVDLQVIQHDFLAHQGDIRNLRVEPLAAHRG 65

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKF 175
            I DR G+ LA   P  +L+V P + +   +   +L      +D +   RK+      +F
Sbjct: 66  VIRDRAGKPLAVSTPVVTLWVNPREAMEHQDQWGRLAGN-SVIDQKAFARKVRRHKSREF 124

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +L R L+P+  K +LS  +PGV    E  R+YPA   ASHVVG+ +ID++G  GIE  L
Sbjct: 125 IYLERGLAPETAKTVLSLNVPGVYALTEYRRYYPAGEVASHVVGFTNIDDQGQEGIELAL 184

Query: 236 D-----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKY 279
           +       G  +V     G            +  + + L++DLR+Q + ++EL+   +K+
Sbjct: 185 EDHLSGHSGRKKVVRDLLGRVIQDIEVLEPAEPGEDVTLSIDLRLQYLAYRELLGAVQKF 244

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
           NA+    V+L+V TGEV++MV+ P Y+P+           NR    +FE GS  K FT+A
Sbjct: 245 NAKGGSAVVLDVRTGEVLAMVNQPAYNPNNRGNLDTGALRNRAVTDLFEPGSTMKPFTVA 304

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
             ++ G+ T     +T              H    ++ I  +   SSN+G +++A AM  
Sbjct: 305 AALEMGMVTPSTTINTHPGTLRVGSKTIRDHRDYGVIDITTVLTKSSNVGTSKLALAMDS 364

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           Q    +L R G         P       P  S+W+ +    +S+G+GLS + +Q A A A
Sbjct: 365 QALPGYLERFGFGQSTHIAFPGESDGLLPLRSKWRDVERAALSYGYGLSVSAVQLAQAYA 424

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFE 516
            + N+G  +P T     + +       V+ K T + +  +L   V+  G+ RRA VPG++
Sbjct: 425 VIANDGVKVPLTL---KKVDQPPQGEQVIGKATARQLVQMLETVVSRVGTARRAQVPGYQ 481

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVA 576
           V GKTGT  KV+   Y+D      F  + P TDP+ + +  +D P     +    G+  A
Sbjct: 482 VAGKTGTVHKVVNGGYADDNYIGLFAGLAPATDPRIVTVVVIDDP---AGDAYYGGLVAA 538

Query: 577 PMVGNIIRRSASMLGVKPV 595
           P    I+      L V P 
Sbjct: 539 PAFSRIMSGVLRSLHVPPD 557


>gi|302871363|ref|YP_003839999.1| stage V sporulation protein D [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302574222|gb|ADL42013.1| stage V sporulation protein D [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 719

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 135/589 (22%), Positives = 246/589 (41%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + V  + +++L  R+     I  E +                 R  
Sbjct: 2   KEASLRIKKRILFVMAVFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QMDYQKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +  ++  +I  + LPG+       R YP  +  + V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKEKADKIRKYALPGIYLTGGTKRVYPNGNFLAQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPVDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP++ F+   +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNKPFELIYKDRFPDFDKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+      F  R  +KV   +I  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGVVNENSQFYCRGYVKVANAIIKCWRYYNPHGSENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHS 436
            E  + S N    +I   +G +   +++   G   K   +LP           +   +  
Sbjct: 361 VEGVQNSCNPVFIEIGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPIGKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--------VSRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K          R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAVANDGVWVQPHVVKTIYDKDKKLIKSFDSPQKRRVLDQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + +R++L+  VT G+G  A++ G+ V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLRNILQSVVTNGTGHNAYLLGYRVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|332305219|ref|YP_004433070.1| penicillin-binding protein transpeptidase [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332172548|gb|AEE21802.1| penicillin-binding protein transpeptidase [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 585

 Score =  387 bits (995), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/569 (24%), Positives = 258/569 (45%), Gaps = 41/569 (7%)

Query: 61  KRRRKVIAHS------KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNI 109
           K+R +    +      + R  + I V +++++ L+ R +    I P     +    ++  
Sbjct: 7   KKRNQQAKQNVAPTALQWRYLLVICVIMLVFVGLSARAVYIQVIDPDLLIQQGDNRTLRT 66

Query: 110 DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVIS-----PDEIIEKLQIVLPNLDSEM 164
               + R  I DRNG+ LA  +P  +++ +P  ++           + L  VL     ++
Sbjct: 67  QNMPVHRGLITDRNGQNLAVSVPVRAIWADPKTIVDNGSLNDKRRWQALADVLGQDYDKL 126

Query: 165 IRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDID 224
           + R  + + +F +++R++SP     +    + GV  R E  R+YP    ++ ++G+ ++D
Sbjct: 127 VSRVKNPKKRFVYIQRQVSPAMADYVDQLSINGVYLRDESRRYYPTGEVSAQLIGFTNVD 186

Query: 225 NRGITGIEKFLDMQ-----GLTRVFTTNKGEK----------NLQPIRLALDLRIQNIVH 269
           ++GI GIEK  +       G  ++    KG +            + I+L +D RIQ   +
Sbjct: 187 DQGIEGIEKLYNQWLKGSPGSRKIRRDAKGRQVEILEQEAGEEPRDIQLTIDQRIQAFAY 246

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
           +EL +  + Y A S   V+++V TGE+++MV+ P Y+P+           NR     FE 
Sbjct: 247 KELKKAVQYYKATSASAVVVDVQTGEILAMVNNPSYNPNNRSGVSGHRIRNRAITDAFEP 306

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K   +   ++ G   +  + DT          +         L +  I R SSN+G
Sbjct: 307 GSSIKPIAVLSALEFGSVEMDSVIDTSPGWMRVGGSMVRDSRNYGELDLTGIIRKSSNMG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLST 447
            +++A ++  Q   +  Y +GL+S   + L    +  +    +W      T+SFG+GLS 
Sbjct: 367 TSKLALSVPKQFLIDQYYNMGLMSDTGSNLIGESSGIFHDRSRWSEFELSTLSFGYGLSV 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGS 506
           T  Q A   + L + G   P + +   ++  E     VL ++    + +++   V  GGS
Sbjct: 427 TTAQLARMYSTLGSGGIKRPLSIIKSEQKAPE---ERVLSEDIAHEVLTMMESVVNEGGS 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G +A VPG+ V GKTGT++K +   Y +    + F  V P +DPQ  V+  ++ P+    
Sbjct: 484 GTKARVPGYRVAGKTGTSRKAVAGGYGEE-YVSIFAGVAPVSDPQLAVVVLINEPRGDL- 541

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
               AG   AP+   I+  S  ML V P 
Sbjct: 542 --YYAGDTAAPVFSKIMSNSLQMLNVPPD 568


>gi|78043919|ref|YP_360894.1| penicillin-binding protein 2B [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996034|gb|ABB14933.1| penicillin-binding protein 2B [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 739

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 139/581 (23%), Positives = 242/581 (41%), Gaps = 74/581 (12%)

Query: 86  IILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEP 140
            I+ +R+          +  E +A   +       R +I DRNG +LA  I   SL   P
Sbjct: 24  SIIIVRLFYLQVIKAETLRSEALADRQSEIILPPQRGNIYDRNGNLLAQSISVESLVANP 83

Query: 141 HKV-------------ISPDE------------IIEKLQIVL--PNLDSEMIRRKL-SSE 172
            ++                ++            +++KL  +L       E +R+KL ++ 
Sbjct: 84  KQLMKYYYDETKEAPPEDKEKDGKSLKPKPLGLLVDKLSKILNLDEKAKENLRQKLSNTR 143

Query: 173 TKFQWLRRKLSPQQQKRILSF--------GLPGVGFRLEKSRFYPAASHASHVVGYVDID 224
           + F W++RKLS  + K +              G+    E  R+YP    A+H++GY   D
Sbjct: 144 SSFIWIKRKLSYDEAKALKKLLADKEDEVYTFGLELVEETQRYYPHNDFAAHLLGYAGTD 203

Query: 225 NRGITGIEKFLDM-----QGLTRVFTTNKG------------EKNLQPIRLALDLRIQNI 267
           N+G+ G+E  LD       G        +G             +    + L +D  IQ  
Sbjct: 204 NQGLAGLELSLDKYLKGIPGRLVTERDARGLEIPESSSLYIPARPGNNVYLTIDETIQYF 263

Query: 268 VHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKE-GWFNRISYGI 326
           V +EL   + +        ++++  TGE++ M S P+++P+E  K   E    N   +  
Sbjct: 264 VERELNNIESQLKPALAMIIVMDPKTGEILGMGSRPNFNPNEFAKYPAEVREKNFAIWYN 323

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDY-HPQNRILTIPEIFRYS 385
           +E GS FK+ T A  ++ G+   +D F     I V    I  +    +   +  E+ + S
Sbjct: 324 YEPGSTFKIITSAAALEEGVVHPQDRFYDPGYIVVNGRKIRCWSKTPHGAQSFAEVIQNS 383

Query: 386 SNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHSLTISFGH 443
            N G  ++  ++G +   +++   G   K   ELP  Q      +     ++  TIS G 
Sbjct: 384 CNPGFVKVGLSLGKERFYKYIRSFGFGEKTGIELPGEQKGLIIPEDKVTNVNLATISIGQ 443

Query: 444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVS--------RIVLKKNTVKTMR 495
            ++ TP+Q   A  A+ N G+L+ P  + +  +++  +         + V+ + T +T+R
Sbjct: 444 SIAVTPIQLIRAVCAVANGGKLVEPHVVKKIVDQAGNIVLENKPRYLKRVISEETARTLR 503

Query: 496 SLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIV 554
            LL   V  G+G +A++ GF V GKTGTAQ V     Y+      SF+   P  DP++  
Sbjct: 504 ELLERVVLKGTGTKAYIKGFRVAGKTGTAQVVSPTGGYAPGKYVASFVGFAPANDPKFAA 563

Query: 555 LSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           L  +  P          G   AP+  ++       +GVKP 
Sbjct: 564 LVVIVEPST---GVYYGGQIAAPVFKSLGEDILRYMGVKPQ 601


>gi|254470463|ref|ZP_05083867.1| penicillin-binding protein, transpeptidase [Pseudovibrio sp. JE062]
 gi|211960774|gb|EEA95970.1| penicillin-binding protein, transpeptidase [Pseudovibrio sp. JE062]
          Length = 574

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 235/575 (40%), Positives = 356/575 (61%), Gaps = 19/575 (3%)

Query: 25  MNMSHNSANISFRNMESGHNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVI 84
           M    +S+ +   N    H                     +V    ++RI   + + +++
Sbjct: 1   MARKADSSFLRRSNFNQKHGTTAM----------------RVRGPGRSRIVFAMTLFVLV 44

Query: 85  YIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-RPDIIDRNGEILATDIPTFSLYVEPHKV 143
           Y  +A R+I  G    +P    +         RPDI+DRNGEILATDI + +LY EP K+
Sbjct: 45  YGAIAGRLILLGLQDGDPAQRFLAAQSTVAQARPDIVDRNGEILATDIKSAALYAEPRKI 104

Query: 144 ISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLE 203
              DE+ + L  VLP LD+  I+++L S   F WL+R+++ +Q++ I + GLPGVGFR  
Sbjct: 105 PDTDEVFDGLISVLPELDTPAIKKRLESNALFTWLKREITVEQRQAIHALGLPGVGFRES 164

Query: 204 KSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN-KGEKNLQPIRLALDL 262
             RFYP     SH++G V++DN+G++G+EK++D   L  +       ++N++P++L++DL
Sbjct: 165 NKRFYPGGQTVSHILGTVNVDNQGLSGMEKYVDQAWLKDLQDLGFTQDRNMEPVKLSVDL 224

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           R+Q+ V  EL  + + Y A++   V+L   TGEVI+M S+PD+DP+   +  ++   NR+
Sbjct: 225 RVQHAVRDELRRSMEYYKAKAAMGVVLKADTGEVIAMTSLPDFDPNNRQQALEKARMNRV 284

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIF 382
           + G+FE+GSIFK  TIAM +DSG   ++D FD   PI+V    I D+H + R+L++PE+F
Sbjct: 285 TGGVFELGSIFKGLTIAMALDSGKVKLEDGFDATKPIRVAGQKIDDFHGKRRVLSVPEVF 344

Query: 383 RYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFG 442
            YSSNIG  ++    GI+  KEFL ++GL  K+ TE+P +  P  P +W  + ++TISFG
Sbjct: 345 IYSSNIGTIKVMQRAGIEAQKEFLSKVGLTEKMNTEMPGVARPLLPPKWNELAAMTISFG 404

Query: 443 HGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV 502
           HG+  TPLQ AVA A L+N G+ + PTF+ RS EE++K+++ VLK  T + +R L RE V
Sbjct: 405 HGVGVTPLQMAVAGATLVNGGKYLEPTFLPRSEEEADKLAKQVLKPETSEILRYLNRENV 464

Query: 503 TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
             GSGRRA VPG++VGGKTGTAQKV+  RY++ +  NSF++ FP ++P+Y+VL  +D P+
Sbjct: 465 LRGSGRRAAVPGYDVGGKTGTAQKVVNGRYAEGVYLNSFMSAFPMSNPEYLVLIVLDEPQ 524

Query: 563 IKERNQL-TAGINVAPMVGNIIRRSASMLGVKPVF 596
             E  +  TAG N  P   ++IRR A MLGV P F
Sbjct: 525 KVEGQRYSTAGWNAVPTTASVIRRIAPMLGVVPDF 559


>gi|152996633|ref|YP_001341468.1| peptidoglycan glycosyltransferase [Marinomonas sp. MWYL1]
 gi|150837557|gb|ABR71533.1| Peptidoglycan glycosyltransferase [Marinomonas sp. MWYL1]
          Length = 587

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 147/563 (26%), Positives = 256/563 (45%), Gaps = 42/563 (7%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           K R      V L++++I   R+          +  +    ++  +    +R  I+DR GE
Sbjct: 12  KWRFRFVYGVALLLFLIAGGRLFYLTVVDKDFLQNQGEIRAVRTEAIPATRGMILDRRGE 71

Query: 126 ILATDIPTFSLYVEPHKVIS----------PDEIIEKLQIVLPNLDSEMIRRKL--SSET 173
            LA   PT+++   P  +            P++ I++L  V+  +    ++ +   +   
Sbjct: 72  PLAVSTPTWTIIANPRALWKLPRDPSLNIGPEQEIKRLAEVM-GVGRAWLQERFEANKTR 130

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F +LRR++ P +   I++  + GV    E  RFYPA   ASHVVG+ +ID++G  GIE 
Sbjct: 131 SFMYLRRQIPPHEADAIMAANVVGVSKTKEYKRFYPAGEVASHVVGFTNIDDKGQEGIEL 190

Query: 234 FLDM-----QGLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKK 277
             D       G         G           E   + I L++DLR+Q + ++EL     
Sbjct: 191 AYDKALEGQPGRRSYVKDLTGNIIRGIGVEEAEHPGENIELSIDLRLQYLAYRELKAAVT 250

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           ++ A S   VIL+V TGEV++MV+ P Y+P++  K + E   NR    +FE GS  K FT
Sbjct: 251 EHRATSASAVILDVKTGEVLAMVNQPSYNPNDRSKLEYEELRNRAVIDLFEPGSTMKPFT 310

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           I+  + SG ++ +   +T                   ++   ++   SSN+GA++IA ++
Sbjct: 311 ISAALMSGQYSTESTINTAPGYLRFGRFTIRDAANYGVIDFEKLLIKSSNVGASKIALSL 370

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
                    Y LG+ S +    P           +W      T+S+G+GLS + LQ A A
Sbjct: 371 PQDAVWNIDYELGIGSPVGIGFPGEATGVLPSHPKWHPSEIATLSYGYGLSVSTLQLAQA 430

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
              L N+G  +P   +   ++++    + V+ K+  +++  ++   V  GSG+ A +PG+
Sbjct: 431 YMVLANDGYRVP---VTMFKQDAPPAGKQVIPKDVARSVVKMMEAVVQRGSGKAAQIPGY 487

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V GKTGT  KV  K Y        F  V P T+P+  ++  ++ PK     +   G   
Sbjct: 488 RVAGKTGTVHKVGSKGYEYDQYIAMFAGVAPATNPRLAMVVMINDPK---GREYYGGEVA 544

Query: 576 APMVGNIIRRSASMLGVKPVFLK 598
           AP+   ++  + + L + P   +
Sbjct: 545 APVFSRVMEGALTTLNIYPDLPE 567


>gi|114566357|ref|YP_753511.1| peptidoglycan glycosyltransferase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337292|gb|ABI68140.1| Peptidoglycan glycosyltransferase [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 705

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/540 (26%), Positives = 242/540 (44%), Gaps = 36/540 (6%)

Query: 86  IILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVIS 145
            +  ++ ++   +  + +   M        R  I DRNG  LA  +   S+Y  P +V S
Sbjct: 29  RVFWVQFVKGAELSEKALQNRMRDVPVESKRGIIYDRNGNELAISVSADSVYAIPAEVCS 88

Query: 146 P---DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRL 202
                EI  KL  VL  +D E + R++S  + F+W++R++ P++ K I    LPG+G   
Sbjct: 89  KGQQKEIAAKLAQVL-EMDEESLLRRISRSSSFEWVKRQIDPEKSKTIRKMDLPGIGLTE 147

Query: 203 EKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNK--------- 248
           E  R+YP  + ASHV+G   +DN G+ G++ + D      +G   +              
Sbjct: 148 ESRRYYPKGTLASHVLGIAGVDNNGLEGVDFYYDKLVGGTKGRIIIEHDAVNRPIPEATH 207

Query: 249 ---GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 +   + L +D  IQ I  +EL +   +  A+S   +I++VSTGE++++ S P +
Sbjct: 208 KFIPPVDGANLILTIDETIQYITERELDKVFNERKAKSAAAIIMDVSTGEILALASRPTF 267

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP++          N      +E GS  K+ T AM +  G+   +  F     IKVGK V
Sbjct: 268 DPNDFSAYAVSNRRNYGINDSYEPGSTMKITTAAMALQEGVVNAESRFYCPGYIKVGKEV 327

Query: 366 IHDYHPQ-NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQA 424
           I     + +   +  +    S N+   QI   +G+Q + ++L   G   K   +LP    
Sbjct: 328 IGCPDRKPHGSQSFAQTIEKSCNVAFIQIGLELGLQNYYKYLKAFGFGQKTGIDLPGEAE 387

Query: 425 PSYPSQWKRIH--SLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES---- 478
                +         T++ G   + TP+Q   A  A+ NEG+L+ P  + +  ++     
Sbjct: 388 GILIPRASAQQIELATMAMGQANAVTPIQLLTAVGAVANEGKLMKPHLLKQVLDDKGNVI 447

Query: 479 ----EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-KKRYS 533
                +V R V+   T + +  +L   V  G+GR A++ G++V GKTGTAQKV    RY 
Sbjct: 448 KKVEPQVVRQVISPETARELCMMLEGEVVNGTGRNAYLEGYKVAGKTGTAQKVGPDGRYM 507

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              +  SF+   P   P+ + +  +D+PK         G   AP    I+  S   L + 
Sbjct: 508 SNEHVASFVGFAPANQPRLLGIVVVDAPKGYP---YYGGWVAAPAFREILNDSFKYLEIP 564


>gi|298293106|ref|YP_003695045.1| peptidoglycan glycosyltransferase [Starkeya novella DSM 506]
 gi|296929617|gb|ADH90426.1| Peptidoglycan glycosyltransferase [Starkeya novella DSM 506]
          Length = 604

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 228/530 (43%), Positives = 335/530 (63%), Gaps = 4/530 (0%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-MNIDEYGMSRPDIIDRNGEILA 128
           ++ RI + ++V   +Y+ +A R+  + +     +A   +  D    +RPDI+DRNG +LA
Sbjct: 56  ARARILLCMLVFAGVYLAIAGRLAMFASAPDSALARRGLGTDAVASARPDILDRNGLVLA 115

Query: 129 TDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQK 188
           TD+ + SL+ EP+++I  DE +E L  VLP+LD   +R++LS++  F WL+R ++PQQQ+
Sbjct: 116 TDVKSASLFGEPNRIIDVDEAVEALTAVLPDLDGNELRQRLSTKRGFIWLKRDITPQQQR 175

Query: 189 RILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNK 248
            I + GLPG+GF  E  R YP  +  +HV+G  +IDN+GI GIEK++D  GL  +     
Sbjct: 176 EIHNLGLPGIGFMTENRRVYPGGTLGAHVMGSTNIDNQGIAGIEKWVDTGGLADLHLAGF 235

Query: 249 GE-KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDP 307
              +  +PI LALDLR+Q+++  EL   K+K+ A +    +++V TGE+++MVS+PD+D 
Sbjct: 236 ASDRQQEPIELALDLRVQHVLRDELFTAKEKFKAIAAAGTVVDVRTGEIVAMVSLPDFDA 295

Query: 308 HEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIH 367
           ++  +       NR++ G+FEMGS FK  T AM +DSG F +    D R  ++ G+  IH
Sbjct: 296 NDPARSLDPKNLNRLTTGVFEMGSTFKALTFAMALDSGRFNINSTLDARGALQFGRFRIH 355

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY 427
           DYH +NR+LT+PE+F YSSNIG A++A A+G+  HK FL + G L +L TELPE  AP  
Sbjct: 356 DYHAENRVLTLPEVFLYSSNIGTAKMALALGVDAHKAFLAKAGQLDRLRTELPESAAPIV 415

Query: 428 PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLK 487
           P +W  +++ TI+FGHGL+  PLQ  +A  AL+N G LIPPTF+ R+ EE++ + + ++K
Sbjct: 416 PKRWGELNTATIAFGHGLAVAPLQAVMAVNALVNGGNLIPPTFLKRTPEEAQALGKQIIK 475

Query: 488 KNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPT 547
             T   MR LLR     GS ++  VPGF  GGKTGTA+KVI  RYS T    +F  +FP 
Sbjct: 476 PETSAKMRYLLRLNAEKGSAKKVNVPGFYAGGKTGTAEKVIGGRYSKTKLLTTFTGIFPM 535

Query: 548 TDPQYIVLSFMDSPKIKERNQLT--AGINVAPMVGNIIRRSASMLGVKPV 595
            +PQY+VL  +D P+  E       AG N AP  G II R   MLG+ P 
Sbjct: 536 DNPQYLVLVILDEPQAVEGTYGYATAGWNAAPTTGKIISRIGPMLGIMPR 585


>gi|254504086|ref|ZP_05116237.1| penicillin-binding protein dimerization domain family [Labrenzia
           alexandrii DFL-11]
 gi|222440157|gb|EEE46836.1| penicillin-binding protein dimerization domain family [Labrenzia
           alexandrii DFL-11]
          Length = 537

 Score =  386 bits (992), Expect = e-105,   Method: Composition-based stats.
 Identities = 239/528 (45%), Positives = 345/528 (65%), Gaps = 3/528 (0%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNID-EYGMSRPDIIDRNGEILATDIP 132
           + + ++    +Y  +  R+I    +   P    ++       SRPD+IDRNGEILATDI 
Sbjct: 1   MYLAMLAFACVYAAIGGRLIYLAQMDEAPSRAWISAQDSVAASRPDLIDRNGEILATDIK 60

Query: 133 TFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILS 192
           T SLY EP +++  DE +E L  +LP+LD  ++RR+L S   F WL+R+++P + +++  
Sbjct: 61  TASLYAEPRRILDVDEAVEGLTRILPDLDEALVRRRLESGAGFVWLKREMTPDKAEQVHD 120

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGE-K 251
            GLPG+GF  E  RFYP    A H+VG V++DN+G++GIEK++D Q L  + +      +
Sbjct: 121 LGLPGIGFLSENQRFYPGGPTAGHIVGAVNVDNQGLSGIEKYVDDQWLRDLQSIGFASGR 180

Query: 252 NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAF 311
            ++P+RL++DLR+Q++V  ELV+  ++Y A +   ++L+  TGEV++M S+PDYDP++  
Sbjct: 181 TMEPVRLSVDLRVQHVVRDELVKAMERYRAIAAAGIVLDAKTGEVVAMSSLPDYDPNDRS 240

Query: 312 KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHP 371
           +  ++   NR + G+FEMGS+FK FT AM +DSG  T+ D FD   P++     I D+H 
Sbjct: 241 EALEKDRLNRATGGVFEMGSVFKAFTTAMALDSGAVTINDSFDATRPLRAAGRTITDFHG 300

Query: 372 QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW 431
           +NRIL++PEIF YSSNIG A++  A G+   KEF+ RL L  +L+TELPE  AP  P +W
Sbjct: 301 KNRILSVPEIFIYSSNIGTAKMMLATGVARQKEFMERLHLTKRLQTELPENAAPLLPPKW 360

Query: 432 KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTV 491
             + ++TISFGHGLS TP+QTAVAAAA++N G L+PPTF+ R++EE + + + V+     
Sbjct: 361 NELAAMTISFGHGLSVTPMQTAVAAAAMVNGGSLLPPTFVPRTQEEVKTLKKQVISPEVS 420

Query: 492 KTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ 551
           + MR L R  V  GSGRRA VPG+ VGGKTGTA+K+    Y      NSFL+ FP  DP+
Sbjct: 421 RMMRYLFRLNVLSGSGRRADVPGYTVGGKTGTAEKIENGVYVSNKRRNSFLSAFPMDDPR 480

Query: 552 YIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           Y+VL  +D PK +      TAG+N AP  G IIRR+A MLGV P F K
Sbjct: 481 YVVLVVLDEPKSEREGIGATAGLNTAPTTGAIIRRAAPMLGVMPRFGK 528


>gi|312876345|ref|ZP_07736330.1| stage V sporulation protein D [Caldicellulosiruptor lactoaceticus
           6A]
 gi|311796839|gb|EFR13183.1| stage V sporulation protein D [Caldicellulosiruptor lactoaceticus
           6A]
          Length = 719

 Score =  386 bits (991), Expect = e-105,   Method: Composition-based stats.
 Identities = 133/589 (22%), Positives = 248/589 (42%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + V  + +++L  R+     I  E +                 R  
Sbjct: 2   KEASIKIKKRILFVMAVFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QMDYQKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +  ++  RI  + LPG+       R YP  +  + V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKEKADRIRKYALPGIYLTGGTKRVYPNGNFLAQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPVDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP++ F+   +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNKPFELIYKDRFPDFDKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+      F  R  +KV   ++  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGVVNENSQFYCRGYVKVANAILKCWRYYNPHGSENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP           +   +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPLSKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--------VSRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K        + R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAVANDGVWVQPHVVKAIYDKDKKLIKSFDTPLKRRVLDQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + ++++L+  VT G+G  A++ G++V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLKTILQSVVTNGTGHNAYLLGYKVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|312794109|ref|YP_004027032.1| stage v sporulation protein d [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181249|gb|ADQ41419.1| stage V sporulation protein D [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 719

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 133/589 (22%), Positives = 248/589 (42%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + V  + +++L  R+     I  E +                 R  
Sbjct: 2   KEASIKIKKRILFVMAVFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QMDYQKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +  ++  RI  + LPG+       R YP  +  + V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKEKADRIRKYALPGIYLTGGTKRVYPNGNFLAQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPVDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP++ F+   +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNKPFELIYKDRFPDFDKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+      F  R  +KV   ++  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGVVNENSQFYCRGYVKVANAILKCWRYYNPHGNENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP           +   +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPLSKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--------VSRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K        + R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAVANDGVWVQPHVVKAIYDKDKKLIKSFDTPLKRRVLDQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + ++++L+  VT G+G  A++ G++V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLKTILQSVVTNGTGHNAYLLGYKVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|157963628|ref|YP_001503662.1| peptidoglycan glycosyltransferase [Shewanella pealeana ATCC 700345]
 gi|157848628|gb|ABV89127.1| Peptidoglycan glycosyltransferase [Shewanella pealeana ATCC 700345]
          Length = 578

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 137/566 (24%), Positives = 244/566 (43%), Gaps = 39/566 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R++     + R+ + +    +++  L  R           +  +    ++      +
Sbjct: 4   QAKRKQKPQLIQWRLYVVVAFVCLMFTSLVGRAAYIQIVEPEMLRHQSDMRTLRTTSREV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRRKL 169
            R  I DRNG++LA  +P  ++Y +P  V   +   +      L  VL     E I +++
Sbjct: 64  QRGLITDRNGDMLAVSVPVKAVYADPKVVHDKNGFADMRRWQALADVLHE-PREDILKRV 122

Query: 170 --SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
             +   +F +L+R+++P     I    LPGV  + E  R+YP     + +VG  +ID++G
Sbjct: 123 QSNPRKRFTYLKRQVTPAVADYIKQLKLPGVYLKPESRRYYPTGEITAQLVGITNIDDKG 182

Query: 228 ITGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQE 271
           I G+E   +          +V  +  G            ++   + L++D RIQ + ++E
Sbjct: 183 IEGLENTYNDWLTGTPSKQKVRKSRDGHVVERLDMVQEGESPNDLVLSIDQRIQQLAYRE 242

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L +  +   A S   V+L+V TGEV++M + P Y+P+     +     NR     +E GS
Sbjct: 243 LKKATEVNQATSGSIVVLDVLTGEVLAMANTPSYNPNSRENLQSYRMRNRALTDAYEPGS 302

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
             K F +A  +D+G      +  T          I         L++  I  +SSN+G  
Sbjct: 303 TIKPFVVAAALDAGTIKTDQIIKTNPGRLRIGGKIVRDGRNYGDLSLSGILVHSSNVGMT 362

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTP 449
           +IA +M +Q        +GL +     L    A       +W      T+SFG+GL  TP
Sbjct: 363 KIALSMPVQELLGAYQTMGLGNYSGINLEGESAGLIHDRRRWSEFERATLSFGYGLMATP 422

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGR 508
           LQ A   A L N+G   P + +   +         V+     + +  +L      GG+ R
Sbjct: 423 LQLARMYATLGNKGVQYPVSILKLKQT---PEGTQVISPQVAQDVMEMLVGVTEKGGTAR 479

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           +A + G+ V GKTGTA+K +   Y +      F  V P  +P+  +   ++ PK    ++
Sbjct: 480 KAHIEGYPVAGKTGTARKAVAGGYGED-YVALFAGVAPVHNPRLAIAVVVNEPK---GDR 535

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
              G   AP+  +++  +  ML V+P
Sbjct: 536 YYGGDIAAPVFASVMSGALQMLNVEP 561


>gi|325980949|ref|YP_004293351.1| peptidoglycan glycosyltransferase [Nitrosomonas sp. AL212]
 gi|325530468|gb|ADZ25189.1| Peptidoglycan glycosyltransferase [Nitrosomonas sp. AL212]
          Length = 575

 Score =  386 bits (990), Expect = e-105,   Method: Composition-based stats.
 Identities = 142/550 (25%), Positives = 250/550 (45%), Gaps = 33/550 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           ++R+   ++V  +I   LA R           +  +  +    + E    R  I DRNG 
Sbjct: 15  RSRLLFGMLVLGLIS--LAARAAYLQGMNNEFLQKKGESRYSRVVEMNADRGMITDRNGH 72

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           I+A   P  S++ +P  V+   E +++L  +L    +++         +F +L+R++ P 
Sbjct: 73  IMAISSPVASIFADPKVVVIKPEKLQQLAHLLEMSSADLNALLTRENRRFVYLKRQIVPD 132

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             ++I+   + G+    E  R+YP    A+HV+G+ DI++ G  G+E+  +       G 
Sbjct: 133 TAEKIMQLKIKGIYLTSESKRYYPEGEFAAHVLGFTDINDEGQEGVERGWEQTLAGELGR 192

Query: 241 TRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
            RV   NKG             K  + + L++D RIQ   H EL +      A++   V+
Sbjct: 193 RRVIKDNKGQIIDEDVESIRSPKPGKDLVLSIDRRIQYRAHAELKQAVLANRAKAGSIVV 252

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           L+  TGE++++ + P Y+P+       E   NR     FE GS  K FT+A+ ++ G   
Sbjct: 253 LDAQTGEILALTNWPAYNPNRRSTINNERLRNRALIDTFEPGSTLKPFTVAIALEVGKVN 312

Query: 349 VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
              +  T                    LT+ EI + SSN+G A+IA +M  Q   E   R
Sbjct: 313 SNTILQTAPGAWQVGRKTIRDVSNKGELTVAEIIQQSSNVGTAKIALSMEPQTMWEMFNR 372

Query: 409 LGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
            G  +   +  P   +      ++W+ I   T+S+GHG+ST+ +Q A A     + G L 
Sbjct: 373 SGFGTLTNSGFPGEASGILRPYNRWRPIEQATMSYGHGISTSLIQLARAYTIFTSGGELK 432

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQ 525
           P + + ++      + + V+ ++T   M  +L      GG+   A + G+ V GKTGTA 
Sbjct: 433 PVSLLKQNI---PVMGQRVISRDTAWAMSRMLEMATQPGGTAPLAQISGYRVAGKTGTAH 489

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K+I  RY+     ++F+   PT++P+ I+   +D P      +   G   AP+   ++  
Sbjct: 490 KLIDGRYASKSYISTFVGYAPTSNPRLIIAVMIDEPSA---GKYFGGAVAAPIFSKVMSG 546

Query: 586 SASMLGVKPV 595
           +  +L V P 
Sbjct: 547 ALHILNVPPD 556


>gi|229541205|ref|ZP_04430265.1| stage V sporulation protein D [Bacillus coagulans 36D1]
 gi|229325625|gb|EEN91300.1| stage V sporulation protein D [Bacillus coagulans 36D1]
          Length = 638

 Score =  385 bits (989), Expect = e-105,   Method: Composition-based stats.
 Identities = 151/572 (26%), Positives = 261/572 (45%), Gaps = 43/572 (7%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSR 116
            +R      + R+   ++  +VI+ I+ +R+        + +             +   R
Sbjct: 1   MKRVSNVTVRKRLVFILLCGIVIFSIIDVRLGYVQFGLGDMLTNRAKALWSRSIPFEGER 60

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
             I DRNG  +A++    ++++ P +V  P +  EKL   L + D E + ++++      
Sbjct: 61  GKIEDRNGVPIASNQSAPTIFIIPRQVKDPAKTAEKLGDAL-DADKEKLYKEITQVRSIV 119

Query: 177 WLR--RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
            ++  RK+S ++   +   GL GV    +  R+YP   + SHV+G+   DN+G+TG+E +
Sbjct: 120 RIKEGRKISNEKANAVRRLGLLGVYIAEDSKRYYPFGRYLSHVLGFTGADNQGLTGLELY 179

Query: 235 LD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENK 276
            D      +G    +T  KG              KN   ++L +D ++Q I+ +EL   +
Sbjct: 180 YDDALSGKKGAVEFYTDAKGKKKMKDMADEYEPPKNGLDLKLTVDTKVQTIIERELDNAE 239

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKV 335
           KKY+ + +  + ++  TGE++ M S P Y P       +E +  N   +  +E GS FK+
Sbjct: 240 KKYHPDGLIAIAMDPGTGEILGMSSRPSYTPDNYKNVPQEVYNRNLPIWSTYEPGSTFKI 299

Query: 336 FTIAMGIDSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQI 393
            T+A  ++       KD F     ++VG   +H +    +   T  E+ + S N G  ++
Sbjct: 300 ITLAAALEEKKVNLTKDKFYDSGAVEVGGSTLHCWKRGGHGSETFLEVVQNSCNPGFVEL 359

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQ 451
            + +G     +++   G  +K   +L    +       +   +   T +FG G+S TP+Q
Sbjct: 360 GERLGKNTLFKYIRNFGFGTKTGVDLSGEASGILFNLDRVGPVELATTAFGQGVSVTPIQ 419

Query: 452 TAVAAAALINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGV 502
              A +A +N G L  P       +          +    R V+ +NT K +R  L   V
Sbjct: 420 QVAAVSAAVNGGILYKPYIAKELVDPKTGETVMRKNPVAKRRVISENTSKQIRHALETVV 479

Query: 503 TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
           T GSG+ A+V G+ VGGKTGTAQK    RY +     SF+   P  DP+ +V   +D+PK
Sbjct: 480 TQGSGKNAYVDGYPVGGKTGTAQKAKNGRYLENNYVLSFIGFAPANDPKIVVYLAVDNPK 539

Query: 563 IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
              +     G   AP+ G II  S   +GVKP
Sbjct: 540 NTIQ---FGGQVAAPIAGTIIGDSLRAMGVKP 568


>gi|222149142|ref|YP_002550099.1| penicillin binding protein 2 [Agrobacterium vitis S4]
 gi|221736127|gb|ACM37090.1| penicillin binding protein 2 [Agrobacterium vitis S4]
          Length = 583

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 273/549 (49%), Positives = 385/549 (70%), Gaps = 2/549 (0%)

Query: 52  MEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDE 111
           +      F+   ++    +K R+G+ I+   ++Y ++  R++QYG  HPE  +  M  D 
Sbjct: 26  VRGKGRAFEGAGKRKADMAKRRVGLLILGFTLVYGVIGGRLVQYGYAHPESTSSIMPPDR 85

Query: 112 YGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS 171
              +RPDI+DRNG++LATDI T SL+ EPHK++  DE +EKLQ VL +LDS    +KLSS
Sbjct: 86  LMAARPDILDRNGQVLATDIRTVSLFAEPHKIVDVDEAVEKLQTVLADLDSRDTYKKLSS 145

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
           ++ FQWLRR+L+P+QQ +IL+ G+PG+GFR E  RFYP  S A+H+VG+V+IDNRG+ G+
Sbjct: 146 KSHFQWLRRQLTPKQQSQILALGIPGIGFRPEIRRFYPGGSTAAHIVGFVNIDNRGMAGM 205

Query: 232 EKFLDMQGLTRVFTTNK-GEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           EK++D QGL  +          L+P++L++DLR+QNIVH  +   +  + A+S G V+L+
Sbjct: 206 EKYIDNQGLADLADLGMTSNAPLEPVKLSIDLRVQNIVHDVVAAAQVNFKAKSAGAVVLD 265

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
           V TGEV+ M S PD+DP++  +G KEGW NR+S G FEMGS FK FT+AMG+D+G   + 
Sbjct: 266 VETGEVLGMASYPDFDPNKPEEGAKEGWLNRMSNGTFEMGSTFKSFTMAMGLDTGRVKLS 325

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
           D+FD R P+K+G   IHD+H Q++ L++P+IF+YSSNIG A+I D +GI   KE+L RLG
Sbjct: 326 DVFDARYPLKIGGFTIHDFHGQSKFLSVPDIFKYSSNIGTAKIIDVVGIPEQKEYLNRLG 385

Query: 411 LLSKLETELPEIQAPSYPS-QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
           LL+K++TELPE++ PS P  +WK+I S+TISFGHG++TTPLQTAVA AALIN G+LI PT
Sbjct: 386 LLTKMKTELPEVKMPSQPRGEWKKISSVTISFGHGVATTPLQTAVAGAALINGGKLIQPT 445

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK 529
           F+ R+ +E+ +V+  VLK +T   MR L       GSGR A VPG +VGGKTGTA KV+ 
Sbjct: 446 FLPRTVDEANEVAEAVLKPSTSADMRYLFEYNGINGSGRGARVPGLDVGGKTGTADKVVN 505

Query: 530 KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASM 589
            RY   LNFN+FL  FP + P+Y+VLSF+D P   E     +     P+V ++IRR+A +
Sbjct: 506 GRYDSKLNFNAFLGAFPMSKPRYVVLSFIDEPLSGEGGGTISAFTALPIVRDVIRRTAPI 565

Query: 590 LGVKPVFLK 598
           LGV+P + +
Sbjct: 566 LGVEPNYGQ 574


>gi|257092214|ref|YP_003165855.1| peptidoglycan glycosyltransferase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257044738|gb|ACV33926.1| Peptidoglycan glycosyltransferase [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 583

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/554 (26%), Positives = 255/554 (46%), Gaps = 31/554 (5%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDII 120
            ++    R  +  ++ L  + +L  R           +  +  +      E   SR  I 
Sbjct: 19  QLSLPPWRSRLMALMILGSFAVLIGRAFYLQILNNDFLQEKGESRYRRDIEISASRGRIA 78

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DR+G++LA   P  S++  P       E  ++L  +L   D + + RKL +E  F +LRR
Sbjct: 79  DRHGDVLAISTPMKSIWAIPPATTLTSEQSKQLAALL-ETDPKQLSRKLDTEKTFVFLRR 137

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           ++ P   +++ +  LPG+G   E  RFYP     +H+VG+  +D++G+ G+E     Q  
Sbjct: 138 QIPPPVAEQVAALKLPGIGQNKEYRRFYPTGEMTAHMVGFTGVDDKGLEGVELAFHGQLL 197

Query: 239 ---GLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
              G   V    +G            ++ + IRLALD +IQ + + +L +     NA++ 
Sbjct: 198 GEPGSRSVIKDRRGQIVEDVGSIKPPQDGKDIRLALDSKIQYLAYSQLKQAIADNNAKAG 257

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
           G V+L+V TGE++++ + P Y+P+           NR     FE GS  K FTIA+G+++
Sbjct: 258 GVVVLDVRTGEILALANWPTYNPNNRENLSGSQLRNRAVTDTFEPGSTLKPFTIALGLEN 317

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G      + +         +        +  L++ E+ + SSN+GAA+IA  +  Q   E
Sbjct: 318 GKVRSDTIINCAPGRLTIGNATISDAHPHGALSVAEVIQKSSNVGAAKIAAMLPYQKMWE 377

Query: 405 FLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +G         P   +        W+ I   T+++GHG+S + +Q A A +    +
Sbjct: 378 MFDDVGFGQLPRLGFPGEVSGRLRPWKNWRPIEQATMAYGHGISVSLIQLARAYSVFARD 437

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLR-EGVTGGSGRRAFVPGFEVGGKT 521
           G L+P +      + S      V    T + +R++L    + GG+  +A +PG+ V GKT
Sbjct: 438 GDLVPLSLTRA--DSSLPHGASVFSPKTAREVRAMLEMAVLPGGTAPKAQIPGYRVAGKT 495

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GTA K+   RY++    +SF+   P +DP+ IV   +D P      +   G   AP+  +
Sbjct: 496 GTAHKLAGGRYAN-KYVSSFVGFAPASDPRLIVAVMIDEPSA---GKHYGGDVAAPVFAS 551

Query: 582 IIRRSASMLGVKPV 595
           ++  S   LG+ P 
Sbjct: 552 VMGSSLRTLGIAPD 565


>gi|83648528|ref|YP_436963.1| penicillin-binding protein 2 [Hahella chejuensis KCTC 2396]
 gi|83636571|gb|ABC32538.1| penicillin-binding protein 2 [Hahella chejuensis KCTC 2396]
          Length = 590

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/542 (26%), Positives = 253/542 (46%), Gaps = 25/542 (4%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           I +     ++++ ++ +++I +  +  +    ++ ++    +R  I+DRNGE LA   P 
Sbjct: 35  IMLVACFIVLVWRVIDLQVINHEFLRSQGDMRTVRVEPIQATRGKILDRNGEPLAVSAPV 94

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRR-KLSSETKFQWLRRKLSPQQQKRILS 192
            +L+  P +    DE   KL  +L     EM++R +     +F +++R+LSP+  +  + 
Sbjct: 95  VTLWANPQEAQENDEGWRKLADLLGMQSDEMVKRLRRHKGKEFIYVQRQLSPETGRLAMD 154

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTN 247
             L G+  + E  R+YPA   A+H+VG  DID +G  G+E   D       G  +V    
Sbjct: 155 LKLQGLYAKREFKRYYPAGEVAAHIVGITDIDEKGQEGVELAFDQYLRGVNGSKKVLKDR 214

Query: 248 KG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           +G            ++   ++L++DLR+Q + ++EL    + +NA+S   VIL+V TGEV
Sbjct: 215 RGYVIKDLSLLQDAQSGADLQLSIDLRLQYMAYRELKAAVEAHNAKSGSLVILDVRTGEV 274

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++MV+ P ++P+        G  NR    +FE GS  K  +IA  + +G FT +   +T 
Sbjct: 275 LAMVNQPSFNPNNRDSMNPSGLRNRAVTDLFEPGSTVKPLSIAAALKTGSFTTETRINTS 334

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
                              L +  I   SSN+G +++A  +G +   E  Y+ G      
Sbjct: 335 PGFLRLNGQTIRDARDYGTLDLVSIITKSSNVGTSKVALKIGGEAVFETFYQAGFGQSSG 394

Query: 417 TELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            E P          ++W+ I   T+S+G+GLS T LQ A +  A+  +G   P + +   
Sbjct: 395 IEFPGEAVGVLPNFTKWQPIRLATLSYGYGLSVTALQLAQSYMAIAADGVRRPVSLIRGG 454

Query: 475 REESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           ++      + V+     + +R +L   V  GG+G RA V  + V GKTGT  KV +  Y+
Sbjct: 455 QQ--GVSPQQVMSPGISRHIREMLETVVLKGGTGTRAHVAEYRVAGKTGTTHKVGEHGYA 512

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
           D      F  + P   P+  +   M+ P+     +   G   AP+   ++  +  +L V 
Sbjct: 513 DDAYNAVFAGLAPVEKPRLAMAIVMNEPQGS---EYYGGEVSAPVFARVVANALRLLNVA 569

Query: 594 PV 595
           P 
Sbjct: 570 PD 571


>gi|237749175|ref|ZP_04579655.1| FtsI cell division protein [Oxalobacter formigenes OXCC13]
 gi|229380537|gb|EEO30628.1| FtsI cell division protein [Oxalobacter formigenes OXCC13]
          Length = 590

 Score =  385 bits (989), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/553 (25%), Positives = 242/553 (43%), Gaps = 34/553 (6%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDR 122
           + S  R  + + +  + +  L  R +         +  +  +      E   +R  I+DR
Sbjct: 30  SLSPWRSRLVLFMLFLAFAGLIARALWLQGISTDFLQKQGESRYARTLELPATRGKILDR 89

Query: 123 NGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           NG +LA+ +P  +++  P  V   P E I KL  +L  +    +  KL S+  F +L+R+
Sbjct: 90  NGHVLASSVPVKAIWAIPEDVLTQPKEKISKLAALL-GMTESSLYAKLDSDKSFVYLKRQ 148

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD----- 236
           +       I+  G+ G+  R E  RFYP     +HVVG+ ++++ G  GIE         
Sbjct: 149 VDNDVADEIVKLGIAGIQTRKEYKRFYPEGEVMAHVVGFTNVEDIGQEGIELASQNVLAG 208

Query: 237 MQGLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
            +G  RV     G             + + + L++D ++Q I ++ L E  +K+ A++  
Sbjct: 209 EKGSRRVIKDRLGHIVEDMRAIKEPLDGKDLVLSIDSKLQYIAYKYLSEAVEKHKAKAGS 268

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            ++L+  TGEV++MV++P ++P++          NR     FE GSI K F++A+ ++ G
Sbjct: 269 AIVLDTHTGEVLAMVNLPSFNPNDRRHLTGAQLRNRAMTDTFEPGSIMKPFSVALALEKG 328

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           +     +  T N               N  +++ ++   SSNIG A+IA  M      E 
Sbjct: 329 IVKPTSMIATGNGKLTIGTATIGDTHSNGTISVAQVIEKSSNIGTAKIALQMQPVEMWEM 388

Query: 406 LYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
              LG   +     P   A        W+ I   T+S+GHG+S +  Q A +       G
Sbjct: 389 FTSLGFGQQPRFGFPGAVAGRVRPYKSWRPIEQATMSYGHGISVSLFQIAHSYMIFARNG 448

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFEVGGKTG 522
             IP +F+ R+        + ++ + T   MR +L    +  G+ RRA V G+ V GKTG
Sbjct: 449 DTIPLSFLKRNEM---PAGQRIVSEKTATDMRQMLEMVTSEHGTARRAQVSGYRVAGKTG 505

Query: 523 TAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNI 582
           TA K+   RY       SF+   P +DP+ ++   +D P          G    P+   I
Sbjct: 506 TAYKIEGGRYVR-KYVGSFVGFAPASDPRVVIAVMIDEPTA----GHYGGTVAGPVFSAI 560

Query: 583 IRRSASMLGVKPV 595
              +   + V P 
Sbjct: 561 AADTLRAMNVAPD 573


>gi|325288824|ref|YP_004265005.1| stage V sporulation protein D [Syntrophobotulus glycolicus DSM
           8271]
 gi|324964225|gb|ADY55004.1| stage V sporulation protein D [Syntrophobotulus glycolicus DSM
           8271]
          Length = 682

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 140/570 (24%), Positives = 244/570 (42%), Gaps = 50/570 (8%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRN 123
               RI     +C +  ++L +R+          +                 R +I D N
Sbjct: 6   RMHKRIVFLFAICSIFLLVLVVRLGIVQLRDGPFLKGIADDYHFRGVPVAPKRGNIEDCN 65

Query: 124 GEILATDIPTFSLYVEPHKVISP---DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           G +LA  + T ++Y  P +V      DEI +KL  +L   + E I ++++  +  +++++
Sbjct: 66  GNVLAMSVSTQTVYAIPAEVKKSGRGDEIADKLAKILGE-NKEDILKRITKRSSLEYVKK 124

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+  +    I    LPG+G   + SR+YP  + A+H++G+V ID++G+ GIE   + +  
Sbjct: 125 KIPAENAAEIKQANLPGIGVVEDSSRYYPNQTLAAHILGFVGIDSQGLEGIEFSRNKELT 184

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVE-------NK 276
              G         G                  ++L +D  IQ    +EL +       N 
Sbjct: 185 GIAGSILTEYEANGIEMPNALQQYVDPIQGNTVKLTIDKNIQAFAQRELDQLMSGQGQNM 244

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVF 336
           +    +S   +++  STG ++++ S P +DP+      +    N      +E GS FK+ 
Sbjct: 245 EGKVPKSASILVMEPSTGRMLAIASAPTFDPNNYKDADQSTRRNAAIQNGYEPGSTFKII 304

Query: 337 TIAMGIDSGLFTVKDLFDTRNPIKV-GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           T+A  ++  + + ++ F       V GK++       +   T  E+   S N G  ++  
Sbjct: 305 TLAAALEEKVISKEERFYDSGSYTVLGKNIHCWKSGGHGSQTFTEVAENSCNPGFIEMGQ 364

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTA 453
            +G     ++L   G   K   E+            +   +   T+S G   + TP+Q  
Sbjct: 365 RLGTGKFYQYLTAFGFGEKTGIEMSGEATGILRNKKKATALDLATMSIGQTNNVTPIQLL 424

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVS--------RIVLKKNTVKTMRSLLREGVTGG 505
            A +A+ N G L+ P  +        +V         R V+ K+T K  R +L   VT G
Sbjct: 425 TAVSAVANGGVLMKPQLVQEIINPQGEVVVPFAKQEVRRVISKDTAKLEREILESVVTNG 484

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +GRRAF+PG+ V GKTGTAQKV    Y       SF++  P  +P+  +L+ +D      
Sbjct: 485 TGRRAFLPGYRVAGKTGTAQKVANGSYVQGEYIASFISFAPADNPRLAILAVVD------ 538

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
                 G   AP+V +++  S   LGVKP 
Sbjct: 539 GVSFYGGTVAAPIVQSVMLDSLKYLGVKPD 568


>gi|298369644|ref|ZP_06980961.1| penicillin binding protein transpeptidase domain-containing protein
           [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282201|gb|EFI23689.1| penicillin binding protein transpeptidase domain-containing protein
           [Neisseria sp. oral taxon 014 str. F0314]
          Length = 581

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 156/567 (27%), Positives = 257/567 (45%), Gaps = 37/567 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNID 110
           Q L +  + K    S  RI + +    V +  L  R +       E +        +   
Sbjct: 10  QMLPKAPKAKKPISSNGRILVVLGALAVGFAGLLGRGVYLQTSQHEFLKNQGDQRFVRTL 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRK 168
               SR  I DRNG  LA   PT SL+  P ++     +  +EKL  ++ ++    I+ K
Sbjct: 70  TLPASRGMITDRNGATLALSAPTESLFAMPSEMDEMPTEAQLEKLSSII-DVPVASIKEK 128

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
           L  +  F +L+R+LS ++   I + G+ G GF+ E  R YP  +  +HV+G+ +ID +G 
Sbjct: 129 LGKKKDFIYLKRQLSKEKADEIAALGIKGFGFQKELKRHYPMGNLFAHVIGFTNIDGKGQ 188

Query: 229 TGIEKFLDM-----QGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQ 270
            G+E   +       G   V   NKG              KN + + L+LD RIQ + ++
Sbjct: 189 EGLELSREDILRGSDGAKVVLRDNKGNIVDSLDSPRNNAPKNGRDMVLSLDQRIQTLAYE 248

Query: 271 ELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMG 330
           EL +    + A++   V+L+  TGE++++V+ P YDP++      E   NR    + E G
Sbjct: 249 ELNKAVDYHQAKAGTVVVLDAQTGEILALVNSPAYDPNQPGSAGSEQRRNRAVTDMIEPG 308

Query: 331 SIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA 390
           S  K FTIA  +DSG                              L +  I + SSN+G 
Sbjct: 309 SAMKPFTIAKALDSGKV--NTSQRFNTNPYKIGPATVRDTHVYPSLDLRGIMQKSSNVGT 366

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTT 448
           ++++     +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  +
Sbjct: 367 SKLSAMFKPKEMYDFYHDLGVGVRMHSGFPGESAGLLRNWKRWRPIEQATMSFGYGLQLS 426

Query: 449 PLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSG 507
            LQ A A   L + G L+P   +   ++      + V+K  T + +R ++      GG+G
Sbjct: 427 LLQLARAYTMLTHNGELLP---VSFEKQAVAPEGKRVIKAETARQIREMMVAVTEPGGTG 483

Query: 508 RRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
               V GF+VG KTGTA+K+I  RY D  +  +F+   P  +P+ IV   +D P     N
Sbjct: 484 TAGAVDGFDVGAKTGTARKLINGRYVDNKHVATFVGFAPAQNPRVIVAVTVDEPTA---N 540

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
               G    P+   ++  S ++LGV P
Sbjct: 541 GYYGGTVAGPVFKQVMSGSLNILGVSP 567


>gi|288958917|ref|YP_003449258.1| cell division protein [Azospirillum sp. B510]
 gi|288911225|dbj|BAI72714.1| cell division protein [Azospirillum sp. B510]
          Length = 624

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 196/534 (36%), Positives = 307/534 (57%), Gaps = 16/534 (2%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS----MNIDEYGMSRPDIID 121
            +  S+ R+ +T  V   ++  +++++     +            + +D    +R DI+D
Sbjct: 50  ALEQSRYRLMVTAAVVTTVFTAISVKLAMATLLAGGGGEARQHVALELDNTPTNRADILD 109

Query: 122 RNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           RNG +LAT + T SLY +P  V  P+E  +KL   LP+LD + +  KLS + +F WL+R 
Sbjct: 110 RNGNLLATSLVTQSLYADPKLVSRPEEAAQKLVSALPDLDYKDVLGKLSGDRRFVWLKRN 169

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLT 241
           L+P+QQ  +   G+PGV F  E+ RFYPA    +H+VG+  IDN G+ G+E+  + +   
Sbjct: 170 LTPKQQAAVHRLGIPGVSFEREERRFYPAGPLTAHIVGFTGIDNNGLAGMEQGFNKRLT- 228

Query: 242 RVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVS 301
                   E+   P++L++DLR+Q+++ +EL    ++++A     ++ +V  GEV++MVS
Sbjct: 229 --------EEPGTPVQLSIDLRLQHVLKKELTATVQEFSAIGAAGIVFDVRNGEVLAMVS 280

Query: 302 IPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKV 361
           +PD+DP +      E  FNR + G++EMGS FK+F  A+  DSG   V D+FD  +P+K+
Sbjct: 281 LPDFDPQDPTGLNPETLFNRATLGVYEMGSTFKIFNSALAFDSGKIRVSDMFDAAHPVKI 340

Query: 362 GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
           G+  I+DYH  +R LT+ E+F++SSN+G+ ++   +G+   K F+ ++G       ELPE
Sbjct: 341 GRFTINDYHNLHRALTVAEVFQHSSNLGSVRMIQLIGVAAQKAFMTKMGFTRPTGLELPE 400

Query: 422 IQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
              P  P+ W+ ++S TISFGHG+S +P+ T  AAA++IN G    PT + R   E E  
Sbjct: 401 SGWPLVPNPWREVNSYTISFGHGISVSPMHTVAAAASVINGGFFHKPTLLKRKAGE-EIP 459

Query: 482 SRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSF 541
           +  V+ + T   MR + R  VT G+G+ A V G+ VGGKTGTA K   K Y      +SF
Sbjct: 460 TEQVVSRQTSDMMRRMFRFVVTDGTGKTAAVKGYVVGGKTGTADKQKGKHYEKNSRMSSF 519

Query: 542 LAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVK 593
           L  FP  DP+YIV   +D PK   R     T G   AP VG I+++   +L V 
Sbjct: 520 LGAFPMNDPRYIVYVLVDEPKGIARTGGFATGGTVGAPTVGRIVKQIGPLLNVP 573


>gi|148257425|ref|YP_001242010.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. BTAi1]
 gi|146409598|gb|ABQ38104.1| division-specific transpeptidase, penicillin-binding protein
           [Bradyrhizobium sp. BTAi1]
          Length = 582

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 217/533 (40%), Positives = 336/533 (63%), Gaps = 4/533 (0%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGN-IHPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           A ++ RIG+ I+    +Y I+  R++ +           +   D    +RPDI+DRNG +
Sbjct: 33  AKARARIGLAIIAFAAVYAIIGGRLVMFAVGADGPTARRAAQQDAIATARPDIVDRNGAV 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP ++I  DE IE L   LP+LD+  +R +L S   F WL+R++SP+Q
Sbjct: 93  LATDVKTPSLFAEPRRLIDKDEAIELLTATLPDLDTSEVRERLMSRKGFVWLKREMSPKQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q+ I   GLPGVGF  E  R YP  +  +H++G V+IDN+GI G+EK+LD QGL  +   
Sbjct: 153 QQDIHRLGLPGVGFLRENKRVYPTGNEVAHLIGLVNIDNQGIAGMEKWLDNQGLADLHRA 212

Query: 247 NKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
               ++  +PI L++DLR+++ +  EL++ K+K+  ++   +++NV TGE+++MVS+PD+
Sbjct: 213 GFATDRLQRPIELSVDLRVEHALRDELLKAKEKFKTKAASGLVVNVRTGEIVAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK FT+AM +D+G + +  L+D R P+  GK  
Sbjct: 273 DPNSPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDTGKYDLNSLWDARGPLHYGKFA 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD  P+ R L++ E+F +SSN+GAA+IA   G++ HK FL ++G   +L TELPE  +P
Sbjct: 333 IHDDEPKGRFLSMKEVFYFSSNVGAARIALTQGVEAHKAFLRKMGQFDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TI+FGHG++  PLQ  +  +AL+N G LIPPTFM R+ EE+  +++ V
Sbjct: 393 ILPKRWAELNTVTIAFGHGMAVAPLQGVMGVSALVNGGLLIPPTFMKRTEEEAMALAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVF 545
           +K  T + MR L+R     G+ R+A V G+ +GGKTGTA+KVI  RY+       F AV 
Sbjct: 453 IKPETSEKMRYLMRLNAEVGTARKADVKGYYIGGKTGTAEKVINGRYAKKKVLTLFTAVI 512

Query: 546 PTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
           P   P+Y +L  +D P+  +      T+G N  P  GN+I R   +LG++P F
Sbjct: 513 PADKPRYQLLIMLDEPQPLKETYGFITSGWNAVPTAGNVIARIGPLLGIEPRF 565


>gi|21230194|ref|NP_636111.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769816|ref|YP_244578.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188993031|ref|YP_001905041.1| Cell division protein FtsI [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21111732|gb|AAM40035.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575148|gb|AAY50558.1| penicillin-binding protein 3 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167734791|emb|CAP53001.1| Cell division protein FtsI [Xanthomonas campestris pv. campestris]
          Length = 623

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/551 (27%), Positives = 253/551 (45%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  V   +  + L  R              +  A  +       SR  I DRNGE
Sbjct: 18  RGRLTLVGVALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 77

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 78  PLAVSTPVESIWVNPQELLRNPDRIPELATALGQ-PLDELNAKLAQKAGKEFMYLKRRIN 136

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 137 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 196

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     +  A     V
Sbjct: 197 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENKAAGGSMV 256

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 257 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 316

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q   + +
Sbjct: 317 TKDTIIDTNPGYMAVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYQSI 376

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S  ++  P   +     P +W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 377 RNFGYGSAPQSGFPGESSGMVLQPQKWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 436

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 437 LTPPTFVRGQHNE----TRQVVTPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 492

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 493 RKNGAGGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 549

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 550 GALRLMDVPPD 560


>gi|269960235|ref|ZP_06174610.1| penicillin-binding protein 3 [Vibrio harveyi 1DA3]
 gi|269835042|gb|EEZ89126.1| penicillin-binding protein 3 [Vibrio harveyi 1DA3]
          Length = 601

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/558 (27%), Positives = 252/558 (45%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +      + +L  R+     I P     +    S+ +     +R  I DRNGE
Sbjct: 49  RWRFQLLLFFVFCAFALLVGRVAYIQVIEPDNLIKQGDLRSVRVKAIPSARGIISDRNGE 108

Query: 126 ILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRRKLSS--ETKFQWL 178
            LA  +P  +++ +P  +     +        L  VL  LD + +  K+    + +F +L
Sbjct: 109 PLAVSVPVEAVWADPKTIFKEGALQQTKSWYALADVL-GLDRQGLINKIKKNEKRRFIYL 167

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R++SP     I    LPGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 168 QRQVSPAMANYIRELKLPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEW 227

Query: 239 -----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G   +     G           +  +P++L +D RIQ + ++ + +    + A S
Sbjct: 228 LTGAAGKKTIRKDRYGRVVENIALEEKQEGKPLQLTIDQRIQAVAYRAIKQAVADHRATS 287

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              VIL+V TG V++MV+ P Y+P+     +     NR+     E GS  K F +   ++
Sbjct: 288 GSVVILDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRVITDSLEPGSTIKPFVVLAALE 347

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT N I           P+    ++  I + SSNIG  ++A  M ++   
Sbjct: 348 NGVADKDTIVDTGNGILQLGGSRVRDAPKVGKASLTTILKKSSNIGVTKLAMQMPVEALL 407

Query: 404 EFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +GL       L       +P  S+W  I   TISFG+GLS TP+Q A A A L N
Sbjct: 408 GLYSSVGLGELSGLNLVGEVVGIFPSRSRWSPIERATISFGYGLSVTPIQLAHAYATLGN 467

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +  +  +   ++R V+ K   + +  +L      GGS RRA VPG+ VG K
Sbjct: 468 LGKYEPIHIIESNDND---MARQVVSKENARLVLDMLETVTQKGGSARRAAVPGYRVGAK 524

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           TGTA+K     YSD    N    V P +DP+  ++  ++ P+  +      G   +P+  
Sbjct: 525 TGTARKASAGGYSDE-YINYTAGVAPVSDPRLALVVVVNEPQGDD---YYGGSVASPVFS 580

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L V P   K
Sbjct: 581 EIMKGALQILNVAPDENK 598


>gi|163794521|ref|ZP_02188492.1| Cell division protein FtsI/penicillin-binding protein 2 [alpha
           proteobacterium BAL199]
 gi|159180245|gb|EDP64768.1| Cell division protein FtsI/penicillin-binding protein 2 [alpha
           proteobacterium BAL199]
          Length = 565

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 199/542 (36%), Positives = 319/542 (58%), Gaps = 19/542 (3%)

Query: 59  FQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP---EPIAPSMNIDEYGMS 115
            +   ++ I   +NR+ +   +  + ++ ++ R+++   +       ++ S       + 
Sbjct: 10  LEGHAKQAIETGRNRLILAGCLIGLAFVAVSARVVELSALRNHSEPALSASSVDTTLTVG 69

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKF 175
           R DI+DRNG ++AT + T SLY +P +V+  ++   +L   LP+++      KL+S+ +F
Sbjct: 70  RADIVDRNGLLVATSLRTPSLYADPKEVLDAEDAAFRLATALPDINPAETAAKLASDRRF 129

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            WL+R L+P++Q++I S G+PG+ F  E  R YP  S  +HVVG+ DID+RGI+G+E+  
Sbjct: 130 VWLKRNLTPREQQQINSLGIPGLHFFDEWKRVYPQGSLTAHVVGFTDIDDRGISGVERSF 189

Query: 236 DMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
           D                  P+RLALDLR+Q+IV QEL +    + A     VI++V+TGE
Sbjct: 190 DDVLRGGRE----------PLRLALDLRVQHIVRQELAQQIATFEAIGGAGVIVDVNTGE 239

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
            I+MVS+PD+D + A +   +  FNR + G++EMGS FK+F  AM +++G  T++  +D 
Sbjct: 240 TIAMVSLPDFDSNVAGQMDPDALFNRATLGVYEMGSTFKIFNTAMALEAGTATMRSGYDA 299

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
            NPIK+ +  I DYH + R L++PEIF+YSSNIG+ ++A  +G +G + F+ +LG+L + 
Sbjct: 300 TNPIKISRFTISDYHAKRRWLSVPEIFKYSSNIGSVKMAIDVGTEGQRAFMAKLGMLRET 359

Query: 416 ETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSR 475
             ELPE+  P  P+ W+ I+++TI+FGHGLS +P+  A   AA++N G   P T +    
Sbjct: 360 ALELPELGRPMVPNPWRPINTMTIAFGHGLSVSPMHLAAGVAAMVNGGIRRPLTILE--- 416

Query: 476 EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIK-KRYSD 534
            ++      ++ + T   MR L+R  V  G+GR+A   G+ VGGKTGTA+KV     Y  
Sbjct: 417 TDTPSPGERIISERTSHDMRRLMRLVVDDGTGRKADAEGYIVGGKTGTAEKVGGRGGYRR 476

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAPMVGNIIRRSASMLGV 592
               +SF+A FP   P+Y+VL  +D PK  + +      G   AP +  II RSA +LGV
Sbjct: 477 KALMSSFVAAFPMQKPRYVVLVMVDEPKGTKESHGYATGGWVAAPAISRIIARSAPLLGV 536

Query: 593 KP 594
            P
Sbjct: 537 AP 538


>gi|304392261|ref|ZP_07374203.1| penicillin-binding protein 2 [Ahrensia sp. R2A130]
 gi|303296490|gb|EFL90848.1| penicillin-binding protein 2 [Ahrensia sp. R2A130]
          Length = 578

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 248/540 (45%), Positives = 361/540 (66%), Gaps = 4/540 (0%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-NIDEYGMSRPDI 119
           +RR  +   +++R+ + +   + ++ I+  R++             +        +RP I
Sbjct: 26  RRREDLATQTRDRLIVVMCGVVAVFSIIQGRLVYLAADDVTGPRARIGADMAIEATRPRI 85

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR 179
           +DRNG+++A DI T SL+ EP  +    E  + L  VLP+L  E + ++L  +  F W++
Sbjct: 86  LDRNGQVMALDIETQSLFAEPKLIERAQETYDMLATVLPDLPEEKLVKRLKGDAGFIWVK 145

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQG 239
           R+L+P+QQ  IL+ GLPG+GFR E  R+YP  + ASH++G+ +IDN+GI GIEK LD   
Sbjct: 146 RELTPRQQADILALGLPGIGFRPETKRYYPGGATASHILGHTNIDNQGIAGIEKHLDDSW 205

Query: 240 LTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVIS 298
           L        G +K L+P++L++D+R+Q+ V Q LV   +KY A +   V+L+ +TGEVI+
Sbjct: 206 LRDFHAAGFGVKKELKPVQLSVDMRVQHFVRQALVTAMEKYRAIAAAGVVLDANTGEVIA 265

Query: 299 MVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNP 358
           M S+PDYDP+      K+   NR+S G+FEMGS FK FT AM +DSG   ++  FD   P
Sbjct: 266 MSSLPDYDPNNPVDALKKDRLNRMSAGLFEMGSTFKTFTTAMALDSGKVNLRSRFDATKP 325

Query: 359 IKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE-T 417
           +++G+  I+D+H + R+L++PE+F YSSNIG A++AD +GI GHKEFL R+GLL K++  
Sbjct: 326 LRIGRFTINDFHGKRRVLSVPEVFIYSSNIGTAKMADVVGIPGHKEFLTRIGLLDKMQGF 385

Query: 418 ELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE 477
           ELPE+  P+ P +WK+++S+TIS+GHG+STTPLQTAVAAA+L+N GRLIPPT   RS + 
Sbjct: 386 ELPEVAKPTQPKKWKKVNSITISYGHGVSTTPLQTAVAAASLVNGGRLIPPTLFPRSADA 445

Query: 478 SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLN 537
           +    + VLK  T   MR L+R  V  GSG+R+ VPGF VGGKTGTA+KV+  RYS+   
Sbjct: 446 AAMAGKQVLKPQTTDAMRYLMRLNVLKGSGKRSDVPGFLVGGKTGTAEKVVNGRYSNDKR 505

Query: 538 FNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIRRSASMLGVKPVF 596
           FN+FLA FP  DP+YIVL  +D PK ++  +  TAG+N AP+VG I+RRSA +LGV+P F
Sbjct: 506 FNAFLATFPVNDPRYIVLVIVDEPKPEKGKKYATAGMNAAPVVGEIVRRSAPLLGVEPDF 565


>gi|84394440|ref|ZP_00993156.1| penicillin-binding protein 3 [Vibrio splendidus 12B01]
 gi|84374939|gb|EAP91870.1| penicillin-binding protein 3 [Vibrio splendidus 12B01]
          Length = 585

 Score =  385 bits (988), Expect = e-104,   Method: Composition-based stats.
 Identities = 140/576 (24%), Positives = 250/576 (43%), Gaps = 36/576 (6%)

Query: 52  MEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPS 106
            +  ++  +  +       K R  + I    + +  L  R+     I P     +    S
Sbjct: 14  KKSTKERVKSEKDSDPILIKWRFNVVIAFVFLAFAALVGRVAYIQIIEPDNLIRQGDLRS 73

Query: 107 MNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLD 161
           + +     +R  I DRNGE LA  +P  +++ +P  +   + + +      L  VL    
Sbjct: 74  VRVKAIPSARGIISDRNGEPLAVSVPVEAVWADPKTIFDKNGMAQIDRWYALADVLGLER 133

Query: 162 SEMIRRK-LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGY 220
             MI +   +   +F +L+R++SP   K I    L GVG + E  R+YPA   ++H++G 
Sbjct: 134 QSMIDKISSNKSRRFVYLQRQVSPAMAKYIRELKLVGVGLKAESRRYYPAGEVSAHLIGV 193

Query: 221 VDIDNRGITGIEKFLDMQ-----GLTRVFTTNKG----------EKNLQPIRLALDLRIQ 265
             ID  G+ G+E+  D       G   +     G           +  +P+ L +D R+Q
Sbjct: 194 TGIDGHGLEGVERSYDKWLTGEAGKRTIRKDRYGRVVENIALEEREEGKPLELTIDQRLQ 253

Query: 266 NIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYG 325
            I ++ + +    + A S   V+L+V TG V++MV+ P Y+P+     +     NR+   
Sbjct: 254 AIAYRAIKQAVADHKATSGSAVLLDVKTGAVLAMVNAPSYNPNNRADLQSFKMRNRVLTD 313

Query: 326 IFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYS 385
             E GS  K F +   +++G      + DT N I            +     +  I + S
Sbjct: 314 AMEPGSTVKPFVVLAALENGTADPDIVIDTGNGIMQIGGSRVRDSSKVGKADLALILKKS 373

Query: 386 SNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGH 443
           SNIG A++A  M ++        +GL       L    +  +P+  +W +    T++FG+
Sbjct: 374 SNIGVAKLALNMPLEALLGMYSSVGLGEMSGLNLVGETSGIFPNRRRWSKFEIATLAFGY 433

Query: 444 GLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT 503
           GLS TP+Q A A A L N+G   P   +  + ++    S+ ++K+   + + ++L     
Sbjct: 434 GLSVTPMQLAHAYATLANKGLYEPIHIIKSNDQD---FSKQIIKRENAELVLNMLEGVTQ 490

Query: 504 -GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
            GG+  RA VPG+ V  KTGT++K     YSD           P +DP+  ++  ++ P+
Sbjct: 491 KGGTATRAAVPGYRVAAKTGTSRKAEAGGYSDE-YIAVTAGFAPVSDPRVALVVVVNEPQ 549

Query: 563 IKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
                    G   AP+   I++ +  ++ V     K
Sbjct: 550 GDL---YYGGSVAAPVFSEIMKGALQIMNVPADENK 582


>gi|254428418|ref|ZP_05042125.1| Penicillin-binding Protein dimerisation domain family [Alcanivorax
           sp. DG881]
 gi|196194587|gb|EDX89546.1| Penicillin-binding Protein dimerisation domain family [Alcanivorax
           sp. DG881]
          Length = 573

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 152/559 (27%), Positives = 259/559 (46%), Gaps = 31/559 (5%)

Query: 61  KRRRKVIAHSKNRIGMTI---VVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRP 117
           ++ R+     + R  +       CL++   + +++IQ+  +  +    ++ ++     R 
Sbjct: 6   RKTRQPNHPMRWRFVLGFWAVCACLLLVRAVDLQVIQHDYLAHQGDIRNLRVEPLAAHRG 65

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKF 175
            I DR G+ LA   P  +L+V P + +   +   +L    P +D +   RK+      +F
Sbjct: 66  VIRDRAGKPLAVSTPVVTLWVNPREAMEHQDQWGRLAGN-PVIDPKAFARKVRRHESREF 124

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +L R L+P+  K +L+  +PGV    E  R+YPA   ASHVVG+ +ID++G  GIE  +
Sbjct: 125 IYLERGLAPEAAKTVLNLNVPGVYSLTEYRRYYPAGEVASHVVGFTNIDDQGQEGIELSM 184

Query: 236 D-----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKY 279
           +       G  +V     G            +  + + L++DLR+Q + ++EL+   +K+
Sbjct: 185 EDHLSGHSGRKKVVRDLLGRVIQDIEVLEPAEPGEDVTLSIDLRLQYLAYRELLGAVQKF 244

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
            A+    V+L+V TGEV++MV+ P Y+P+           NR    +FE GS  K FT+A
Sbjct: 245 KAKGGSAVVLDVRTGEVLAMVNQPAYNPNNRGNLDTGALRNRAVTDLFEPGSTMKPFTVA 304

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
             ++ G+ T     +T              H    ++ I  +   SSN+G +++A AM  
Sbjct: 305 AALEMGMVTPSTTINTHPGTLRVGSKTIRDHRDYGVIDITTVLTKSSNVGTSKLALAMEP 364

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
                +L R G         P       P  S+W+ +    +S+G+GLS + +Q A A A
Sbjct: 365 LALPGYLERFGFGQSTHIAFPGESNGLLPLRSKWRDVERAALSYGYGLSVSAVQLAQAYA 424

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVPGFE 516
            + N+G  +P T     + +       V+ K T + +  +L   V+  G+ RRA VPG++
Sbjct: 425 VIANDGVKVPLTL---KKVDGVPQGEQVIGKATARQLVQMLETVVSRVGTARRAQVPGYQ 481

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVA 576
           V GKTGT  KV+   Y+D      F  + P TDP+ + +  +D P          G+  A
Sbjct: 482 VAGKTGTVHKVMAGGYADDNYIGLFAGLAPATDPRIVTVVVIDDP---GGKAYYGGLVAA 538

Query: 577 PMVGNIIRRSASMLGVKPV 595
           P   NI+      L V P 
Sbjct: 539 PAFSNIMSGVLRSLHVPPD 557


>gi|92116829|ref|YP_576558.1| peptidoglycan glycosyltransferase [Nitrobacter hamburgensis X14]
 gi|91799723|gb|ABE62098.1| Peptidoglycan glycosyltransferase [Nitrobacter hamburgensis X14]
          Length = 585

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 220/545 (40%), Positives = 346/545 (63%), Gaps = 4/545 (0%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-HPEPIAPSMNIDEYGM 114
           ++L   R     A ++ R+G+ I+V  +IY ++A R++ +           + + D    
Sbjct: 24  RNLLYGRNVDRAAKARVRVGLVIIVFGLIYAVIAARLVMFAAFPDDRGGHRTASQDAIAT 83

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDI+DRNG++LATD+   SL+ EP ++I  DE +E L   LP+L++  +R++L +   
Sbjct: 84  ARPDIVDRNGQVLATDVKAPSLFGEPRRIIDRDEAVELLTATLPDLETAEVRQRLGTRKG 143

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL+R+++P QQK I + G+PG+GF  E  R YP+    +H++G V+IDN+GI G+EK+
Sbjct: 144 FVWLKREITPSQQKEIHNLGIPGIGFLRENKRVYPSGREVAHLIGLVNIDNQGIAGMEKW 203

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           LD  GL  +       ++  +P+ L++DLR+++ +  ELV+ K+ Y+A++   ++ NV T
Sbjct: 204 LDSNGLADLHRAGFATDRLQKPVELSVDLRVEHALRDELVKAKEHYHAKAASGLVSNVRT 263

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+++MVS+PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG + +  ++
Sbjct: 264 GEIVAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKYDLNSMW 323

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D R P+  G+  IHD H   R + + E+F YSSNIGAA+IA A G++ HK FL +LG + 
Sbjct: 324 DARAPLHYGRFTIHDDHRLGRFINMKEVFTYSSNIGAARIALAQGVEAHKAFLRKLGQMD 383

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           +L TELPE  AP  P +W  ++++TI++GHG++  PLQ  +   AL+N G LIPPTF+ R
Sbjct: 384 RLRTELPESAAPILPRKWGELNTVTIAYGHGIAVAPLQAVMGIDALVNGGWLIPPTFLKR 443

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           S  ++ K+++ V+KK T   MR LLR     G+ R+A V G+ VGGKTGTA+KVI  RY+
Sbjct: 444 SEADAMKLAKRVIKKETSDKMRFLLRLNAEVGTARKADVKGYYVGGKTGTAEKVINGRYA 503

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLG 591
                N+F A+ P  +PQY +L  +D P+  +      T+G N  P  G +I R A +LG
Sbjct: 504 KKRVLNAFTAILPADNPQYQLLVMLDEPQPLKETHGFITSGWNAVPTGGKVIARIAPLLG 563

Query: 592 VKPVF 596
           V+P F
Sbjct: 564 VQPRF 568


>gi|153835409|ref|ZP_01988076.1| peptidoglycan synthetase FtsI [Vibrio harveyi HY01]
 gi|148868065|gb|EDL67240.1| peptidoglycan synthetase FtsI [Vibrio harveyi HY01]
          Length = 601

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/558 (27%), Positives = 252/558 (45%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +      + +L  R+     I P     +    S+ +     +R  I DRNGE
Sbjct: 49  RWRFQLLLFFVFCAFALLVGRVAYIQVIEPDNLIKQGDLRSVRVKAIPSARGIISDRNGE 108

Query: 126 ILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRRKLSS--ETKFQWL 178
            LA  +P  +++ +P  +     +        L  VL  LD + +  K+    + +F +L
Sbjct: 109 PLAVSVPVEAVWADPKTIFKEGALQQTKSWYALADVL-GLDRQGLINKIKKNEKRRFIYL 167

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R++SP     I    LPGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 168 QRQVSPAMANYIRELKLPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEW 227

Query: 239 -----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G   +     G           +  +P++L +D RIQ + ++ + +    + A S
Sbjct: 228 LTGAAGKKTIRKDRYGRVVENIALEEKQEGKPLQLTIDQRIQAVAYRAIKQAVADHRATS 287

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              VIL+V TG V++MV+ P Y+P+     +     NR+     E GS  K F +   ++
Sbjct: 288 GSVVILDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRVITDSLEPGSTIKPFVVLAALE 347

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT N I           P+    ++  I + SSNIG  ++A  M ++   
Sbjct: 348 NGVADKDTIVDTGNGILQLGGSRVRDAPKVGKASLTTILKKSSNIGVTKLAMQMPVEALL 407

Query: 404 EFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +GL       L       +P  S+W  I   TISFG+GLS TP+Q A A A L N
Sbjct: 408 GLYSSVGLGELSGLNLVGEVVGIFPSRSRWSPIERATISFGYGLSVTPIQLAHAYATLGN 467

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +  +  +   ++R V+ K   + +  +L      GGS RRA VPG+ VG K
Sbjct: 468 LGKYEPIHIIDSNDND---MARQVVSKENARLVLDMLETVTQKGGSARRAAVPGYRVGAK 524

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           TGTA+K     YSD    N    V P +DP+  ++  ++ P+  +      G   +P+  
Sbjct: 525 TGTARKASAGGYSDE-YINYTAGVAPVSDPRLALVVVVNEPQGDD---YYGGSVASPVFS 580

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L V P   K
Sbjct: 581 EIMKGALQILNVAPDENK 598


>gi|115524114|ref|YP_781025.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisA53]
 gi|115518061|gb|ABJ06045.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisA53]
          Length = 584

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 214/545 (39%), Positives = 335/545 (61%), Gaps = 6/545 (1%)

Query: 58  LFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-NIDEYGMSR 116
           L   R     A ++ R+G  +V    IY ++  R++    +     A      +    +R
Sbjct: 23  LLYGRNVDRAAKARARVGFAMVAFAAIYGVIGFRLVTIAMVGDSHNARRSGAHEAVATAR 82

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
           PDI+DRNG +LATD+ T SL+ EP +++  DE IE L   LP+LD+  +R +LSS   F 
Sbjct: 83  PDILDRNGAVLATDVKTPSLFSEPRRIVDKDEAIELLTATLPDLDTPEVRERLSSRKGFA 142

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           WL+R+++P+QQ+ I   G+PG+GF  E  R YP+    SH++G V+IDN+GI GIEK+LD
Sbjct: 143 WLKREITPRQQQDIKKLGIPGIGFLRENKRVYPSGPAVSHLIGLVNIDNQGIAGIEKWLD 202

Query: 237 MQGLTRVFTTNKGEKNL-QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
             GL  +         L +P+ LA+DLR+++ +  EL++ ++KY A++   ++ NV TGE
Sbjct: 203 TNGLADLHRAGFASDRLQKPVELAIDLRVEHALRDELLKAQEKYKAKAASGLVSNVRTGE 262

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +++MVS+PD+DP++  +       NR++ G++EMGS FK  T+AM +DSG   +  L+D 
Sbjct: 263 IVAMVSLPDFDPNDPREAHDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKANLNTLYDA 322

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
           R  +  GK  IHD H   R +T+ E+F +SSN+GAA++A + G++ H+ FL ++G L +L
Sbjct: 323 RGALHYGKFAIHDTHALGRSITLSEVFTFSSNVGAARVALSQGVEAHRAFLKKVGQLDRL 382

Query: 416 ETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSR 475
            TELPE  +P  P +W  ++++TI+FGHG++  PLQ  +   A+IN G LIPPTF+ RS 
Sbjct: 383 RTELPESASPIVPKRWGELNTITIAFGHGMAVAPLQAVMGINAMINGGYLIPPTFLKRSE 442

Query: 476 EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF--VPGFEVGGKTGTAQKVIKKRYS 533
           +E+  +++ V+KK T   +R ++R     G+ ++A     G+ +GGKTGT++KV+  RYS
Sbjct: 443 QEAMLIAKRVIKKETSDKVRYMMRLNAEIGTAKQADQLAKGYYIGGKTGTSEKVVNGRYS 502

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLG 591
                NSF A+ P  +PQY +L  +D PK         T+G N  P  G +I R A +LG
Sbjct: 503 KKQVLNSFTAIMPADNPQYQLLVMLDEPKALPETHGFITSGWNAVPTGGKVIARIAPLLG 562

Query: 592 VKPVF 596
           ++P F
Sbjct: 563 LEPRF 567


>gi|109899826|ref|YP_663081.1| peptidoglycan glycosyltransferase [Pseudoalteromonas atlantica T6c]
 gi|109702107|gb|ABG42027.1| peptidoglycan synthetase FtsI [Pseudoalteromonas atlantica T6c]
          Length = 586

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 142/569 (24%), Positives = 260/569 (45%), Gaps = 41/569 (7%)

Query: 61  KRRRKVIAHS------KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNI 109
           K+R +    +      + R  + I V +++++ L+ R +    I P     +    ++  
Sbjct: 8   KKRNQQAKQNVAPTALQWRYLLVIGVIMLVFVGLSARAVYIQVIDPDLLIKQGDNRTLRT 67

Query: 110 DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVI-----SPDEIIEKLQIVLPNLDSEM 164
               + R  I DRNG+ LA  +P  +++ +P  ++     +     + L  VL    +++
Sbjct: 68  QNMPVHRGLITDRNGQNLAVSVPVRAIWADPKTIVENGSLNDKRRWQALADVLGQDYTKL 127

Query: 165 IRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDID 224
           + R  + + +F +++R++SP     +    + GV  R E  R+YP    ++ ++G+ ++D
Sbjct: 128 VSRVKNPKKRFVYIQRQVSPAMADYVDQLSISGVYLRDESRRYYPTGEVSAQLIGFTNVD 187

Query: 225 NRGITGIEKFLDMQ-----GLTRVFTTNKGEK----------NLQPIRLALDLRIQNIVH 269
           ++GI GIEK  +       G  ++    KG +            + I+L +D RIQ   +
Sbjct: 188 DQGIEGIEKLYNEWLKGAPGSRKIRRDGKGRQVEILEQEAGEEPKDIQLTIDQRIQAFAY 247

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
           +EL +  + Y A S   V+++V TGE+++MV+ P Y+P+           NR     FE 
Sbjct: 248 KELKKAVQYYKATSASAVVVDVQTGEILAMVNNPSYNPNNRSGVSGHRIRNRAITDAFEP 307

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K   +   ++ G   +  + DT          +         L +  I R SSN+G
Sbjct: 308 GSSIKPIAVLSALEFGSVEMDSVIDTSPGWMRVGGSMVRDSRNYGELDLTGIIRKSSNMG 367

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLST 447
            +++A ++  Q   +  Y +GL+S   + L    +  +    +W      T+SFG+GLS 
Sbjct: 368 TSKLALSVPKQFLIDQYYNMGLMSDTGSNLIGESSGIFHDRSRWSEFELSTLSFGYGLSV 427

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGS 506
           T  Q A   + L + G   P + +   ++  E     VL ++    + +++   V  GGS
Sbjct: 428 TTAQLARMYSVLGSGGIKRPLSVIKSEQKAPE---ERVLSEDIAHEVLTMMESVVNEGGS 484

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G +A VPG+ V GKTGT++K +   Y +    + F  V P +DPQ  V+  ++ P+    
Sbjct: 485 GTKARVPGYRVAGKTGTSRKAVAGGYGEE-YVSIFAGVAPVSDPQLAVVVLINEPRGDL- 542

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKPV 595
               AG   AP+   I+  S  ML V P 
Sbjct: 543 --YYAGDTAAPVFSKIMSNSLQMLNVPPD 569


>gi|300309672|ref|YP_003773764.1| cell division FtsI protein/penicillin-binding protein 2
           [Herbaspirillum seropedicae SmR1]
 gi|300072457|gb|ADJ61856.1| cell division FtsI protein/penicillin-binding protein 2
           [Herbaspirillum seropedicae SmR1]
          Length = 592

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/548 (27%), Positives = 255/548 (46%), Gaps = 34/548 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    + V  V ++ L +R +         +  +  +      E   +R  I DRNG++L
Sbjct: 37  RSRFVLFVLFVAFVALVLRALWLQGVSTDFLQKQGASRYARTLELPATRGKITDRNGQVL 96

Query: 128 ATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A+ +P  +++  P  V + P + + +L  +L   D++ +R+KL S+  F +L+R++    
Sbjct: 97  ASSVPVKAIWAIPEDVQAAPKDKLVQLAKLLEMSDAD-LRKKLDSDRSFVYLKRQVEQDT 155

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
             +I+  G+PG+  R E  RFYP     +HVVG+ +I++ G  G+E           G  
Sbjct: 156 ADKIVKLGIPGIETRKEYKRFYPEGEVMAHVVGFTNIEDAGQDGMELAAQKTLAGVTGSR 215

Query: 242 RVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           RV     G             + + + L++D +IQ I   +L E  +K+ A++ G ++++
Sbjct: 216 RVIKDRLGRVVEDIESIREPHDGRDLTLSIDSKIQYIAFTQLKEAVEKFKAKAGGIIVVD 275

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TGEV+++ ++P Y+P++          NR+    FE GS  K FT+A+ +D+   T  
Sbjct: 276 AKTGEVLALANLPTYNPNDRSVLTGAQLRNRVVTDTFEPGSTMKPFTVALALDTHRVTPS 335

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            +F T                 +  LT+ +I   SSNIG A+IA  M  +   E    +G
Sbjct: 336 TVFQTAPGKMTIGTATIGDSHAHGPLTVAQIIEKSSNIGTAKIALGMPPEEMWEMFTTVG 395

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
              + +   P   A        W+ I   T+S+GHG+S + +Q A A       G +IP 
Sbjct: 396 FGQQPKFGFPGAVAGRVRPYKSWRPIEQATMSYGHGISVSLIQLAHAYLIFARNGDIIPL 455

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKV 527
           +F   ++     + + V+  +T   MR +L   V  GG+  +A VPG+ VGGKTGTA K+
Sbjct: 456 SF---TKVTDSPIGQRVISADTALQMRRMLETVVAPGGTAPQAQVPGYRVGGKTGTAYKI 512

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
              +Y       SF  + P +DP+ I+   +D P+     Q   G    P+  N+   + 
Sbjct: 513 EGGKYVR-KYVASFSGIAPMSDPRLIISVMIDEPQ----GQHYGGPVAGPVFANVAANAL 567

Query: 588 SMLGVKPV 595
             L V P 
Sbjct: 568 RALNVPPD 575


>gi|222528778|ref|YP_002572660.1| stage V sporulation protein D [Caldicellulosiruptor bescii DSM
           6725]
 gi|222455625|gb|ACM59887.1| stage V sporulation protein D [Caldicellulosiruptor bescii DSM
           6725]
          Length = 719

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 132/589 (22%), Positives = 245/589 (41%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + V  + +++L  R+     I  E +                 R  
Sbjct: 2   KEAALRVKKRILFVMAVFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QMDYKKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +  ++  +I  + LPG+       R YP  +  + V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKEKADKIRKYALPGIYLTGGTKRVYPNGNFLAQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPVDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP+  F+   +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNRPFELIYKDKFPDFYKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+      F  R  +KV   ++  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGIVNENSQFYCRGYVKVANAILKCWRYYNPHGSENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP           +   +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPLGKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--------VSRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K          R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAVANDGVWVQPHVVKAIYDKDKKLFKSFDTPQKRRVLDQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + ++ +L+  VT G+G  A++ G++V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLKVILQSVVTNGTGHNAYLLGYKVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|85714967|ref|ZP_01045952.1| Penicillin-binding protein, transpeptidase [Nitrobacter sp.
           Nb-311A]
 gi|85698164|gb|EAQ36036.1| Penicillin-binding protein, transpeptidase [Nitrobacter sp.
           Nb-311A]
          Length = 579

 Score =  384 bits (987), Expect = e-104,   Method: Composition-based stats.
 Identities = 216/545 (39%), Positives = 344/545 (63%), Gaps = 4/545 (0%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-HPEPIAPSMNIDEYGM 114
           ++L   R     A ++ R+G  I++  +IY ++A R++ +           + + D    
Sbjct: 18  RNLLYGRNVDRAAKARVRVGFVIILFSLIYAVIAARLVMFAAFSDDRGGHRTASQDAIAT 77

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK 174
           +RPDIIDRNG++LATDI   SL+ EP ++I  DE +E L   LP+L++  +R++L +   
Sbjct: 78  ARPDIIDRNGQVLATDIKAPSLFGEPRRLIDRDEAVELLTATLPDLETAEVRQRLGTRKG 137

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F WL+R+++P QQK I   G+PG+GF  E  R YP+    +H++G V+IDN+GI G+EK+
Sbjct: 138 FVWLKREITPAQQKEIHGLGIPGIGFLRENKRVYPSGREVAHLIGLVNIDNQGIAGMEKW 197

Query: 235 LDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVST 293
           LD  GL  +       ++  +P+ L++DLR+++ +  EL++ ++ Y A++   ++ NV T
Sbjct: 198 LDSNGLADLHRAGFATDRLQKPVELSIDLRVEHALRDELLKAQEHYRAKAASGIVSNVRT 257

Query: 294 GEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLF 353
           GE+I+MVS+PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG + +  ++
Sbjct: 258 GEIIAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKYGLNSMW 317

Query: 354 DTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLS 413
           D R P++ G+  IHD H   R + + E+F YSSNIGAA+IA A G++ HK FL ++G + 
Sbjct: 318 DARAPLRYGRFTIHDDHRMGRFINMKEVFTYSSNIGAARIALAQGVEAHKAFLRKMGQMD 377

Query: 414 KLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
           +L TELPE  +P  P +W  ++++TI+FGHG++  PLQ  +   AL+N G LIPPTF+ R
Sbjct: 378 RLRTELPESASPILPRKWGELNTVTIAFGHGMAVAPLQAVMGIDALVNGGWLIPPTFLKR 437

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYS 533
           + +E+  +++ V+K+ T   MR LLR     G+ R+A V G+ VGGKTGT++KVI  RY+
Sbjct: 438 TEQEAMAIAKRVIKQETSDKMRFLLRLNAEVGTARKADVKGYYVGGKTGTSEKVINGRYA 497

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLG 591
                N+F A+ P  +PQY +L  +D P+  +      T+G N  P  G +I R A +LG
Sbjct: 498 KKRVLNAFTAILPADNPQYQLLVMLDEPQPLKETHGFITSGWNAVPTGGKVIARIAPILG 557

Query: 592 VKPVF 596
           V+P F
Sbjct: 558 VQPRF 562


>gi|15837394|ref|NP_298082.1| penicillin binding protein 3 [Xylella fastidiosa 9a5c]
 gi|9105688|gb|AAF83602.1|AE003919_13 penicillin binding protein 3 [Xylella fastidiosa 9a5c]
          Length = 613

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 147/551 (26%), Positives = 253/551 (45%), Gaps = 34/551 (6%)

Query: 71  KNRIGMT-----IVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +      +    +I     +++I       +  A  +       SR  I DRNGE
Sbjct: 15  RGRLLLVGTALGLCSMTLIASAAYVQLINSDFYQRQAEARYLRELPIPTSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++  P +++   + I KL  VL ++  + +R +LS +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMDELRTRLSQKADKEFMYLKRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQ 238
           P     +L   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDVAHHVLGLQIPGVFAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELSFDDWLTGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  RV    +G            +  + + L +D RIQ + ++EL     +  A     V
Sbjct: 194 GSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRNAIVENQAAGGSIV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+ GE+++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVNNGEILAMVNLPTYNPNAVTGINSSARRNRAVTDLVEPGSTMKPLTVATALQAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + +G+  I D    N +L +  +   SSNIGAA+I   +  +   E +
Sbjct: 314 TPDTVIDTNPGYLSLGRFTIRDVPRNNGVLNVAGVITRSSNIGAAKIVAKVPDKTFYELV 373

Query: 407 YRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  +   +  P   +   P    W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 QGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L+PPTF+     E+    R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LVPPTFVKGHHAEA----RQVVDAKVAQQVIGMMETVVTRGGAKAAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKTGANGYESGHYNALFAGLVPATRPRFATVIVINDPQGK---AYYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|163746122|ref|ZP_02153481.1| penicillin-binding protein [Oceanibulbus indolifex HEL-45]
 gi|161380867|gb|EDQ05277.1| penicillin-binding protein [Oceanibulbus indolifex HEL-45]
          Length = 595

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 172/564 (30%), Positives = 283/564 (50%), Gaps = 16/564 (2%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
                    E+ +   ++ R K    ++ R+ +  V  L  + ++  R+       P   
Sbjct: 19  GENPDAIERENKRIRHEQMRDKARMRAEGRLLVLGVCFLCAFTVIGGRMGLLAMSEPSEP 78

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE 163
                      SR DI DRNG +LAT+  T +LY +P  +I P+   +KL  + P+L  E
Sbjct: 79  RGHAPGAVISASRADITDRNGNLLATNFETHALYAQPRHMIDPEAAAKKLVKIFPDLKEE 138

Query: 164 MIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
            + +  + + KF W+++K+SP+Q + +   G PG+ F     R YP  S A+HV+G    
Sbjct: 139 RLIKDFTGKRKFLWIKKKISPEQMQAVHDIGDPGLLFAPRDMRLYPNGSLAAHVLGGASY 198

Query: 224 DNRGITGIEKFLDMQGLTRVFTTNKGEKNL-QPIRLALDLRIQNIVHQELVENKKKYNAE 282
              G+   E               +   N  +P+ L+LDL +Q    + L    K  NA+
Sbjct: 199 GKEGVHAAEVIGVAGAEKYFDDYLRDPANGAKPLELSLDLTVQAASERVLYGGMKLMNAK 258

Query: 283 SVGTVILNVSTGEVISMVSIPDYDPHEAFK------GKKEGWFNRISYGIFEMGSIFKVF 336
              +++++V TGEVIS+ S+PD+DP+   +            FNR   G++E+GS FK+F
Sbjct: 259 GATSILMDVHTGEVISVASLPDFDPNNRPRPLTQGDASDSPLFNRSVQGVYELGSTFKIF 318

Query: 337 TIAMGIDSGLFTVKDLFDTRNPIKVGKHVI-HDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
             A  I+ GLF    + DT  P+KVG   I    +     L++ +I  +SSN G  ++A 
Sbjct: 319 AAAQAIELGLFNADTIIDTSGPMKVGGFRIGEFRNKNYGKLSVADIIVHSSNRGTGRMAL 378

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTA 453
            +GI+  +EFL  LG       E+ E        PS+W  + S+TIS+GHGLS+TP+  A
Sbjct: 379 EIGIERQQEFLKSLGFFEPTPFEIVEASGGKPLLPSRWTELSSVTISYGHGLSSTPMHLA 438

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
              AA+ N GR++ PT + +    + ++   V+ + T    R++LR+ VT G+   A VP
Sbjct: 439 AGYAAIANGGRVVKPTLLKQ---TAPQLGPRVMSEETAAQARNMLRKVVTDGTASFAEVP 495

Query: 514 GFEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLT 570
           G+++ GKTGTA K      Y +    N+F ++FP   P+Y+++  +D P      + + T
Sbjct: 496 GYQIAGKTGTADKPKPTGGYYEDKVINTFASIFPIDSPKYVLIVTLDEPVETSGPKPRRT 555

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
           AG    P+   ++RR A +LG++P
Sbjct: 556 AGWTAVPVAAEMVRRIAPLLGLRP 579


>gi|328553588|gb|AEB24080.1| penicillin-binding protein [Bacillus amyloliquefaciens TA208]
          Length = 639

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/566 (27%), Positives = 258/566 (45%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + ++  ++I++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLLVLLFGVIIFLIIDSRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
           G  LAT+    +++V P ++ +P +  + L  VL N+  E + + ++ +T  + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQIQNPIKTGKLLASVL-NMSEEKVYKHITKKTSIEKISPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM--- 237
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNKKAKEIKALDLKGVYVAEDSIRHYPYGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 238 --QGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL     KYN + 
Sbjct: 186 GVKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTIDAKVQTIIERELDNAAAKYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GEV+ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEVLGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLF--TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
                       +D       G  +       +   +  E+ + S N G  ++ + +G Q
Sbjct: 306 QEQKVNLQRDHFYDRGFAEVDGARLRCWKKGGHGSQSYLEVVQNSCNPGFVELGERLGKQ 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFQYIKDFGFGKKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            IN G L  P       +         +S    R V+ + T K +R  L   V  G+GR 
Sbjct: 426 AINGGTLYTPFIAKEWVDPVTKKTVKKQSPIAKRQVISQETSKQIRYALESVVAQGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G   AP+VGNI+R S   LG+KP 
Sbjct: 543 FGGTVAAPIVGNIMRDSLPELGIKPR 568


>gi|167622389|ref|YP_001672683.1| peptidoglycan glycosyltransferase [Shewanella halifaxensis HAW-EB4]
 gi|167352411|gb|ABZ75024.1| Peptidoglycan glycosyltransferase [Shewanella halifaxensis HAW-EB4]
          Length = 578

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 137/565 (24%), Positives = 243/565 (43%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R++     + R+ + +    +++  L  R           +  +    ++      +
Sbjct: 4   QAKRKQKPQLIQWRLYVVVAFVCLLFTSLVGRAAYIQIIEPEMLRHQSDMRTLRTTSREV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRR-K 168
            R  I DRNGE+LA  +P  ++Y +P  +   D   +      L  VL     ++++R +
Sbjct: 64  QRGLITDRNGEMLAVSVPVKAVYADPKVIHDEDGFADMRRWQALADVLHEPKEDILKRVQ 123

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P     I    LPGV  + E  R+YP     + +VG  +ID++GI
Sbjct: 124 SNPRKRFTYLKRQVTPAVANYIQQLDLPGVYLKPESRRYYPTGEITAQLVGITNIDDKGI 183

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            G+E   D          +V  +  G            ++   + L++D RIQ + ++EL
Sbjct: 184 EGLENTYDDWLTGTPSKQKVRKSRDGHVVERLDMVQEGESPNDLVLSIDQRIQQLAYREL 243

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
            +  +   A S   V+L+V TGEV++M + P Y+P+     +     NR     +E GS 
Sbjct: 244 KKATEINQATSGSIVVLDVLTGEVLAMANTPSYNPNSRENLQSYRMRNRALTDAYEPGST 303

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +D+G      +  T          I         L++  +  +SSN+G  +
Sbjct: 304 IKPFVVAAALDAGTIKTDQIIKTNPGRMRIGGKIVRDGRNYGDLSLSGVLVHSSNVGMTK 363

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           IA +M +Q        +GL +     L    A       +W      T+SFG+GL  TPL
Sbjct: 364 IALSMPVQELLGAYQTMGLGNYSGINLEGESAGLIHDRRRWSEFERATLSFGYGLMATPL 423

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L N+G   P + +   +         V+     + +  +L      GG+ R+
Sbjct: 424 QLARMYATLGNKGVQYPVSILKLKQA---PQGTQVISPQVAQDVMEMLVGVTEKGGTARK 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA+K +   Y +      F  V P   P+  +   ++ PK    ++ 
Sbjct: 481 AHIEGYPVAGKTGTARKAVAGGYGED-YVAIFAGVAPVHTPKLAITVVINEPK---GDRY 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+   ++  +  ML V+P
Sbjct: 537 YGGDVAAPVFAAVMSGALQMLNVEP 561


>gi|319786247|ref|YP_004145722.1| peptidoglycan glycosyltransferase [Pseudoxanthomonas suwonensis
           11-1]
 gi|317464759|gb|ADV26491.1| Peptidoglycan glycosyltransferase [Pseudoxanthomonas suwonensis
           11-1]
          Length = 607

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/566 (27%), Positives = 263/566 (46%), Gaps = 39/566 (6%)

Query: 60  QKRRRKVIAHS----KNRIGMTIVVCLVIYIIL-----AIRIIQYGNIHPEPIAPSMNID 110
           ++R  +    +    + R+ +  V   +  + L      ++++       +  A  +   
Sbjct: 3   ERRPVRNRNRAPFNLRGRMMLVGVALGLCSVALVGRAGWVQLVDAEFYQRQGEARFVREI 62

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS 170
               SR  I DRNGE LA   P  S++  P +++   + + +L   L ++  + +  +LS
Sbjct: 63  PIPTSRGMITDRNGEPLAVSTPVESIWANPQELLRYPDRLPELAKAL-DVPLDQLSTRLS 121

Query: 171 S--ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
              + +F +L+R+++P Q K IL+  +PGV  + E  RFYP     +HV+G+ +ID+RG 
Sbjct: 122 QRADKEFVYLKRRINPDQAKAILAHNVPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQ 181

Query: 229 TGIEKFLDMQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQEL 272
            G+E   D       G  RV     G            +  + + L++D RIQ + ++EL
Sbjct: 182 EGLELAFDEWLRGKPGAKRVIRDRHGRIVENIDLVRPAEPGKDLVLSIDRRIQFLAYREL 241

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +K NA S   V+L+V TGEV++MV++P Y+P+    G  +   NR+   + E GS 
Sbjct: 242 RAALEKNNAASGSAVVLDVPTGEVLAMVNLPSYNPNAVSGGNPDSRRNRVVTDLIEPGST 301

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K  T+A  + +G       FDT              H    +L +  I   SSN+GA  
Sbjct: 302 MKPITVAAALSAGKVRPTTRFDTSPGYMGLGRFTIRDHRNYGVLDVTGIITKSSNLGAVM 361

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPL 450
           +A  M  Q   +F+   G  S   +  P   A     P++W  +   T+S+G+GLS TPL
Sbjct: 362 LAQGMDDQYFYDFVRGFGYGSPPRSGFPGEAAGVLRPPARWDGLTKATMSYGYGLSATPL 421

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A A AAL N GRL  PTF+     ES    R V+       +  +++     GG+  +
Sbjct: 422 QIAQAYAALGNHGRLTTPTFVKGQINES----RQVVAPEIADEVLRMMQTVTEPGGTATQ 477

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA++     Y+      +F  + P ++P++  +  ++ P+       
Sbjct: 478 AAILGYHVAGKTGTARQASAGGYAR-RYTTTFAGLVPASNPRFATVVVINDPQA---GSY 533

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
            AG+   P+   ++  +  ++ V P 
Sbjct: 534 YAGLVSGPVFRAVMEDALRVMDVPPD 559


>gi|322384126|ref|ZP_08057844.1| penicillin-binding-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321151206|gb|EFX44515.1| penicillin-binding-like protein [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 651

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/572 (25%), Positives = 258/572 (45%), Gaps = 44/572 (7%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSR 116
            +R      ++R+ + +++  + +I L +R+        + +A            +  +R
Sbjct: 1   MKRVSSVMVRHRLFVALLLGTLTFIALLVRLAYVQLWKGQELAERAEDSWRRNIPFAANR 60

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE---T 173
            +I DRNG  L  ++ T S+   P ++  P     KL  VL     E I ++++      
Sbjct: 61  GEIWDRNGTRLTYNVSTPSVMAIPAQLKDPKAAAAKLAQVLEG-SEETIYKQITKRQSIN 119

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           K     RK++ ++   I +  +PG+    +  R+YP  S A H++G+  IDN+G+TG+E 
Sbjct: 120 KVSPAGRKITQEKALEIKNLNIPGIVVAEDNKRYYPFGSLAGHILGFTGIDNQGLTGVEA 179

Query: 234 FLDM-----QGLTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENK 276
             D       G         G             K+   ++L +D  +Q+++ +EL +  
Sbjct: 180 KYDKLLTGLPGSVSYLADAAGRQMPGSTDEYVKPKDGLNLQLTIDQHLQSVLERELDQAM 239

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKV 335
            K+ A+++  ++++ +TGEV++M S P Y+P    +   E +  N   +  +E GS FK+
Sbjct: 240 VKHQAQNILAIMMDPNTGEVLAMGSRPGYEPARYKEYDSEIYNRNLPIWKTYEPGSTFKI 299

Query: 336 FTIAMGIDSGLFT-VKDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQI 393
            T+A  +         + F     I+VG           +   T  ++   S N G   +
Sbjct: 300 ITLASALQEKKVDLKNEQFFDPGAIEVGGARLRCWKKGGHGSETFLQVVENSCNPGFVVL 359

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQ 451
              +G +   +++ R G   +   +L   +      PS+   +   T +FG G+S TP+Q
Sbjct: 360 GQRLGKESLFDYIQRFGFGKRTGIDLAGEENGILFKPSRVGPVELATTAFGQGVSVTPIQ 419

Query: 452 TAVAAAALINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGV 502
              A +A +N G+L  P                    ++ R V+ + T K +R  L   V
Sbjct: 420 QITAVSAAVNGGKLFKPHVAKAWINPESGQVVDTIQPELVRNVISEETSKQVREALESVV 479

Query: 503 TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
             G+GR AF+ G+ VGGKTGTAQKVI  RYS   +  SF+   P  +P+ +V + +D P+
Sbjct: 480 AKGTGRNAFIDGYRVGGKTGTAQKVINGRYSPDEHIVSFIGFAPANNPKIVVYAAVDDPQ 539

Query: 563 IKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
             +      G+  AP+V NI+  +   + V+P
Sbjct: 540 GIQ----FGGLVAAPIVKNIMEDALHYMKVQP 567


>gi|308173482|ref|YP_003920187.1| penicillin-binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606346|emb|CBI42717.1| penicillin-binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|328911618|gb|AEB63214.1| penicillin-binding protein [Bacillus amyloliquefaciens LL3]
          Length = 639

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/566 (27%), Positives = 258/566 (45%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + ++  ++I++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLLVLLFGVIIFLIIDSRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
           G  LAT+    +++V P ++ +P +  + L  VL N+  E + + ++ +T  + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQIQNPIKTGKLLASVL-NMSEEKVYKHITKKTSIEKISPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM--- 237
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNKKAKEIKALNLKGVYVAEDSIRHYPYGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 238 --QGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL     KYN + 
Sbjct: 186 GVKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTIDAKVQTIIERELDNAAAKYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GEV+ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEVLGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLF--TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
                       +D       G  +       +   +  E+ + S N G  ++ + +G Q
Sbjct: 306 QEQKVNLQRDHFYDRGFAEVDGARLRCWKKGGHGSQSYLEVVQNSCNPGFVELGERLGKQ 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFQYIKDFGFGKKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            IN G L  P       +         +S    R V+ + T K +R  L   V  G+GR 
Sbjct: 426 AINGGTLYTPFIAKEWVDPVTKKTVKKQSPIAKRQVISQETSKQIRYALESVVAQGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G   AP+VGNI+R S   LG+KP 
Sbjct: 543 FGGTVAAPIVGNIMRDSLPELGIKPR 568


>gi|238024831|ref|YP_002909063.1| penicillin-binding protein [Burkholderia glumae BGR1]
 gi|237879496|gb|ACR31828.1| Penicillin-binding protein [Burkholderia glumae BGR1]
          Length = 633

 Score =  384 bits (986), Expect = e-104,   Method: Composition-based stats.
 Identities = 129/547 (23%), Positives = 236/547 (43%), Gaps = 31/547 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    ++V  + +  L  R              +         E   +R  I+DRNG +L
Sbjct: 30  RSKFVVIVMFLAFAALIGRAFWVQVANQDFYLGQGEKRYQRTIELDATRGRIVDRNGAML 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V         L  +L ++    + R+L+++  F  L+R++ P   
Sbjct: 90  AVSLATYEIWANPKQVDP--AAYGPLAKLL-DMPHAELARRLTADKSFVLLKRQIDPDTA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            +I    L G+    +  RFYP    A+HVVG+ +I++RG  G+E   D +     G   
Sbjct: 147 AKIGKLDLEGITQIADSKRFYPEGESAAHVVGFTNIEDRGQEGVELAADGRLLGTAGQRE 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   + L +D R+Q + + +L       +A++   V+L  
Sbjct: 207 VIRDRLGRIISDTRPLVPAQHGATVELTIDRRVQQLAYAQLKAAVLANHAKAGSVVVLEA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            +GE++++ + P +DP++  +       NR     FE GS  K   +A+ ID G    + 
Sbjct: 267 RSGEILALANYPTFDPNDRSRLTGAQLRNRAVIDTFEPGSTVKPLVVALSIDEGKVGPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           L +T          +      + ++T+ +  + SSN+  A++A  +  Q   +     G+
Sbjct: 327 LVNTSPGTWKIGPAVIHDTSNHGVMTVAQALQKSSNVALAKLALNLPAQTIWDKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               +   P + +       +W+ I   T+++G+GLS + LQ A    A   +G L P +
Sbjct: 387 GHAPDLTFPGVASGRLRPYQRWRPIEQATMAYGYGLSMSLLQIAQMYTAYAGDGTLHPVS 446

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVI 528
            +    + + +    V +  T   +RS+L   V  GG+GR A V G+ +GGKTGTA+K  
Sbjct: 447 LLRDGSD-AGRQGHRVTRPETAAAIRSMLEMAVSEGGTGRAARVDGYRIGGKTGTARKQE 505

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y+       F  + P +DP+ IV   +D P          G    P+  +++  +  
Sbjct: 506 GGGYAKGKYRALFAGMAPMSDPRVIVAVMIDEP---GGRGYYGGTVAGPVFSSVMGGTLQ 562

Query: 589 MLGVKPV 595
           +L V P 
Sbjct: 563 LLAVPPD 569


>gi|260462084|ref|ZP_05810328.1| Peptidoglycan glycosyltransferase [Mesorhizobium opportunistum
           WSM2075]
 gi|259031944|gb|EEW33211.1| Peptidoglycan glycosyltransferase [Mesorhizobium opportunistum
           WSM2075]
          Length = 569

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 261/548 (47%), Positives = 370/548 (67%), Gaps = 4/548 (0%)

Query: 52  MEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDE 111
           +EDG  +    R+      K RI MT+ V   I+ +++ R++  G   P+      +   
Sbjct: 13  VEDGSIVVDGARKATGGKGKARIVMTMAVFFGIFSVISGRLVYLGFQTPDLSGGPQSRVT 72

Query: 112 YGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS 171
              SRPDI+DRNGE+LATDI T SL+ EP +++  DE IEKL  VLP +D E    KL S
Sbjct: 73  --ASRPDIVDRNGEVLATDIKTASLFAEPRRIVDADEAIEKLSTVLPEIDYEQTYHKLKS 130

Query: 172 ETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGI 231
              F WL+R+L+P+QQ  I+  G+PG GFR EK RFYP+   +S++VG  +IDN+GI+G+
Sbjct: 131 GAGFVWLQRQLTPKQQADIMQLGIPGFGFRTEKRRFYPSGETSSYIVGLTNIDNQGISGM 190

Query: 232 EKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           EK++D QGL+ +  +     K+L+P++L++DLRIQ++V  E+    ++Y A   G V+LN
Sbjct: 191 EKYIDEQGLSDLQASGLAVAKDLKPVKLSIDLRIQHVVRDEIAAGLERYRALGAGAVVLN 250

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
           V TGEV++M S+PD+DP+  +  +++   NR+S G++EMGS FK FT AM +DSG  T+ 
Sbjct: 251 VKTGEVVAMASVPDFDPNNPYNAQEKDRLNRMSAGLYEMGSTFKSFTSAMALDSGKATMA 310

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
             FD  +PI+VG   IHD+H +NR+L++PE+F YSSNIG+A+ A+ +GI GH+EFL+RLG
Sbjct: 311 SRFDASHPIRVGHQAIHDFHGKNRVLSLPEVFLYSSNIGSAREAELVGIAGHREFLHRLG 370

Query: 411 LLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           +L K++TELPE+  P+ P  WK+++S TI+FGHG+STTPLQ AV  AAL+N G L+ PTF
Sbjct: 371 ILDKMQTELPEVARPTEPKVWKQVNSFTIAFGHGVSTTPLQAAVGCAALMNGGYLMEPTF 430

Query: 471 MIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
           ++RS +E+   ++ V+   TV+ MR L       GS R A VPG+ VGGKTGTA+KVI  
Sbjct: 431 LVRSEQEAMATAKKVVSDKTVEGMRYLYTLNAEKGSARNARVPGYRVGGKTGTAEKVING 490

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIRRSASM 589
           RYS  LNFN+F+A FP  DPQY+V +  D+P  ++      A  N   + GNIIRRSA+M
Sbjct: 491 RYSKDLNFNTFVAAFPMDDPQYLVFTIADAPHPEKPGMTDVAAANAGVIAGNIIRRSAAM 550

Query: 590 LGVKPVFL 597
           LGVKP F 
Sbjct: 551 LGVKPDFS 558


>gi|170728858|ref|YP_001762884.1| peptidoglycan glycosyltransferase [Shewanella woodyi ATCC 51908]
 gi|169814205|gb|ACA88789.1| Peptidoglycan glycosyltransferase [Shewanella woodyi ATCC 51908]
          Length = 578

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 138/565 (24%), Positives = 245/565 (43%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R+K     + R+ + +    +++  L  R           +  E    ++      +
Sbjct: 4   QAKRKKKPQLIQWRLYVVVAFVCLLFTSLIGRAAYIQIVEPEKLRHESDMRTLRTTSREV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRR-K 168
            R  I DRNGE+LA  +P  ++Y +P  V   +        + L  VL     E+++R +
Sbjct: 64  QRGLITDRNGEMLAVSVPVKAVYADPKVVHDKNGFVDMRRWQALADVLHEPKDEILKRVQ 123

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P   + I    LPGV  + E  R+YP +  ++ +VG  +ID+ GI
Sbjct: 124 SNPRKRFTYLKRQVTPAVAEYIKQLRLPGVYLKSESRRYYPTSEISAQLVGITNIDDVGI 183

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            GIE   +          +V  +  G            ++   + L++D RIQ + ++E+
Sbjct: 184 EGIENSYNDWLTGTPSKQKVRKSRDGHVVERLDMVHEGESPNDLVLSIDQRIQQLAYREI 243

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +   A S   V+L+V TGEV++M + P Y+P+     +     NR     +E GS 
Sbjct: 244 KRVTEINQATSASIVVLDVHTGEVLAMANTPSYNPNSRENLQSYRMRNRALTDAYEPGST 303

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +D+G      +F T          I         L++  I  +SSN+G A+
Sbjct: 304 IKPFVVAAALDAGTIKEDQIFKTYPGRMRIGGKIVRDGRDYGDLSLSGILVHSSNVGMAK 363

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           I  +M +Q        +GL +     L    +       +W      T+SFG+G   TPL
Sbjct: 364 IGLSMPVQELLGSYQTMGLGNYSGINLEGESSGLIHDRRRWSDFERATLSFGYGFMVTPL 423

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L ++G L P + +   +         V+  +  +++  +L      GG+  +
Sbjct: 424 QLARLYATLGSKGVLYPVSILKLKQR---PEGTQVISPHVAQSVMEMLVGVTEKGGTATK 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA+K +   Y +      F  V P  +P+  +   ++ PK  +    
Sbjct: 481 AHIEGYPVAGKTGTARKAVAGGYGED-YVAVFAGVAPVHNPRLAIAVVVNEPKGDK---Y 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP    ++  +  ML V+P
Sbjct: 537 YGGDLAAPAFAKVMSGALQMLNVEP 561


>gi|152979995|ref|YP_001354711.1| FtsI cell division protein [Janthinobacterium sp. Marseille]
 gi|151280072|gb|ABR88482.1| FtsI cell division protein [Janthinobacterium sp. Marseille]
          Length = 586

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/548 (25%), Positives = 246/548 (44%), Gaps = 33/548 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +    ++ LA R +         +  +  +      E   +R  I DRNG++L
Sbjct: 30  RSRVVLFLIFAAFLTLAGRALWLQGMSTEFLQKQGASRYARTLELPATRGKITDRNGQVL 89

Query: 128 ATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A+ +P  +++  P  V  SP E ++ L  +L ++    +RRKL S+  F +L+R++    
Sbjct: 90  ASSVPVRAVWAIPEDVLESPPEKLQALAKLL-DMPERELRRKLDSDRTFVYLKRQVELDT 148

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLT 241
             +IL  G+ G+  R E  R+YP     +H+VG+ +++++G  G+E           G  
Sbjct: 149 VDKILKLGIAGIDTRKEYKRYYPEGEVMAHIVGFTNVEDKGQEGMELAYQKTLVGVTGSR 208

Query: 242 RVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           RV     G             + + + L++D +IQ I    L E  +   A++ G V+++
Sbjct: 209 RVIKDRLGRIVEDIESVREPHDGKDLALSIDSKIQYIAFSALKEAVEVNKAKAGGIVVMD 268

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TGEV+++ ++P Y+P+           NR+    FE GS  K F++A+G+++   T  
Sbjct: 269 AKTGEVLALANLPTYNPNNRSVLTGAQLRNRVITDTFEPGSTMKPFSVALGLETNRVTPN 328

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            +  T                 + +L++ ++   SSNIG A+IA  M      +    +G
Sbjct: 329 TMIQTAPGKMTIGTATIGDAHASGLLSVSQVIEKSSNIGTAKIALQMEPHEMWDLFTSVG 388

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
              + +   P   A        W+ I   T+S+GHG+S + LQ   A      +G LIP 
Sbjct: 389 FGQQPKINFPGAVAGRVRPYKSWRPIEQATMSYGHGISVSLLQMVHAYTVFARDGDLIP- 447

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKV 527
             +   R   + +   +    T + MRS+L       GS  RA VPG+ V GKTGTA K+
Sbjct: 448 --ITFQRTTDQPIGERIFSAKTARQMRSMLEMAAGPTGSAPRAQVPGYRVAGKTGTAYKI 505

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
            K +Y      +SF+   P +DP+ I+   +D P      +   G   AP+   +   + 
Sbjct: 506 EKGQYVR-KYVSSFVGFAPVSDPRIIIAVMIDEPGA---GKHYGGQVAAPVFATVTANAL 561

Query: 588 SMLGVKPV 595
             + V P 
Sbjct: 562 RSMNVAPD 569


>gi|329924113|ref|ZP_08279346.1| stage V sporulation protein D [Paenibacillus sp. HGF5]
 gi|328940845|gb|EGG37155.1| stage V sporulation protein D [Paenibacillus sp. HGF5]
          Length = 647

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/550 (25%), Positives = 247/550 (44%), Gaps = 44/550 (8%)

Query: 85  YIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVE 139
           +  L IR+          +  +          +   R +I+DRNG  L T+I T +++  
Sbjct: 23  FSALIIRLAYVQIGKGAELSAKAEDLWRRDIPFAAQRGEILDRNGTALVTNITTPTIWAI 82

Query: 140 PHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RRKLSPQQQKRILSFGLP 196
           P ++  PD   E L  ++  +D + I++ ++  ++ + +    RK++ +  + I    LP
Sbjct: 83  PVQIKDPDHTAETLAGLIS-MDKDDIKKIITKRSRLERINPGGRKITMELAQEIRDLKLP 141

Query: 197 GVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNKGE- 250
           G+    +  R+YP    A+H++G+    ++G+TG+E   D      +G     +   G  
Sbjct: 142 GIVVAEDNKRYYPYGDLAAHILGFTGAYSQGLTGLEAMHDDKLKGFEGGISYLSDAGGRI 201

Query: 251 -----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
                      ++   + L +D  IQ+I+ +EL +   KY A    ++ +N  TGE+++M
Sbjct: 202 MPGSSEKYVEPRDGLNLELTIDKSIQSIMERELDQAMVKYQANGAWSIAMNPKTGEILAM 261

Query: 300 VSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRN 357
            S P Y P    +   E +  N   +  +E GS FK+ T+A  ++        D F    
Sbjct: 262 ASRPGYSPANYQEFSAETYNRNLPIWMTYEPGSTFKIITLAAALEEDKVDLKNDHFFDSG 321

Query: 358 PIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
            ++VG           +   T  E+ + S N G   +   +G +   +++   G  +K  
Sbjct: 322 AVEVGGARLRCWKKGGHGSQTFMEVVQNSCNPGFVALGQKLGKESLFQYIRDFGFGAKTG 381

Query: 417 TELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            +L   +        +   +   T +FG G+S TP+Q   A +A IN G+L  P      
Sbjct: 382 IDLNGEENGILFKLDKVGPVELATTAFGQGVSVTPIQQVAAVSAAINGGKLFKPHVAKAW 441

Query: 475 REE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
                         ++ R V+ + T K +R  L   V  G+GR AF+ G+ VGGKTGTAQ
Sbjct: 442 VNPETGETVEEIKPELVRQVISEETSKQVREALESVVAKGTGRPAFIDGYRVGGKTGTAQ 501

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           KVI  RYS T +  SF+   P  DP+ +V + +D+PK  +      G+  AP+V NI+  
Sbjct: 502 KVINGRYSSTEHIVSFIGFAPADDPEIVVYTAVDNPKGIQ----FGGVVAAPIVQNILED 557

Query: 586 SASMLGVKPV 595
           +   + V P 
Sbjct: 558 ALHYMNVPPR 567


>gi|156973215|ref|YP_001444122.1| penicillin-binding protein 3 [Vibrio harveyi ATCC BAA-1116]
 gi|156524809|gb|ABU69895.1| hypothetical protein VIBHAR_00896 [Vibrio harveyi ATCC BAA-1116]
          Length = 601

 Score =  384 bits (985), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/558 (27%), Positives = 251/558 (44%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +      + +L  R+     I P     +    S+ +     +R  I DRNGE
Sbjct: 49  RWRFQLLLFFVFCAFALLVGRVAYIQVIEPDNLIKQGDLRSVRVKAIPSARGIISDRNGE 108

Query: 126 ILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRRKLSS--ETKFQWL 178
            LA  +P  +++ +P  +     +        L  VL  LD + +  K+    + +F +L
Sbjct: 109 PLAVSVPVEAVWADPKTIFKEGALQQTKSWYALADVL-GLDRQGLINKIKKNEKRRFIYL 167

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R++SP     I    LPGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 168 QRQVSPAMANYIRELKLPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEW 227

Query: 239 -----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G   +     G           +  +P++L +D RIQ + ++ + +    + A S
Sbjct: 228 LTGAAGKKTIRKDRYGRVVENIALEEKQEGKPLQLTIDQRIQAVAYRAIKQAVADHRATS 287

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              VIL+V TG V++MV+ P Y+P+     +     NR+     E GS  K F +   ++
Sbjct: 288 GSVVILDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRVITDSLEPGSTIKPFVVLAALE 347

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT N I           P+    T+  I + SSNIG  ++A  M ++   
Sbjct: 348 NGVADKDTIVDTGNGILQLGGSRVRDAPKVGKATLTTILKKSSNIGVTKLAMQMPVEALL 407

Query: 404 EFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +GL       L       +P  S+W  I   TISFG+GLS TP+Q A A A L N
Sbjct: 408 GLYSSVGLGELSGLNLVGEVVGIFPSRSRWSPIERATISFGYGLSVTPIQLAHAYATLGN 467

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +  +  +   ++R V+ K   + +  +L      GGS RRA VPG+ VG K
Sbjct: 468 LGKYEPIHIIESNDND---MARQVVSKENARLVLDMLETVTQKGGSARRAAVPGYRVGAK 524

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           TGTA+K     YSD    N    V P +DP+  ++  ++ P+  +      G   +P   
Sbjct: 525 TGTARKASAGGYSDE-YINYTAGVAPVSDPRLALVVVVNEPQGDD---YYGGSVASPAFS 580

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L V P   K
Sbjct: 581 EIMKGALQILNVAPDENK 598


>gi|285019579|ref|YP_003377290.1| cell division protein ftsi [Xanthomonas albilineans GPE PC73]
 gi|283474797|emb|CBA17296.1| probable cell division protein ftsi [Xanthomonas albilineans]
          Length = 621

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/561 (27%), Positives = 263/561 (46%), Gaps = 38/561 (6%)

Query: 65  KVIAHS----KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMS 115
           +  + S    + R+ +      +  + L  R              +  A  +       S
Sbjct: 6   RNRSRSNFNLRGRLALVGAALGLCSMTLIGRAAYVQLINTDFYQRQGEARFLRELPIATS 65

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--T 173
           R  I DRNGE LA   P  S++V P +++   + I +L   L +L  + +  KLS +   
Sbjct: 66  RGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPQLAQAL-DLPVDELTAKLSQKVDK 124

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   +++ G+PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 125 EFMYLKRRINPDKAHAVIALGIPGVFAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 184

Query: 234 FLDMQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKK 277
             D       G  RV    KG            +  + + L++D RIQ + ++EL     
Sbjct: 185 AFDEWLRGKPGAERVIRDRKGAIVESIDLVKPTQPGKDLTLSIDRRIQFLAYKELRNALV 244

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           +  A     VI++V TGE+++MV++P Y+P+       +   NR    + E GS  K  T
Sbjct: 245 ENKAAGGSIVIMDVVTGEILAMVNLPTYNPNAVTGVNSDARRNRAVTDLVEPGSTMKPLT 304

Query: 338 IAMGIDSGLFTVKD-LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           I+  + +G+ T    +      + VG+  I D    N +LT+  +   SSNIGAA+IA  
Sbjct: 305 ISTALKAGVVTKDTLIDTNPGYMAVGRFTIKDVPHNNGVLTVTGVITRSSNIGAAKIAAK 364

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAV 454
           +  Q   + ++  G  S   +  P   A     P++W      T+++G+GLS TPLQ A 
Sbjct: 365 LPDQTFYDQIHSYGYGSAPHSGFPGESAGVLPSPARWSGSSKTTMAYGYGLSVTPLQIAR 424

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           A  AL N G+L+ PTF+    EE    ++ VL     K + +++   VT G  + A + G
Sbjct: 425 AYCALGNGGKLVTPTFVKGQHEE----TKQVLDPAIAKEVVAMMETVVTQGGAKGAAILG 480

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           + V GKTGTA+K     Y        F  + P + P++  +  ++ P+  +      G+ 
Sbjct: 481 YHVAGKTGTARKTGPGGYEHGHYNALFAGLVPASHPRFATVIVINDPQGTK---YYGGLV 537

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP+  N++  +  ++ V P 
Sbjct: 538 SAPVFHNVMEGALRLMDVPPD 558


>gi|89067946|ref|ZP_01155390.1| Cell division protein FtsI/penicillin-binding protein 2 [Oceanicola
           granulosus HTCC2516]
 gi|89046544|gb|EAR52600.1| Cell division protein FtsI/penicillin-binding protein 2 [Oceanicola
           granulosus HTCC2516]
          Length = 595

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 175/566 (30%), Positives = 286/566 (50%), Gaps = 17/566 (3%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
                    E+ +   +  R K  A ++ R+ +   +  + ++ +  R+           
Sbjct: 19  GANPDAIEAENLRLRHEDMRDKARARAEGRLVVLGAMFFLAFVTIGGRMGALAGSESSEP 78

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE 163
             S+  +    +R DI+DRNG ILAT++ T +LYV P  +I P+     L  + P L  +
Sbjct: 79  EASVAGNPIIGTRADIVDRNGRILATNLDTHALYVHPQDIIDPEAAARGLVEIFPELKYD 138

Query: 164 MIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
            +    +SE +F W+RR++SP+Q + +   G PG+ F   + R YP  S A+H++G    
Sbjct: 139 ELYELFTSERRFDWIRREISPEQMQAVFEIGDPGLLFGPREMRLYPNGSLAAHILGGASY 198

Query: 224 DNRGITGIEKFLDMQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
              G++  E  + + G  + F            P+ L++DL +Q    + L       NA
Sbjct: 199 GTEGVSAAE-VIGVAGAEKYFDNYLRDPANEGAPLELSIDLSVQAAAERVLQGGMTLMNA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFK------GKKEGWFNRISYGIFEMGSIFKV 335
           +   +V++++ TGE++SMVS+PD+DP+                FNR   G++E+GS+FK+
Sbjct: 258 KGASSVLMDIHTGEILSMVSLPDFDPNNRPPVATQGDQSDSPLFNRAVQGVYELGSVFKI 317

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FTIA G++ GL   + + +T+ P+  G+  I D+H     L+  ++   SSNIG A++A 
Sbjct: 318 FTIAQGMELGLINAETMIETKGPLTWGRFRIRDFHDYGPELSATDVIVESSNIGTARVAM 377

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTA 453
            +G +  +EFL RLGLL     EL E        P+ W  I ++TIS+GHGLS++PL  A
Sbjct: 378 HIGGERQREFLGRLGLLEPTSVELVEAPTGRPLLPANWSEISTMTISYGHGLSSSPLHLA 437

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A+L+N G  + PT +   R         V+        R +LR+ V  G+     VP
Sbjct: 438 QAYASLLNGGERVTPTLLR--RTAPPPAGERVVSDVVSAAARYMLRQVVVRGTASFGEVP 495

Query: 514 GFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER--NQL 569
           G++V GKTGTA K       Y D     +F ++FP  DPQY+++  +D P        + 
Sbjct: 496 GYDVAGKTGTADKPRENGGGYYDDKVIATFASIFPADDPQYVLILSLDEPVETMGDQPRR 555

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
           TAG    P+   +IRR+A +LG++P 
Sbjct: 556 TAGWTAVPVAAEMIRRTAPLLGLRPD 581


>gi|189423745|ref|YP_001950922.1| peptidoglycan glycosyltransferase [Geobacter lovleyi SZ]
 gi|189420004|gb|ACD94402.1| Peptidoglycan glycosyltransferase [Geobacter lovleyi SZ]
          Length = 662

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/557 (27%), Positives = 233/557 (41%), Gaps = 40/557 (7%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNG 124
           ++ RI M   +    ++ +  R      +  +                  +R  I DR G
Sbjct: 9   ARVRIIMVSCLFACGFLAVTARSFYLQVVQHDQLVKLAERQHNRTIPITPARGGIFDRTG 68

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
             LA  +   SLY EP ++  P  +   L   L  +    ++RKL SE  F WL R+L P
Sbjct: 69  AALAVSLEMDSLYAEPKRITDPAGMAAALAP-LIQIPQHELQRKLDSEKSFAWLARQLPP 127

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQG 239
           +   +I    LPG+GF  E  RFYP    ASHV+G+  +D  G+ G+E+  D       G
Sbjct: 128 ETASKIKQLKLPGIGFVKENKRFYPNFEMASHVLGFTGMDPGGLEGLERRYDTTILGKTG 187

Query: 240 LTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
                    G                + + L LD  IQ    +EL +  +   A+S   +
Sbjct: 188 YLLTERDALGRDVAIRNAVVQDAAPGKNLYLTLDKNIQYFTEKELAKAVEGSRAKSGMAL 247

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++  TG+V++M + P ++P+   +       NR     FE GS FKVF ++  ++  L 
Sbjct: 248 VMDPWTGKVLAMANYPTFNPNSFRQYPSLNLRNRCVSDSFEPGSTFKVFLLSAALEEKLV 307

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
             +D  +  N        I      +  +++ E+ +YSSNIG+A+I   +G      +L 
Sbjct: 308 RPQDGINCENGRYSFGGRIIRDDHPHGRVSVAEVLKYSSNIGSAKIGLKLGDDRLHRYLK 367

Query: 408 RLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
             G   K   +LP   +      S+W      TISFG G+S T LQ   A +A+ N G L
Sbjct: 368 AFGFGDKSGIDLPGEASGGLRPVSRWYGTDIATISFGQGVSATALQLVAATSAVANGGLL 427

Query: 466 IPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFE 516
           + P  + R  + +         +  R V+   T  TM  ++      GG+   A + GF 
Sbjct: 428 MKPYLVERVTDNAGLELQRFEPQTVRRVISTQTAATMTQMMEGVTQKGGTATNAAIDGFR 487

Query: 517 VGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           V GKTGTAQKV    + YS T    SF+   P   P   +L  +D P          G+ 
Sbjct: 488 VAGKTGTAQKVDPVSRGYSATKRTASFVGFVPAEKPLLTILVVIDEPATSP----YGGVV 543

Query: 575 VAPMVGNIIRRSASMLG 591
            AP    I   +   L 
Sbjct: 544 AAPAFREIAFNTLCYLK 560


>gi|86148534|ref|ZP_01066821.1| Cell division protein FtsI [Vibrio sp. MED222]
 gi|85833680|gb|EAQ51851.1| Cell division protein FtsI [Vibrio sp. MED222]
          Length = 585

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 145/575 (25%), Positives = 250/575 (43%), Gaps = 36/575 (6%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSM 107
           E  ++  +  +       K R  + I    + +  L  R+     I P     +    S+
Sbjct: 15  ESTKERVKSEKDSDPILIKWRFNVVIAFVFLAFAALVGRVAYIQIIEPDNLIRQGDLRSV 74

Query: 108 NIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDS 162
            +     +R  I DRNGE LA  +P  +++ +P  +   + + +      L  VL     
Sbjct: 75  RVKAIPSARGIISDRNGEPLAVSVPVEAVWADPKTIFDKNGMAQIDRWYALADVLGLQRQ 134

Query: 163 EMIRRK-LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            MI +   +   +F +L+R++SP   K I    L GVG + E  R+YPA   ++H++G  
Sbjct: 135 SMIDKISSNKSRRFIYLQRQVSPAMAKYIRELKLVGVGLKAESRRYYPAGEVSAHLIGVT 194

Query: 222 DIDNRGITGIEKFLDMQ-----GLTRVFTTNKG----------EKNLQPIRLALDLRIQN 266
            ID  G+ G+E+  D       G   +     G           +  +P+ L +D R+Q 
Sbjct: 195 GIDGHGLEGVERSYDKWLTGEAGKRTIRKDRYGRVVENIALEEREEGKPLELTIDQRLQA 254

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           I ++ + +    + A S   V+L+V TG V++MV+ P Y+P+     +     NR+    
Sbjct: 255 IAYRAIKQAVADHKATSGSAVLLDVKTGAVLAMVNAPSYNPNNRSDLQSFKMRNRVLTDA 314

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
            E GS  K F +   +++G    K + DT N I            +     +  I + SS
Sbjct: 315 MEPGSTVKPFVVLAALENGTADAKSIIDTGNGIMQIGGSRVRDTSKVGKADLALILKKSS 374

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHG 444
           NIG A++A  M ++        +GL       L    +  +P+  +W +    T+SFG+G
Sbjct: 375 NIGVAKLALDMPLEALLGMYSSVGLGEMSGLNLVGETSGIFPNRRRWSKFEIATLSFGYG 434

Query: 445 LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT- 503
           LS TPLQ A A A L N+G   P   +  + ++    S+ ++K+   + +  +L      
Sbjct: 435 LSVTPLQLAHAYATLANKGMYEPIHIIKSNDQD---FSKQIIKRENAEMVLQMLEGVTQK 491

Query: 504 GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           GG+  RA VPG+ V  KTGT++K     YSD           P +DP+  ++  ++ P+ 
Sbjct: 492 GGTATRAAVPGYRVAAKTGTSRKAAAGGYSDE-YIAITSGFAPVSDPRVALVVVVNEPQG 550

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
                   G   AP+   I++ +  +L V     K
Sbjct: 551 DL---YYGGSVAAPVFSEIMKGALQILNVPADENK 582


>gi|52080119|ref|YP_078910.1| penicillin-binding protein [Bacillus licheniformis ATCC 14580]
 gi|52785493|ref|YP_091322.1| SpoVD [Bacillus licheniformis ATCC 14580]
 gi|319646106|ref|ZP_08000336.1| SpoVD protein [Bacillus sp. BT1B_CT2]
 gi|52003330|gb|AAU23272.1| penicillin-binding protein [Bacillus licheniformis ATCC 14580]
 gi|52347995|gb|AAU40629.1| SpoVD [Bacillus licheniformis ATCC 14580]
 gi|317391856|gb|EFV72653.1| SpoVD protein [Bacillus sp. BT1B_CT2]
          Length = 644

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 150/564 (26%), Positives = 255/564 (45%), Gaps = 43/564 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  ++I++I+  R+     +  +               +   R +I+DRN
Sbjct: 7   TVRKRLIFVLLFGVIIFLIIDTRLGYVQFVLGDKLTTLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    S+ V P +V +P +    L  VL N+  E   + ++ +T  + +    R
Sbjct: 67  GVKLATNQSAPSVLVVPKQVENPIKTSRLLASVL-NMSEEKAYKHVTKKTSIERINPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           K+S ++ K +    L GV    +  R YP  S+ SHV+G+  IDN+G+ G+E F D +  
Sbjct: 126 KISHEKAKEVRDLNLKGVYIAEDSIRHYPFGSYLSHVLGFAGIDNQGLLGLEAFYDKELK 185

Query: 239 ---GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
              G  + ++  KG             K+   ++L +D ++Q I+ +E    + KYN + 
Sbjct: 186 GEKGYVKFYSDAKGKRMPGEADDYTPPKDGLDMKLTIDSKVQTIMEREFDIAEAKYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE+++MVS PD+DP        + +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MVGVAMNPKNGEILAMVSRPDFDPANYQSIDPKVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLF--TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       +   +  E+ + S N G  ++   +G +
Sbjct: 306 EENKVNLQKDQFYDKGSVEVDGARLKCWKRGGHGAQSFLEVVQNSCNPGFVELGQRLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
               ++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFTYIKSFGFGQKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQVTAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         ++    R V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKQTVKKQTPIAKRKVISEETSKQIRYALESVVAQGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y    +  SF+   P+ DP  +V   +D+PK   +   
Sbjct: 486 AFVDGYRVGGKTGTAQKVKDGKYLKNNHIVSFIGTAPSDDPSIVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVK 593
             G   AP+VGNI+R S   LGVK
Sbjct: 543 FGGTVAAPIVGNIMRDSLPQLGVK 566


>gi|146295953|ref|YP_001179724.1| stage V sporulation protein D [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|145409529|gb|ABP66533.1| stage V sporulation protein D [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 719

 Score =  383 bits (984), Expect = e-104,   Method: Composition-based stats.
 Identities = 135/589 (22%), Positives = 239/589 (40%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPD 118
           ++     K RI   + +  + +++L  R+     I  E       +           R  
Sbjct: 2   KEASIKIKKRIIFMMAIFFLSFVLLVGRLSYLQLIKGEELKKKAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++     +V   +     L  +L  +D E I +KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLSQVKDKEYTARVLSGIL-GMDYEKILKKLNTKGVSDVY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +   +  +I  + LPGV       R YP  +  + V+G+  +D++G+ G+E + D 
Sbjct: 121 IARNIDKDKANKIRKYDLPGVYLTGGAKRVYPNGNFLAQVLGFTGVDDQGLAGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGSIAAQTDASGRAAPFSEEFFKKPADGYDVMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP+  F    +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNRPFDLLYKDRFPDFDKLPQSEKVKIIQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R    ++E GS FK+ T A G++ G+      F  R  +KV   ++  +     +     
Sbjct: 301 RALNDVYEPGSTFKIVTAAAGLEEGVVNENSRFYCRGYVKVANAILRCWRYYNPHGAENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP               +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPIDKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV--------SRIVLKK 488
            TISFG G+S TP+Q       + N+G  + P  +    ++ +KV         R V+  
Sbjct: 421 ATISFGQGISATPIQVISMINTVANDGVWVQPHIVKAIYDKDKKVIKSFGNPEKRRVMNP 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
              K +RS+L+  VT G+G  A++ G+ V GKTGT+QK  K   +      SF    P  
Sbjct: 481 EIAKRLRSILQSVVTNGTGHNAYLLGYRVAGKTGTSQKYDK---TVKRYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLEIQPQYT 583


>gi|51892343|ref|YP_075034.1| soprulation-specific penicillin-binding protein [Symbiobacterium
           thermophilum IAM 14863]
 gi|51856032|dbj|BAD40190.1| soprulation-specific penicillin-binding protein [Symbiobacterium
           thermophilum IAM 14863]
          Length = 707

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 140/556 (25%), Positives = 234/556 (42%), Gaps = 38/556 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R    I +  +++  L  R+I            +     M        R  I+DRNG 
Sbjct: 8   RRRTVALIGIFALVFTALTGRMIYLQIAAGDFFADKAFRYRMRPVPIQADRGQILDRNGY 67

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
            L T+    S+Y EP  +         L  +L N+  E + R++S  T F+WL+RK+ P+
Sbjct: 68  PLLTNRVCESVYAEPIVIRDKAAAARALAPIL-NMPPEELERRMSRHTFFEWLKRKVDPE 126

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
              ++ +  + G+G   EK R+YP    A HV+G  ++D++GI G+E   +       G 
Sbjct: 127 VAAQVKALNITGIGLAPEKCRYYPEDELAVHVLGIANLDHQGIEGLELTYNEYLKGQNGQ 186

Query: 241 TRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
            +   T +G                  +   LD+ +Q I+ +++     +  A+    ++
Sbjct: 187 IQCEYTARGLPMEDGECHVIYGTPGHDLVTTLDVNLQRIIERDVERAVLETRAQRAAIIV 246

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           ++V TGE++++   P YDP        +             GSIFK  T A  +DSG+  
Sbjct: 247 MDVKTGEILALAQWPRYDPELGGNSDPQLRRIFTVTDALNPGSIFKPITAAAALDSGVID 306

Query: 349 VKDLFDTRNPIKVGKH-VIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
              +F+    + V    + +        + I EI   SSN+G   +   +G     E+  
Sbjct: 307 RNTVFNDTGCMTVEGWTICNWDRKGLGSVRIDEIMAKSSNVGFGTLGMWLGADRFYEYHS 366

Query: 408 RLGLLSKLETELPEIQAPSYPSQWKR--IHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
           R GL      +LP      Y  +     I     ++G  L+ TP+Q   A AA+ N+G+L
Sbjct: 367 RFGLDRPTGIDLPGEATGQYRPKKDATAIDLAVQAYGQTLTATPIQMLTAIAAIANDGKL 426

Query: 466 IPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           + P       +           +V R V+     + ++ L+   V  G+G+ A V G++V
Sbjct: 427 MWPHLGKAIYDHEGNLVKEIQPRVVRQVVAPEVARYVQELMVGVVENGTGKNARVAGYQV 486

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           GGKTGTA KVI  R +      SF+   P  DPQ  VL  +D P+         G   AP
Sbjct: 487 GGKTGTANKVIGGRIAQGKYIASFVGFAPYPDPQVAVLISIDEPQ----GAYYGGQIAAP 542

Query: 578 MVGNIIRRSASMLGVK 593
           + G ++    + L   
Sbjct: 543 IFGEVMGSVLAYLDAP 558


>gi|312622931|ref|YP_004024544.1| stage v sporulation protein d [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312203398|gb|ADQ46725.1| stage V sporulation protein D [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 719

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 131/589 (22%), Positives = 246/589 (41%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + V  + +++L  R+     I  E +                 R  
Sbjct: 2   KEASLKVKKRILFVMAVFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QIDYKKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +  ++  +I  + LPG+       R YP  +  + V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKEKADKIRKYALPGIYLTGGTKRVYPNGNFLAQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPVDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A++V  ++  V TGE+++M S PD+DP++ F+   +                     W N
Sbjct: 241 AKNVTIIVEKVKTGEILAMTSKPDFDPNKPFELIYKDKFPDFDKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+      F  R  +KV   ++  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGVVNENSQFYCRGYVKVANAILKCWRYYNPHGSENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP           +   +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPLGKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--------VSRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K          R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAVANDGVWVQPHVVKAIYDKDKKLIKSFDTPQKRRVLDQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + ++ +L+  VT G+G  A++ G++V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLKVILQSVVTNGTGHNAYLLGYKVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|13471555|ref|NP_103121.1| penicillin-binding protein [Mesorhizobium loti MAFF303099]
 gi|14022297|dbj|BAB48907.1| penicillin-binding protein [Mesorhizobium loti MAFF303099]
          Length = 569

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 260/550 (47%), Positives = 372/550 (67%), Gaps = 10/550 (1%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE---PIAPSMNI 109
           EDG  + +  R+      K RI MT+ V   I+  ++ R++  G   P+           
Sbjct: 14  EDGSIVVEGARKATGGKGKARIVMTMAVFFGIFSTISGRLVYLGFQTPDLSGGPQSR--- 70

Query: 110 DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL 169
                SRPDI+DRNGE+LATDI T SL+ EP +++  DE IEKL  VLP +D E    KL
Sbjct: 71  --ITASRPDIVDRNGEVLATDIKTASLFAEPRRIVDADEAIEKLSTVLPEIDYEQTYHKL 128

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
            S   F WL+R+L+P+QQ  I+  G+PG GFR EK RFYP+   +S++VG  +IDN+GI+
Sbjct: 129 KSGAGFVWLQRQLTPKQQADIMQLGIPGFGFRTEKRRFYPSGETSSYIVGLTNIDNQGIS 188

Query: 230 GIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVI 288
           G+EK++D QGL+ +  +     K+L+P++L++DLR+Q++V  E+    ++Y A   G V+
Sbjct: 189 GMEKYIDEQGLSDLQASGLAVAKDLKPVKLSIDLRVQHVVRDEIAAGLERYRAIGAGAVV 248

Query: 289 LNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFT 348
           LNV TGEVI+M S+PD+DP+  +  +++   NR+S G++EMGS FK FT AM +DSG  T
Sbjct: 249 LNVKTGEVIAMASVPDFDPNNPYNAQEKDRLNRMSAGLYEMGSTFKSFTSAMALDSGKAT 308

Query: 349 VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
           +   FD  +PI+VG   IHD+H +NR+L++PE+F YSSNIG+A+ A+ +GI+GH+EFL+R
Sbjct: 309 MNSRFDASHPIRVGHQAIHDFHGKNRVLSLPEVFLYSSNIGSAREAELVGIEGHREFLHR 368

Query: 409 LGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           LG+L +++TELPE+  P+ P  WK+++S TI+FGHG+STTPLQ AV  AAL+N G L+ P
Sbjct: 369 LGILERMQTELPEVARPTEPKVWKQVNSFTIAFGHGVSTTPLQAAVGCAALMNGGYLMNP 428

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI 528
           TF++R+++E+  +++ V+ + TV+ MR L       GS R A VPG+ VGGKTGTA+KVI
Sbjct: 429 TFLVRTQQEAMAIAKKVVSEKTVEGMRYLYSLNAEKGSARNARVPGYRVGGKTGTAEKVI 488

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIRRSA 587
             RYS  LNFN+F+A FP  DPQY+V +  D+P  ++      A  N   M GNIIRRSA
Sbjct: 489 NGRYSKELNFNTFVAAFPIEDPQYLVFTIADAPHPEKPGMTDVAAANAGVMAGNIIRRSA 548

Query: 588 SMLGVKPVFL 597
           +MLGVKP F 
Sbjct: 549 AMLGVKPDFS 558


>gi|310642993|ref|YP_003947751.1| stage v sporulation protein d/sporulation specific
           d,d-transpeptidase [Paenibacillus polymyxa SC2]
 gi|309247943|gb|ADO57510.1| Stage V sporulation protein D/sporulation specific
           D,D-transpeptidase [Paenibacillus polymyxa SC2]
          Length = 638

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 143/571 (25%), Positives = 261/571 (45%), Gaps = 44/571 (7%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPD 118
           +K     + R+   ++   V++  L+IR+          +  +          +   R +
Sbjct: 2   KKSNVIMRRRLVWGLLGLFVLFAALSIRLAYVQLGKGGELSAKAEDSWRRNIPFAAKRGE 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL 178
           I+DR G  L  ++ + ++   P ++  P+E   +L  +L ++  + + + ++  T  Q L
Sbjct: 62  ILDRQGTALTYNVSSPTVMAIPVQIKEPEETARRLAPLL-DMSEDKVLKLITKRTASQKL 120

Query: 179 R---RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
           +   RK++ ++ ++I    LPG+    +  R+YP    A+H++G+  IDN+G+TG+EK  
Sbjct: 121 QPGGRKITMEKAQKIRDLKLPGIVVAEDNKRYYPYGDLAAHILGFTGIDNQGLTGVEKQQ 180

Query: 236 DMQ-----GLTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENKKK 278
           + +     G     +   G             K+   ++L +D  +Q+I+ +EL +   K
Sbjct: 181 NSKLRGIDGSIAYLSDAGGRLMPGSSEKYIEPKDGLNLQLTIDKSVQSIMERELDQAMVK 240

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFT 337
           + A+S  ++ +N  TGE++ M   P Y+P    +   E +  N   +  +E GS FK+ T
Sbjct: 241 FQAKSALSIAMNPKTGEILGMAGRPSYEPALYKQYAPEIYNRNLPIWMTYEPGSTFKIIT 300

Query: 338 IAMGIDSGLFT-VKDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           +A  ++        D F     I+VG           +   T  ++   S N G   +  
Sbjct: 301 LAAALEEKKVNLKNDRFFDPGYIEVGGARLRCWKKGGHGSQTFLQVVENSCNPGFVTLGQ 360

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTA 453
            +G +   +++   G  SK   ++            Q   +   T +FG G+S TP+Q  
Sbjct: 361 RLGKETLFKYIRNFGFGSKTGIDMIGEGNGILFKLAQVGPVELATTAFGQGVSVTPIQQV 420

Query: 454 VAAAALINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTG 504
            A +A IN G L  P       +            ++ R V+ ++T + +R  L   V  
Sbjct: 421 TAVSAAINGGNLYKPHITKGWIQPETGKVLEKVEPELVRRVVSEDTSRQVREALESVVAK 480

Query: 505 GSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIK 564
           G+GR AF+ G+ VGGKTGTAQKVI  RYS + +  SF+   P  DPQ +V + +D+PK  
Sbjct: 481 GTGRPAFIEGYRVGGKTGTAQKVINGRYSSSEHIVSFIGFAPADDPQIVVYTAVDNPKGI 540

Query: 565 ERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           +      G+  AP+V NI++ +   L + P 
Sbjct: 541 Q----FGGVVAAPIVQNILKDALIALKIPPR 567


>gi|58583454|ref|YP_202470.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|58428048|gb|AAW77085.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 625

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/567 (26%), Positives = 261/567 (46%), Gaps = 34/567 (5%)

Query: 55  GQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNI 109
           G     + R +   + + R+ +  +   +  + L  R     ++       +  A  +  
Sbjct: 2   GAMKTGRNRTRSNFNLRGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRE 61

Query: 110 DEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL 169
                SR  I DRNGE LA   P  S++V P +++   + I +L   L     + +  KL
Sbjct: 62  LPIATSRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKL 120

Query: 170 SSE--TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           + +   +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG
Sbjct: 121 AQKAGKEFMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRG 180

Query: 228 ITGIEKFLDMQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQE 271
             G+E   D       G  +V    +G            +  + + L++D RIQ + ++E
Sbjct: 181 QEGLELAFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKE 240

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L     + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS
Sbjct: 241 LRNALVENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGS 300

Query: 332 IFKVFTIAMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGA 390
             K  T+A  + +G+ T   + D     + VG+  I D    N +L +  +   SSNIGA
Sbjct: 301 TMKPLTVATALTAGVVTKDTVIDTNPGYMSVGRFTIRDVPHNNGVLNVTGVITRSSNIGA 360

Query: 391 AQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTT 448
           A+IA  +  Q   + +   G  S   +  P   A     P++W      T+S+G+GLS T
Sbjct: 361 AKIAAKVPDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVT 420

Query: 449 PLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR 508
           PLQ A A A L N G+L PPTF+     E    +R V+     + +  ++   VT G  +
Sbjct: 421 PLQIAQAYATLGNGGKLTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAK 476

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
            A + G+ V GKTGTA+K     Y        F  + P T P++  +  ++ P+ K    
Sbjct: 477 GAAILGYHVAGKTGTARKNGASGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV--- 533

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
              G+  AP+   ++  +  ++ V P 
Sbjct: 534 YYGGLVSAPVFHKVMEGALRLMDVPPD 560


>gi|261405660|ref|YP_003241901.1| stage V sporulation protein D [Paenibacillus sp. Y412MC10]
 gi|261282123|gb|ACX64094.1| stage V sporulation protein D [Paenibacillus sp. Y412MC10]
          Length = 647

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 141/550 (25%), Positives = 245/550 (44%), Gaps = 44/550 (8%)

Query: 85  YIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVE 139
           +  L IR+          +  +          +   R +I+DRNG  L T+I T +++  
Sbjct: 23  FSALIIRLAYVQIGKGAELSAKAEDLWRRDIPFAAQRGEILDRNGTALVTNITTPTIWAI 82

Query: 140 PHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RRKLSPQQQKRILSFGLP 196
           P ++  PD   E L  ++  +D   I++ ++  ++ + +    RK++ +  + I    LP
Sbjct: 83  PVQIKDPDHTAETLAGLIS-MDKADIKKIITKRSRLERINPGGRKITMELAQEIRDLKLP 141

Query: 197 GVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNKGE- 250
           G+    +  R+YP    A+H++G+    ++G+TG+E   D      +G     +   G  
Sbjct: 142 GIVVAEDNKRYYPYGDLAAHILGFTGAYSQGLTGLEAMHDDKLKGFEGGISYLSDAGGRI 201

Query: 251 -----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
                      ++   + L +D  IQ+I+ +EL +   KY A    ++ +N  TGE+++M
Sbjct: 202 MPGSSEKYVEPRDGLNLELTIDKSIQSIMERELDQAMVKYQANGAWSIAMNPKTGEILAM 261

Query: 300 VSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRN 357
            S P Y P    +   E +  N   +  +E GS FK+ T+A  ++        D F    
Sbjct: 262 ASRPGYSPANYQEFSAETYNRNLPIWMTYEPGSTFKIITLAAALEEDKVDLKNDHFFDSG 321

Query: 358 PIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
            ++VG           +   T  E+ + S N G   +   +G +   +++   G  +K  
Sbjct: 322 AVEVGGARLRCWKKGGHGSQTFMEVVQNSCNPGFVALGQKLGKESLFQYIRDFGFGAKTG 381

Query: 417 TELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            +L   +            +   T +FG G+S TP+Q   A +A IN G+L  P      
Sbjct: 382 IDLNGEENGILFKLDNVGPVELATTAFGQGVSVTPIQQVAAVSAAINGGKLFKPHVAKAW 441

Query: 475 REE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
                         ++ R V+ + T K +R  L   V  G+GR AF+ G+ VGGKTGTAQ
Sbjct: 442 VNPETGETVEEIKPELVRQVISEETSKQVREALESVVAKGTGRPAFIDGYRVGGKTGTAQ 501

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           KVI  RYS T +  SF+   P  DP+ +V + +D+PK  +      G+  AP+V NI+  
Sbjct: 502 KVINGRYSSTEHIVSFIGFAPADDPEIVVYTAVDNPKGIQ----FGGVVAAPIVQNILED 557

Query: 586 SASMLGVKPV 595
           +   + V P 
Sbjct: 558 ALHYMNVPPR 567


>gi|251797880|ref|YP_003012611.1| stage V sporulation protein D [Paenibacillus sp. JDR-2]
 gi|247545506|gb|ACT02525.1| stage V sporulation protein D [Paenibacillus sp. JDR-2]
          Length = 645

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 138/564 (24%), Positives = 248/564 (43%), Gaps = 45/564 (7%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ + +++ +  +  L  R+        E               Y   R DI+DRNG 
Sbjct: 9   RRRLFIVLLISVAAFAGLIFRLSYVQLWQGEKLSAQAEDNWRREIPYKAKRGDILDRNGT 68

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---RKL 182
            LA DI T ++   P ++        KL   L ++  E + + LS +T    L+   +++
Sbjct: 69  KLAYDISTPTVLAIPVQIPDKQATAAKLAPYL-DMTEEALVKLLSKKTSIVELKPGGKRM 127

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM----- 237
           +  + +++ +  L GV    + +R+YP  S A+H++G+  +D +G+TG+E   +      
Sbjct: 128 TTDKAQQVRNLHLNGVVVAEDNNRYYPFGSLAAHLLGFTGVD-KGLTGVEAKYNDMLKGI 186

Query: 238 QGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
            G     +T  G             +    + L +D +IQ ++ +EL +       + + 
Sbjct: 187 DGNVSYLSTASGKTMPNSSDTYKAPQQGLSLELTIDQQIQAVMERELDQAMTALQPDDII 246

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDS 344
            + +N +TGE++ M S P Y+P    +   E +  N   +  +E GS FK+ T+A  I+ 
Sbjct: 247 AIAMNPNTGEILGMASRPTYEPANFREYPSETYNRNLPIWMTYEPGSTFKIITLAAAIEE 306

Query: 345 GLFT-VKDLFDTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGH 402
                  + F     +++G           +   T  E+ + S N G   + + +G +  
Sbjct: 307 KKVDLKNETFFDPGAVEIGGARLRCWKKGGHGSQTFLEVVQNSCNPGFVNLGNRLGKEKL 366

Query: 403 KEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALI 460
            +++   G  SK   ++P           +   +   T +FG G+S TP+Q   A +A I
Sbjct: 367 FDYIKNFGFGSKTGIDIPGEANGILFKLDKVGPVELATTAFGQGVSVTPIQQIAAVSAAI 426

Query: 461 NEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
           N G L  P                    +  R V+ ++T K +R  L   V  G+G  AF
Sbjct: 427 NGGTLYKPHVTKAWINPQTGETVQQVEPEAVRKVISEDTSKQVREALESVVALGTGGNAF 486

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           + G+ VGGKTGTAQKVI  RYS   +  SF+   P   P+ ++   +D+P+  +      
Sbjct: 487 IDGYRVGGKTGTAQKVINGRYSPNEHIVSFVGFAPADKPEIVIYVAVDNPQGIQ----FG 542

Query: 572 GINVAPMVGNIIRRSASMLGVKPV 595
           G+  AP+V NI+  + ++L V P 
Sbjct: 543 GVVAAPIVRNIMEDALTILQVPPR 566


>gi|84625266|ref|YP_452638.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188575292|ref|YP_001912221.1| peptidoglycan synthetase FtsI [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|84369206|dbj|BAE70364.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519744|gb|ACD57689.1| peptidoglycan synthetase FtsI [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 622

 Score =  383 bits (983), Expect = e-104,   Method: Composition-based stats.
 Identities = 153/560 (27%), Positives = 258/560 (46%), Gaps = 35/560 (6%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSR 116
           R R      + R+ +  +   +  + L  R     ++       +  A  +       SR
Sbjct: 7   RTRSNFNL-RGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELPIATSR 65

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TK 174
             I DRNGE LA   P  S++V P +++   + I +L   L     + +  KL+ +   +
Sbjct: 66  GMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKAGKE 124

Query: 175 FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF 234
           F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E  
Sbjct: 125 FMYLQRRINPDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELA 184

Query: 235 LDMQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKK 278
            D       G  +V    +G            +  + + L++D RIQ + ++EL     +
Sbjct: 185 FDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVE 244

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
            NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+
Sbjct: 245 NNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTV 304

Query: 339 AMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  + +G+ T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +
Sbjct: 305 ATALTAGVVTKDTVIDTNPGYMSVGRFTIRDVPHNNGVLNVTGVITRSSNIGAAKIAAKV 364

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
             Q   + +   G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A
Sbjct: 365 PDQTFYQSIRNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQA 424

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGF 515
            A L N G+L PPTF+     E    +R V+     + +  ++   VT G  + A + G+
Sbjct: 425 YATLGNGGKLTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAKGAAILGY 480

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
            V GKTGTA+K     Y        F  + P T P++  +  ++ P+ K       G+  
Sbjct: 481 HVAGKTGTARKNGASGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVS 537

Query: 576 APMVGNIIRRSASMLGVKPV 595
           AP+   ++  +  ++ V P 
Sbjct: 538 APVFHKVMEGALRLMDVPPD 557


>gi|95930737|ref|ZP_01313470.1| Peptidoglycan glycosyltransferase [Desulfuromonas acetoxidans DSM
           684]
 gi|95133217|gb|EAT14883.1| Peptidoglycan glycosyltransferase [Desulfuromonas acetoxidans DSM
           684]
          Length = 700

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 162/584 (27%), Positives = 260/584 (44%), Gaps = 60/584 (10%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-----HPEPIAPSMNIDEYGMSRPDI 119
           +     + RI +     + ++ +L  R                 +           R  I
Sbjct: 22  QEAKAVRRRILLVGGCFVAVFFMLLGRAFYLQVWTAEQWQKRASSQHTKTISLTPQRGAI 81

Query: 120 IDRNGEILATDIPTFSLYVEPHKVI--------------SPDEI-------IEKLQIVLP 158
            DRNGE LA  +   S+YV P +                  DE         +KL  +L 
Sbjct: 82  YDRNGEPLAISLEADSVYVNPTETTKLFKEQRQRLAENPDSDETPYSYDVIAKKLAEILA 141

Query: 159 NLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVV 218
            L   +IR KL  + KF W++R++S ++ + +    LPG+    E  R YP    A  V+
Sbjct: 142 -LKPAVIRGKLERDKKFIWIKRRISARESQLLDEVSLPGIHTIKEHVRSYPQGRVAGQVL 200

Query: 219 GYVDIDNRGITGIEKFLDM----QGLTRVFTTNKGEK------------NLQPIRLALDL 262
           G+   DN G+ GIE+  +      G       + G +              + + L +D 
Sbjct: 201 GFSGTDNEGLEGIERRYNGLVAGDGSYLTVQADGGRRGIGSGQQVFKGRQGKDLYLTIDT 260

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           ++Q IV +EL    K+ NA +   ++++  +GE+++M S+PDYDP+     +     NR+
Sbjct: 261 QLQFIVEKELQAAVKEANARAGSAIMMDPHSGEILAMSSVPDYDPNHFRHSRPAARRNRV 320

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIF 382
               FE GS FK+F +A  +D+G  + KD+ D           +   H     LT+ ++ 
Sbjct: 321 VCDTFEPGSTFKLFLLASALDTGTISTKDVIDCGPGAYRVGGKVIHDHRAMGHLTVSDVL 380

Query: 383 RYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTIS 440
           +YSSNIG A+IA  +G +   ++L   G   +   +     +     P +W  I    IS
Sbjct: 381 KYSSNIGCAKIAQRLGKETFYDYLRSFGFGERTGIDFDGEGSGILRSPQRWFEIDLAAIS 440

Query: 441 FGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSRE--------ESEKVSRIVLKKNTVK 492
           FG G++ T LQ   AA+A++N G L+ P  + R R+        +   V R V+ ++   
Sbjct: 441 FGQGVTATALQLVTAASAIVNGGELMHPYLVRRIRDARNDISEEQKPTVVRRVIGRDVAL 500

Query: 493 TMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTD 549
            MR+++     + G+G RA VPGFEVGGKTGTAQKV      YS     +SF+   P  +
Sbjct: 501 AMRNMMITVTDSDGTGSRAQVPGFEVGGKTGTAQKVDPVTGTYSVDKRVSSFIGFAPARN 560

Query: 550 PQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
           PQ +VL  +D P      +   G+  AP+   I+ +S   L V 
Sbjct: 561 PQIVVLVALDEP----EGKAYGGLLAAPVFSRIVEQSMQYLHVP 600


>gi|28897228|ref|NP_796833.1| penicillin-binding protein 3 [Vibrio parahaemolyticus RIMD 2210633]
 gi|153839042|ref|ZP_01991709.1| peptidoglycan synthetase FtsI [Vibrio parahaemolyticus AQ3810]
 gi|260366062|ref|ZP_05778528.1| penicillin-binding protein [Vibrio parahaemolyticus K5030]
 gi|260878317|ref|ZP_05890672.1| peptidoglycan glycosyltransferase FtsI [Vibrio parahaemolyticus
           AN-5034]
 gi|260896406|ref|ZP_05904902.1| peptidoglycan glycosyltransferase FtsI [Vibrio parahaemolyticus
           Peru-466]
 gi|28805437|dbj|BAC58717.1| penicillin-binding protein 3 [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747470|gb|EDM58418.1| peptidoglycan synthetase FtsI [Vibrio parahaemolyticus AQ3810]
 gi|308087552|gb|EFO37247.1| peptidoglycan glycosyltransferase FtsI [Vibrio parahaemolyticus
           Peru-466]
 gi|308093163|gb|EFO42858.1| peptidoglycan glycosyltransferase FtsI [Vibrio parahaemolyticus
           AN-5034]
 gi|308111364|gb|EFO48904.1| penicillin-binding protein [Vibrio parahaemolyticus K5030]
          Length = 597

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 144/557 (25%), Positives = 250/557 (44%), Gaps = 36/557 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +      + +L  R+     I P     +    S+ +     +R  I DRNGE
Sbjct: 45  RWRFHLLLFFVFCAFALLVARVAYIQIIEPDNLIKQGDLRSIRVKSIPSARGIISDRNGE 104

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEK-----LQIVLPNLDSEMIRR-KLSSETKFQWLR 179
            LA  +P  +++ +P  +   + + +K     L  VL      +I + K + + +F +L+
Sbjct: 105 PLAVSVPVEAVWADPATIFKENALSQKQNWYALADVLGVDRQGLIDKIKRNEKRRFIYLQ 164

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-- 237
           R++SP     I    LPG+G + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 165 RQVSPAMANYIRELKLPGIGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEWL 224

Query: 238 ---QGLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
              +G   +     G           +  + ++L +D R+Q I ++ + +    + A S 
Sbjct: 225 TGEEGKKTIRKDRYGRVVENIAWQDKQEGKSLQLTIDQRLQAIAYRAIKQAVADHRATSG 284

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TG V++MV+ P Y+P+     +     NR+     E GS  K F I   +++
Sbjct: 285 SVVMLDVKTGAVLAMVNAPSYNPNNRTDWQSYKMRNRVITDSMEPGSTIKPFVILAALEN 344

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G+     + DT N +                 ++  I + SSNIG  ++A  M ++    
Sbjct: 345 GVADKDTIVDTGNGVLRLGGSRVRDVSWVGKASLSMILKKSSNIGVTKLAMQMPVEALLG 404

Query: 405 FLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +G        L       +P  ++W  I   TI+FG+GLS TP+Q A A A L N 
Sbjct: 405 LYSSVGFGELSGLNLVGEVTGIFPTRTRWSPIERATIAFGYGLSITPIQLAHAYATLGNL 464

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G+  P   +  +  +   +SR V+ K   + +  +L      GGS RRA VPG+ VG KT
Sbjct: 465 GKYEPIHIIESNDRD---MSRQVVSKENARLVLDMLETVTQKGGSARRAAVPGYRVGAKT 521

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT++K     YSD         + P +DP+  ++  ++ P+  +      G   +P+   
Sbjct: 522 GTSRKASAGGYSDE-YITYTAGLAPVSDPRIALVVIVNEPQGDD---YYGGSVASPVFSE 577

Query: 582 IIRRSASMLGVKPVFLK 598
           I++ +  +L V P   K
Sbjct: 578 IMKGALQILNVAPDENK 594


>gi|312128121|ref|YP_003992995.1| stage v sporulation protein d [Caldicellulosiruptor hydrothermalis
           108]
 gi|311778140|gb|ADQ07626.1| stage V sporulation protein D [Caldicellulosiruptor hydrothermalis
           108]
          Length = 719

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 130/589 (22%), Positives = 247/589 (41%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + +  + +++L  R+     I  E +                 R  
Sbjct: 2   KEASIKIKKRILFVMAIFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QMDYQKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +  ++  +I  + LPG+       R YP  +  + V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKEKADKIRKYALPGIYLTGGTKRVYPNGNFLAQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPIDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP++ F+   +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNKPFELIYKDKFPDFDKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+      F  R  +KV   ++  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGVVNENSQFYCRGYVKVANAILKCWRYYNPHGSENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP               +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIIQPLNRVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV--------SRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K+         R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAVANDGVWVQPHVVKAIYDKDKKLIKSFDTPRKRRVLDQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + ++++L+  V+ G+G  A++ G++V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLKTILQSVVSNGTGHNAYLLGYKVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|260899189|ref|ZP_05907584.1| peptidoglycan glycosyltransferase FtsI [Vibrio parahaemolyticus
           AQ4037]
 gi|308107134|gb|EFO44674.1| peptidoglycan glycosyltransferase FtsI [Vibrio parahaemolyticus
           AQ4037]
 gi|328471993|gb|EGF42870.1| penicillin-binding protein 3 [Vibrio parahaemolyticus 10329]
          Length = 597

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 144/557 (25%), Positives = 250/557 (44%), Gaps = 36/557 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +      + +L  R+     I P     +    S+ +     +R  I DRNGE
Sbjct: 45  RWRFHLLLFFVFCAFALLVARVAYIQIIEPDNLIKQGDLRSIRVKSIPSARGIISDRNGE 104

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEK-----LQIVLPNLDSEMIRR-KLSSETKFQWLR 179
            LA  +P  +++ +P  +   + + +K     L  VL      +I + K + + +F +L+
Sbjct: 105 PLAVSVPVEAVWADPATIFKENALSQKQNWYALADVLGVDRQGLIDKIKRNEKRRFIYLQ 164

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-- 237
           R++SP     I    LPG+G + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 165 RQVSPAMANYIRELKLPGIGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEWL 224

Query: 238 ---QGLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
              +G   +     G           +  + ++L +D R+Q I ++ + +    + A S 
Sbjct: 225 TGEEGKKTIRKDRYGRVVENIAWQDKQEGKSLQLTIDQRLQAIAYRAIKQAVADHRATSG 284

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TG V++MV+ P Y+P+     +     NR+     E GS  K F I   +++
Sbjct: 285 SVVMLDVKTGAVLAMVNAPSYNPNNRTDWQSYKMRNRVITDSMEPGSTIKPFVILAALEN 344

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G+     + DT N +                 ++  I + SSNIG  ++A  M ++    
Sbjct: 345 GVADKDTIVDTGNGVLRLGGSRVRDVSWVGKASLSMILKKSSNIGVTKLAMQMPVEALLG 404

Query: 405 FLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +G        L       +P  ++W  I   TI+FG+GLS TP+Q A A A L N 
Sbjct: 405 LYSSVGFGELSGLNLVGEVTGIFPTRTRWSPIERATIAFGYGLSITPIQLAHAYATLGNL 464

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G+  P   +  +  +   +SR V+ K   + +  +L      GGS RRA VPG+ VG KT
Sbjct: 465 GKYEPIHIIESNDRD---MSRQVVSKENARLVLDMLETVTQKGGSARRAAVPGYRVGAKT 521

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT++K     YSD         + P +DP+  ++  ++ P+  +      G   +P+   
Sbjct: 522 GTSRKASAGGYSDE-YITYTAGLAPVSDPRIALVVIVNEPQGDD---YYGGSVASPVFSE 577

Query: 582 IIRRSASMLGVKPVFLK 598
           I++ +  +L V P   K
Sbjct: 578 IMKGALQILNVAPDENK 594


>gi|254491293|ref|ZP_05104473.1| penicillin-binding protein dimerization domain family [Methylophaga
           thiooxidans DMS010]
 gi|224463422|gb|EEF79691.1| penicillin-binding protein dimerization domain family [Methylophaga
           thiooxydans DMS010]
          Length = 568

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 135/549 (24%), Positives = 255/549 (46%), Gaps = 33/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R+ +  ++ ++I + L  R+      +P     +  A  +        R  I+D  GE L
Sbjct: 15  RLNLVRLMFILIVLGLGWRLADLQIFNPDFLRYQGDARHLRQVPVVAHRGMILDSQGEPL 74

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQ 185
           A   P  S+++ P  V   +  +  L ++L   +   I+ ++  +   +F +L+R+++P+
Sbjct: 75  AISTPVHSVWLNPQDVALDEPKLPSLAVMLGQ-NIREIQERIATNQSREFVYLKRRVTPE 133

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
              ++    + GV  + E  R+YPA   ASH+VG+ +ID+ G  G+E   D       GL
Sbjct: 134 LADQVKQLNIRGVALQREYKRYYPAGEVASHIVGFTNIDDIGQEGLELTYDAVLTGRSGL 193

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            R+   ++G            K  + I+L++DLR+Q + +Q L     ++NA++   V++
Sbjct: 194 KRMVRDSRGNYVEGGELIRPAKAGENIQLSMDLRLQYLTYQALKNAVTEHNAKAGTAVVI 253

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           ++ +GEV++M + P ++P+     +   + NR    +FE GS  K FT+  GI SG + +
Sbjct: 254 DIHSGEVLAMANQPSFNPNNRHGLRASDFRNRAVTDLFEPGSTVKPFTVTSGIKSGKYDL 313

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             + +T   +          +     + +  + + SSNI A++IA  +          R 
Sbjct: 314 NTIINTHPGVFRVSGHSIRDYRDYGEIDLATLIQKSSNIAASKIALDLDPDELWHDFARF 373

Query: 410 GLLSKLETELPEIQAPSYPSQWKRIHS--LTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL        P     + P           T+ +G+GLST+ LQ A A + L + G L P
Sbjct: 374 GLGDATGAYFPGEAMGTMPDLSSWRKLDIATMGYGYGLSTSALQLARAYSVLGSGGILKP 433

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            TF+     +     R V   + +  + +++ + V  GG+G RA V  + V GK+GTA+K
Sbjct: 434 VTFVK---TDETPKGRRVFSADIMSQVITMMEKVVEPGGTGTRASVANYRVAGKSGTAKK 490

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            I   Y+D    + F  + P + P+  ++  +D P+ +   +   G   AP+   ++  +
Sbjct: 491 AISGGYADDRYQSVFAGLIPASSPRLAMVVMVDEPRGE---EYYGGAVAAPVFAEVMTGA 547

Query: 587 ASMLGVKPV 595
             +L + P 
Sbjct: 548 MRLLNIAPD 556


>gi|154685936|ref|YP_001421097.1| SpoVD [Bacillus amyloliquefaciens FZB42]
 gi|154351787|gb|ABS73866.1| SpoVD [Bacillus amyloliquefaciens FZB42]
          Length = 639

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 154/566 (27%), Positives = 257/566 (45%), Gaps = 43/566 (7%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+ + ++  ++I++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLLVLLFGVIIFLIIDSRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---R 180
           G  LAT+    +++V P ++ +P +  + L  VL N+  E + + ++ +T  + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQIQNPIKTGKLLASVL-NMSEEKVYKHITKKTSIEKISPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM--- 237
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+ + G+E + D    
Sbjct: 126 KISNKKAKEIKALDLKGVYVAEDSIRHYPYGSFLSHVLGFAGIDNQVLLGLEAYYDDDLK 185

Query: 238 --QGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL     KYN + 
Sbjct: 186 GVKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTIDAKVQTIIERELDNAAAKYNPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GEV+ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEVLGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLF--TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
                       +D       G  +       +   +  E+ + S N G  Q+ + +G Q
Sbjct: 306 QEQKVNLQRDHFYDKGFAEVDGARLRCWKKGGHGSQSYLEVVQNSCNPGFVQLGERLGKQ 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFQYIKDFGFGKKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            IN G L  P       +         +S    R V+ + T K +R  L   V  G+GR 
Sbjct: 426 AINGGTLYTPFIAKEWVDPVTKKTVKKQSPIAKRQVISQETSKQIRYALESVVAQGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK   +   
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTIQ--- 542

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPV 595
             G   AP+VGN++R S   LGVKP 
Sbjct: 543 FGGTVAAPIVGNMMRDSLPELGVKPR 568


>gi|94501902|ref|ZP_01308412.1| penicillin-binding protein 2 [Oceanobacter sp. RED65]
 gi|94425955|gb|EAT10953.1| penicillin-binding protein 2 [Oceanobacter sp. RED65]
          Length = 579

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 149/553 (26%), Positives = 258/553 (46%), Gaps = 39/553 (7%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + + L+++++LA R++Q        +  E    ++        R  I+DRN E L
Sbjct: 17  RHYLVMTLGLLLFVVLAGRLVQLQTFEQDFLQSEGEKRTVRDQLIHAYRGMIVDRNNEPL 76

Query: 128 ATDIPTFSLYVEPHKV----ISPDEIIEKLQIVLPNLDSEMIRRK--LSSETKFQWLRRK 181
           A   P  S+++ P +        +  + +L   L       ++ +  L+ + +F +L R+
Sbjct: 77  AVSTPVKSIWINPKQFLQDSKDIEGDLRQLAFHLSQ-SFWQLKNRVLLNKQKEFMYLERQ 135

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD----- 236
            +P   K I +  LPGVG + E  RFYPA   ASHVVG+ +ID  GI G+E   +     
Sbjct: 136 QTPLLAKAIQALELPGVGVQQEFKRFYPAGEVASHVVGFTNIDESGIEGVELAFNDYLEG 195

Query: 237 MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
             G+ R+     G            +  + + L+LDLR+Q   ++EL  +  ++ A++  
Sbjct: 196 TPGVGRIVKDRLGRLVKDLGVVEPAQAGKELVLSLDLRLQYQAYRELKASVTQHGAKAGS 255

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            ++++V TGE++++V+ P ++P+   +   +   NR++  IFE GS  K FT+A  + +G
Sbjct: 256 LIMVDVKTGEILALVNQPAFNPNNRVELVADSVRNRVATDIFEPGSTVKPFTVAAALSNG 315

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           +   + + +T       K      H     L I  I   SSNIG +++A  MG     +F
Sbjct: 316 IVQTESIVNTHPGFMRLKGKTIRDHRDYGRLDITGILTKSSNIGVSKLALEMGGNALWQF 375

Query: 406 LYRLGLLSKLETELPEIQAP---SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
              LGL   +   LP  Q        + W  + + T+SFG+GL+ TPLQ A A   L N 
Sbjct: 376 YQSLGLGQPVGLGLPGEQGGKISIRGAHWDNLQTATMSFGYGLAVTPLQLAQAYQVLANG 435

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKT 521
           G  +P T +     +++     ++       + ++L   V   G+ RRA V G+ V GKT
Sbjct: 436 GIKMPLTLVK----QNKVRGERIISNKVANDVVAMLETVVGPKGTARRARVDGYRVAGKT 491

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT  KV  + Y D    + F  + P  +P+   +  +D P      +   G   AP+   
Sbjct: 492 GTVHKVGAQGYKDESYLSLFAGIAPADNPRIATIIVVDEP---AGREYYGGEVAAPVFSR 548

Query: 582 IIRRSASMLGVKP 594
           + + S  +L + P
Sbjct: 549 VAQASLRLLNIAP 561


>gi|78046381|ref|YP_362556.1| cell division protein FtsI [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78034811|emb|CAJ22456.1| cell division protein FtsI [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 622

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/551 (27%), Positives = 253/551 (45%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R              +  A  +       SR  I DRNGE
Sbjct: 15  RGRLTLVGIALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKAGKEFMYLQRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 194 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGSMV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q     +
Sbjct: 314 TKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYHSI 373

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|27381719|ref|NP_773248.1| penicillin binding protein 2 [Bradyrhizobium japonicum USDA 110]
 gi|27354888|dbj|BAC51873.1| penicillin binding protein 2 [Bradyrhizobium japonicum USDA 110]
          Length = 580

 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 217/543 (39%), Positives = 332/543 (61%), Gaps = 4/543 (0%)

Query: 58  LFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMS-R 116
           L   R     A ++ R+G+ ++    +Y ++  R++ +        A      E   + R
Sbjct: 21  LLYGRNVDRAAKARARVGLAMLAFASVYALIGGRLVMFAIGADAHSARRAAAQEVVATAR 80

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
           PDI+DRNG ILATD+   SL+ EP ++I  DE IE L   +P+LD   +R +L +   F 
Sbjct: 81  PDIVDRNGAILATDVKAASLFGEPRRIIDKDEAIELLTATVPDLDEAEVRERLKTRKGFV 140

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           WL+R+++P+QQ+ I   G+PG+GF  E  R YP  +  +H++G V+IDN+GI G+EK+LD
Sbjct: 141 WLKREITPKQQQDIHKLGIPGIGFLRENKRVYPTGNEVAHLIGLVNIDNQGIAGMEKWLD 200

Query: 237 MQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
            QGL  +       ++  +PI L++DLR+++ +  EL++ K+KY+ ++   ++ NV TGE
Sbjct: 201 NQGLADLHRAGFATDRLQKPIELSVDLRVEHALRDELLKAKEKYHTKAASGIVSNVKTGE 260

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +++MVS+PD+DP+   +       NR++ G++EMGS FK FT+AM +DSG   +   +D 
Sbjct: 261 IVAMVSLPDFDPNNPKEAHDPDRINRLTTGVYEMGSTFKAFTLAMALDSGKINLNSSWDA 320

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
           R  +  GK  IHD HP  R +   E+F +SSNIGAA+IA   G++ HK FL ++G L++L
Sbjct: 321 RGNLHYGKFTIHDSHPLGRFINTKEVFTFSSNIGAARIALGQGVEAHKAFLAKMGQLTRL 380

Query: 416 ETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSR 475
            TELPE  AP  P +W  ++++T +FG GLS  PLQ  +   AL+N G LIPPTFM RS 
Sbjct: 381 RTELPESAAPLIPRRWSELNTVTAAFGQGLSVAPLQAVMGINALVNGGYLIPPTFMKRSE 440

Query: 476 EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDT 535
            E+  +++ V+K++T   MR L+R     G+ + A V G+ VGGKTGT++KVI  RY+  
Sbjct: 441 AEAAALAKRVVKQDTSDKMRFLMRLNAEIGTAKTADVKGYYVGGKTGTSEKVINGRYAKK 500

Query: 536 LNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVK 593
              NSF A+ P  DP+Y +L  +D P+     +   T+G N  P  G +I R A +LGV+
Sbjct: 501 RVLNSFTAIMPCDDPKYQILIMLDEPQAIPETKGFITSGWNAVPTGGRVIERIAPLLGVE 560

Query: 594 PVF 596
           P F
Sbjct: 561 PRF 563


>gi|325925692|ref|ZP_08187070.1| peptidoglycan synthetase FtsI [Xanthomonas perforans 91-118]
 gi|325543908|gb|EGD15313.1| peptidoglycan synthetase FtsI [Xanthomonas perforans 91-118]
          Length = 622

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 151/551 (27%), Positives = 254/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R              +  A  +       SR  I DRNGE
Sbjct: 15  RGRLTLVGIALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKAGKEFMYLQRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 194 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGSMV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q   + +
Sbjct: 314 TKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYQSI 373

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|221322912|ref|ZP_03604206.1| penicillin-binding protein [Bacillus subtilis subsp. subtilis str.
           SMY]
          Length = 645

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/569 (26%), Positives = 258/569 (45%), Gaps = 50/569 (8%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P +  ++L  VL N+  E + + ++ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVL-NMSEEKVYKHVTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KY+ + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE++ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK       
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTI---- 541

Query: 570 TAGINV---APMVGNIIRRSASMLGVKPV 595
                     P+VGNI+R S   LGVKP 
Sbjct: 542 ---SLAERWQPIVGNIMRDSLPELGVKPR 567


>gi|221309389|ref|ZP_03591236.1| penicillin-binding protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221318638|ref|ZP_03599932.1| penicillin-binding protein [Bacillus subtilis subsp. subtilis str.
           JH642]
          Length = 645

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/569 (26%), Positives = 258/569 (45%), Gaps = 50/569 (8%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P +  ++L  VL N+  E + + ++ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVL-NMSEEKVYKHVTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KY+ + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE++ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK       
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGTF---- 541

Query: 570 TAGINV---APMVGNIIRRSASMLGVKPV 595
                     P+VGNI+R S   LGVKP 
Sbjct: 542 ---SLAERWQPIVGNIMRDSLPELGVKPR 567


>gi|319782842|ref|YP_004142318.1| peptidoglycan glycosyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168730|gb|ADV12268.1| Peptidoglycan glycosyltransferase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 569

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 258/547 (47%), Positives = 370/547 (67%), Gaps = 4/547 (0%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEY 112
           EDG  + +  R+      + RI MT+ V   I+  ++ R++  G   P+      +    
Sbjct: 14  EDGSIVVEGARKATGGKGRTRIVMTMAVFFGIFSTISGRLVYLGFQTPDMSGGPQSRVT- 72

Query: 113 GMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE 172
             SRPDI+DRNGE+LATDI T SL+ EP +++  DE IEKL  VLP++D E    KL S 
Sbjct: 73  -ASRPDIVDRNGEVLATDIKTASLFAEPRRIVDADEAIEKLSTVLPDIDYEQTYHKLKSG 131

Query: 173 TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
             F WL+R+L+P+QQ  I+  G+PG GFR EK RFYP+   +S++VG  +IDN+GI+G+E
Sbjct: 132 AGFVWLQRQLTPKQQSDIMQLGIPGFGFRTEKRRFYPSGETSSYIVGLTNIDNQGISGME 191

Query: 233 KFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           K++D QGL+ +  +     K+L+P++L++DLR+Q++V  E+    ++Y A   G V+LNV
Sbjct: 192 KYVDEQGLSDLQASGLAIAKDLKPVKLSIDLRVQHVVRDEIAAGLERYRAMGTGAVVLNV 251

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV++M S+PD+DP+  +  + +   NR+S G++EMGS FK FT AM +DSG  T+  
Sbjct: 252 KTGEVVAMASVPDFDPNNPYNAQDKDRLNRMSAGLYEMGSTFKSFTSAMALDSGKATMAS 311

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
            FD  +PI+VG   IHD+H +NR+L++PE+F YSSNIG+A+ A+ +GI+GH+EFL+RLG+
Sbjct: 312 RFDASHPIRVGHQAIHDFHGKNRVLSLPEVFLYSSNIGSAREAEMVGIEGHREFLHRLGI 371

Query: 412 LSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFM 471
           L +++TELPE   P+ P  WK+++S TI+FGHG+STTPLQ AV  AAL+N G L+ PTF+
Sbjct: 372 LDRMQTELPETARPTEPKVWKQVNSFTIAFGHGVSTTPLQAAVGCAALMNGGFLMNPTFL 431

Query: 472 IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKR 531
           +R++ E+   ++ V+ + TV+ MR L       GS R A VPG+ VGGKTGTA+KVI  R
Sbjct: 432 VRTQAEAMATAKRVVSEKTVEGMRYLYSLNAEKGSARNARVPGYRVGGKTGTAEKVINGR 491

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIRRSASML 590
           YS  LNFN+F+A FP  DPQY+V +  D+P  ++      A  N   M GNIIRRSA+ML
Sbjct: 492 YSKDLNFNTFVAAFPMDDPQYLVFTIADAPHPEKPGMTDVAAANAGVMAGNIIRRSAAML 551

Query: 591 GVKPVFL 597
           GVKP F 
Sbjct: 552 GVKPDFS 558


>gi|71275127|ref|ZP_00651414.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Dixon]
 gi|71900700|ref|ZP_00682823.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
 gi|170731116|ref|YP_001776549.1| peptidoglycan glycosyltransferase [Xylella fastidiosa M12]
 gi|71163936|gb|EAO13651.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Dixon]
 gi|71729521|gb|EAO31629.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
 gi|167965909|gb|ACA12919.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa M12]
          Length = 613

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 146/551 (26%), Positives = 254/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMT-----IVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +      +    +I     +++I       +  A  +       SR  I DRNGE
Sbjct: 15  RGRLLLVGTALGLCSMTLIASAAYVQLINSDFYQRQAQARYLRELPIPTSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLS 183
            LA   P  S++  P +++   + I KL  VL ++  + +R +L   ++ +F +L+R+++
Sbjct: 75  PLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMDELRTRLLQKADKEFMYLKRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQ 238
           P     +L   +PGV  + E  RFYP +   +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDVAHYVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEGLELSFDDWLTGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  RV    +G            +  + + L +D RIQ + ++EL     +  A     V
Sbjct: 194 GSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRNAIVENQAAGGSIV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+ GE+++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMKPLTVATALQAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + +G+  I D    N +L +  +   SSNIGAA+I   +  +   E +
Sbjct: 314 TPDTVIDTNPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIVAKVPDKTFYELV 373

Query: 407 YRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  +   +  P   +   P    W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 QGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L+PPTF+     E+    R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LVPPTFVKGHHAEA----RQVVDAKVAQQVIGMMETVVTRGGAKAAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKTGANGYESGHYNALFAGLVPATRPRFATVIVINDPQGK---AYYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|580936|emb|CAA81085.1| SpoVD [Bacillus subtilis subsp. subtilis str. 168]
          Length = 645

 Score =  382 bits (981), Expect = e-104,   Method: Composition-based stats.
 Identities = 148/569 (26%), Positives = 258/569 (45%), Gaps = 50/569 (8%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRN 123
             + R+   ++  +++++I+  R+     +  E               +   R +I+DRN
Sbjct: 7   TVRKRLLFVLLFGVIVFLIIDTRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERGEILDRN 66

Query: 124 GEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RR 180
           G  LAT+    +++V P +V +P +  ++L  VL N+  E + + ++ +   + +    R
Sbjct: 67  GVKLATNKSAPTVFVVPRQVQNPMKTSKQLAAVL-NMSEEKVYKHVTKKASIEKITPEGR 125

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD---- 236
           K+S ++ K I +  L GV    +  R YP  S  SHV+G+  IDN+G+ G+E + D    
Sbjct: 126 KISNEKAKEIKALDLKGVYVAEDSIRHYPFGSFLSHVLGFAGIDNQGLLGLEAYYDDDLK 185

Query: 237 -MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
             +G  + +T  KG             K+   ++L +D ++Q I+ +EL   + KY+ + 
Sbjct: 186 GEKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTVDSKVQTIMERELDNAEAKYHPDG 245

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGI 342
           +  V +N   GE++ M S PD+DP +        +  N   +  +E GS FK+ T+A  +
Sbjct: 246 MIAVAMNPKNGEILGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIITLAAAL 305

Query: 343 DSGLFT--VKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
           +           +D  +    G  +       + + T  E+ + S N G  ++ + +G +
Sbjct: 306 EEQKVNLKRDQFYDKGHAEVDGARLRCWKRGGHGLQTYLEVVQNSCNPGFVELGERLGKE 365

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
              +++   G   K   +L            +   +   T +FG G+S TP+Q   A +A
Sbjct: 366 KLFKYIKDFGFGQKTGIDLQGEGTGILFPLERVGPVEQATTAFGQGVSVTPIQQVAAVSA 425

Query: 459 LINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
            +N G L  P       +         +S    + V+ + T K +R  L   V  G+GR 
Sbjct: 426 AVNGGTLYTPYIAKEWIDPVTKKTVKKQSPIAKKQVISEETSKQIRYALESVVAEGTGRN 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           AFV G+ VGGKTGTAQKV   +Y +  +  SF+   P  DP  +V   +D+PK       
Sbjct: 486 AFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGAF---- 541

Query: 570 TAGINV---APMVGNIIRRSASMLGVKPV 595
                     P+VGNI+R S   LGVKP 
Sbjct: 542 ---SLAERWQPIVGNIMRDSLPELGVKPR 567


>gi|150283|gb|AAA25465.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  382 bits (981), Expect = e-103,   Method: Composition-based stats.
 Identities = 155/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+ V
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVV 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKEVMSGSLNILGVSP 568


>gi|21241544|ref|NP_641126.1| penicillin-binding protein 3 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21106895|gb|AAM35662.1| penicillin-binding protein 3 [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 622

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/551 (27%), Positives = 254/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R              +  A  +       SR  I DRNGE
Sbjct: 15  RGRLTLVGIALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDDLNAKLAQKAGKEFMYLQRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 194 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGSMV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q   + +
Sbjct: 314 TKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYQSI 373

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|218708480|ref|YP_002416101.1| peptidoglycan synthetase ftsI precursor [Vibrio splendidus LGP32]
 gi|218321499|emb|CAV17451.1| Peptidoglycan synthetase ftsI precursor [Vibrio splendidus LGP32]
          Length = 585

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/575 (25%), Positives = 250/575 (43%), Gaps = 36/575 (6%)

Query: 53  EDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSM 107
           E  ++  +  +       K R  + I    + +  L  R+     I P     +    S+
Sbjct: 15  ESTKERVKSEKDLDPILIKWRFNVVIAFVFLAFAALVGRVAYIQIIEPDNLIRQGDLRSV 74

Query: 108 NIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDS 162
            +     +R  I DRNGE LA  +P  +++ +P  +   + + +      L  VL     
Sbjct: 75  RVKAIPSARGIISDRNGEPLAVSVPVEAVWADPKTIFDKNGMAQIDRWYALADVLGLQRQ 134

Query: 163 EMIRRK-LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYV 221
            MI +   +   +F +L+R++SP   K I    L GVG + E  R+YPA   ++H++G  
Sbjct: 135 SMIDKISSNKSRRFIYLQRQVSPAMAKYIRELKLVGVGLKAESRRYYPAGEVSAHLIGVT 194

Query: 222 DIDNRGITGIEKFLDMQ-----GLTRVFTTNKG----------EKNLQPIRLALDLRIQN 266
            ID  G+ G+E+  D       G   +     G           +  +P+ L +D R+Q 
Sbjct: 195 GIDGHGLEGVERSYDKWLTGEAGKRTIRKDRYGRVVENIALEEREEGKPLELTIDQRLQA 254

Query: 267 IVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGI 326
           I ++ + +    + A S   V+L+V TG V++MV+ P Y+P+     +     NR+    
Sbjct: 255 IAYRAIKQAVADHKATSGSAVLLDVKTGAVLAMVNAPSYNPNNRSDLQSFKMRNRVLTDA 314

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSS 386
            E GS  K F +   +++G    K + DT N I            +     +  I + SS
Sbjct: 315 MEPGSTVKPFVVLAALENGTADAKSIIDTGNGIMQIGGSRVRDTSKVGKADLALILKKSS 374

Query: 387 NIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHG 444
           NIG A++A  M ++        +GL       L    +  +P+  +W +    T+SFG+G
Sbjct: 375 NIGVAKLALDMPLEALLGMYSSVGLGEMSGLNLVGETSGIFPNRRRWSKFEIATLSFGYG 434

Query: 445 LSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT- 503
           LS TPLQ A A A L N+G   P   +  + ++    S+ ++K+   + +  +L      
Sbjct: 435 LSVTPLQLAHAYATLANKGMYEPIHIIKSNDQD---FSKQIIKRENAEMVLQMLEGVTQK 491

Query: 504 GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI 563
           GG+  RA VPG+ V  KTGT++K     YSD           P +DP+  ++  ++ P+ 
Sbjct: 492 GGTATRAAVPGYRVAAKTGTSRKAAAGGYSDE-YIAITSGFAPVSDPRVALVVVVNEPQG 550

Query: 564 KERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
                   G   AP+   I++ +  +L V     K
Sbjct: 551 DL---YYGGSVAAPVFSEIMKGALQILNVPADENK 582


>gi|312134655|ref|YP_004001993.1| stage v sporulation protein d [Caldicellulosiruptor owensensis OL]
 gi|311774706|gb|ADQ04193.1| stage V sporulation protein D [Caldicellulosiruptor owensensis OL]
          Length = 720

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 137/589 (23%), Positives = 246/589 (41%), Gaps = 62/589 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPD 118
           ++     K RI   + V  + +++L  R+     I  E +                 R  
Sbjct: 2   KETSLRIKKRILFVMAVFFLSFVLLVGRLFYLQLIKGEELKKRAFSQWTRERLVAPKRGS 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I+DRNG+ILA  I   ++    +++   +   + L  +L  +D + I  KL+++     +
Sbjct: 62  IVDRNGKILAMSITAETVVASLNQIKDKEWTAKVLSGIL-QMDYQKILNKLNTKGVSDIY 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           + R +   +  +I  + LPG+       R YP  +  S V+G+  ID++G++G+E + D 
Sbjct: 121 IARNIDKDKADKIRKYALPGIYLTGGTKRVYPNGNFLSQVLGFTGIDDQGLSGLELYYDK 180

Query: 237 ----MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                 G     T   G              +   + L +D  IQ+   +   +      
Sbjct: 181 YLRGKPGAISAQTDASGRAAPFSEEFFKKPVDGYDLMLTIDETIQHFAEKYAQKALYDNK 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------WFN 320
           A+SV  ++  V TGE+++M S PD+DP++ F+   +                     W N
Sbjct: 241 AKSVTIIVEKVKTGEILAMTSKPDFDPNKPFELIYKDRFTDFDKLSQAEKNKIVQSMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
           R     +E GS FK+ T A G++ G+   K  F  R  +KV   VI  +     +     
Sbjct: 301 RALTDTYEPGSTFKIVTAAAGLEEGIVNEKSQFYCRGYVKVANAVIKCWRYYNPHGSENF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHS 436
            E  + S N    ++   +G +   +++   G   K   +LP           +   +  
Sbjct: 361 VEGVQNSCNPVFIEVGQRLGKEKLYKYINLFGFGQKTGIDLPGEAKGIVQPVEKVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK--------VSRIVLKK 488
            TISFG G+S TP+Q      A+ N+G  + P  +    ++ +K          R VL +
Sbjct: 421 ATISFGQGISATPIQVISMINAIANDGVWVQPHVVKAIYDKDKKLIKSFDAPKKRRVLYQ 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
           +  + +R++L+  VT G+G  A++ G+ V GKTGT+QK  K   +      SF    P  
Sbjct: 481 DVARRLRNILQSVVTNGTGHNAYLLGYRVAGKTGTSQKYDK---TSKKYIASFGGFAPAD 537

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +P+  VL  +D P          G+  AP+  +++      L ++P + 
Sbjct: 538 NPEVSVLVIIDEPDPSL---YYGGLIAAPVARDLLNDILRYLDIQPQYT 583


>gi|28199740|ref|NP_780054.1| penicillin-binding protein 3 [Xylella fastidiosa Temecula1]
 gi|182682487|ref|YP_001830647.1| peptidoglycan glycosyltransferase [Xylella fastidiosa M23]
 gi|28057861|gb|AAO29703.1| penicillin-binding protein 3 [Xylella fastidiosa Temecula1]
 gi|182632597|gb|ACB93373.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa M23]
 gi|307578767|gb|ADN62736.1| peptidoglycan glycosyltransferase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 613

 Score =  382 bits (980), Expect = e-103,   Method: Composition-based stats.
 Identities = 149/564 (26%), Positives = 257/564 (45%), Gaps = 38/564 (6%)

Query: 62  RRRKVIAHS----KNRIGMT-----IVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEY 112
           + R     S    + R+ +      +    +I     +++I       +  A  +     
Sbjct: 2   KNRNNRFRSHFNLRGRLLLVGTALGLCSMTLIASAAYVQLINSDFYQRQAQARYLRELPI 61

Query: 113 GMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--S 170
             SR  I DRNGE LA   P  S++  P +++   + I KL  VL ++  E +R +L   
Sbjct: 62  PTSRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMEELRTRLLQK 120

Query: 171 SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITG 230
           ++ +F +L+R+++P     +L   +PGV  + E  RFYP +   +HV+G+ +ID+RG  G
Sbjct: 121 ADKEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEG 180

Query: 231 IEKFLD-----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVE 274
           +E   D       G  RV    +G            +  + + L +D RIQ + ++EL  
Sbjct: 181 LELSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRN 240

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
              +  A     V+++V+ GE+++MV++P Y+P+           NR    + E GS  K
Sbjct: 241 AIIENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMK 300

Query: 335 VFTIAMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
             T+A  + +G+ T   + D     + +G+  I D    N +L +  +   SSNIGAA+I
Sbjct: 301 PLTVATALQAGVVTPDTVIDTNPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKI 360

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQ 451
              +  +   E +   G  +   +  P   +   P    W      T+S+G+GLS TPLQ
Sbjct: 361 VAKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQ 420

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
            A A A L N G+L+PPTF+     E+    R V+     + +  ++   VT G  + A 
Sbjct: 421 IAQAYATLGNGGKLVPPTFVKGHHAEA----RQVVDAKVAQQVIGMMETVVTRGGAKAAA 476

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           + G+ V GKTGTA+K     Y        F  + P T P++  +  ++ P+ K       
Sbjct: 477 ILGYHVAGKTGTARKTGANGYESGHYNALFAGLVPATRPRFATVIVINDPQGK---AYYG 533

Query: 572 GINVAPMVGNIIRRSASMLGVKPV 595
           G+  AP+   ++  +  ++ V P 
Sbjct: 534 GLVSAPVFHRVMEGALRLMDVPPD 557


>gi|84501748|ref|ZP_00999920.1| penicillin-binding protein [Oceanicola batsensis HTCC2597]
 gi|84390369|gb|EAQ02928.1| penicillin-binding protein [Oceanicola batsensis HTCC2597]
          Length = 597

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 168/565 (29%), Positives = 288/565 (50%), Gaps = 17/565 (3%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
                    E+ +   ++ R +    ++ RI +   V  + ++ + +++       P   
Sbjct: 23  GENPDAIEKENLRLRHEEMRDRARVRAEGRILVLGAVFALAFLTIGVKMWIVAESEPAEP 82

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE 163
             S+        R DI+DR+G +LAT++ T++LY  PH+++ P+   E L  + P+LD  
Sbjct: 83  RTSIAGASIVAQRGDILDRHGRVLATNLDTYALYAHPHQMVEPERAAEALVGIFPDLDLA 142

Query: 164 MIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
            + R  +   +F W+RRK+SP+Q++ +   G PG+ F   + R YP  + ASH++G    
Sbjct: 143 RLTRDFTGNRRFVWIRRKISPEQRQAVHDIGEPGLLFGPREMRLYPNGAIASHILGGAGY 202

Query: 224 DNRGITGIEKFLDMQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
              G+   E      G+ R F           +P+ L+LDL +Q    + L    +  NA
Sbjct: 203 GEEGVHAAEIK-GTAGVERAFDDYLTDPANGGKPLELSLDLTVQAASEKVLYGGMRLMNA 261

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW------FNRISYGIFEMGSIFKV 335
           +   +++++V TGE+ISMVS+PD+DP++      +G       FNR   G++E+GS FK+
Sbjct: 262 KGAASILMDVKTGEIISMVSLPDFDPNDRPNPPTQGHPDDSPLFNRAVQGVYELGSTFKI 321

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           F  A  +D GL T + + D R PI+ G+H I DYH   + L++ +I   SSNIG A++A+
Sbjct: 322 FAAAQALDLGLVTPETVVDIRGPIRWGRHSIRDYHWYGKELSVADIIIKSSNIGTARLAE 381

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTA 453
            +G +  K+FL  LGL      E+ E  +        W  + ++T+SFGHG+S +PL  A
Sbjct: 382 QIGAERQKQFLADLGLFEPTPVEMIEAPSGKPLVQKNWSELTTMTVSFGHGISISPLHLA 441

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            A A + N+G+ + PT + +S  +       V+ K   +  + +LR  VT G+   A + 
Sbjct: 442 AAYATIANDGQRVRPTLLRQSAPQDGP---QVMSKPAARRAQDMLRRVVTEGTASFARID 498

Query: 514 GFEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLT 570
            + + GKTGTA K      Y       +F ++FP   P+Y+++  +D       +  + T
Sbjct: 499 HYSIAGKTGTADKPKPTGGYYKDRTITTFASMFPAHSPRYVLIVTLDEAVETSGDEPRRT 558

Query: 571 AGINVAPMVGNIIRRSASMLGVKPV 595
           AG    P+   +I R A +LG++P 
Sbjct: 559 AGWTAVPVAAEMITRVAPLLGLRPE 583


>gi|325923947|ref|ZP_08185537.1| peptidoglycan synthetase FtsI [Xanthomonas gardneri ATCC 19865]
 gi|325545573|gb|EGD16837.1| peptidoglycan synthetase FtsI [Xanthomonas gardneri ATCC 19865]
          Length = 622

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 152/561 (27%), Positives = 259/561 (46%), Gaps = 38/561 (6%)

Query: 65  KVIAHS----KNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMS 115
           +  A S    + R+ +  +   +  + L  R     ++       +  A  +       S
Sbjct: 5   RNRARSNFNLRGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELPIATS 64

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--T 173
           R  I DRNGE LA   P  S++V P +++   + I +L   L     + +  KL+ +   
Sbjct: 65  RGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVELKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLDMQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G            +  + + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           +A  + +G+ T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  
Sbjct: 304 VATALTAGVVTKDTIIDTNPGYMAVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAK 363

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAV 454
           +  Q   + +   G  S   +  P   +     P++W      T+S+G+GLS TPLQ A 
Sbjct: 364 VPDQTFYQSIRNFGYGSAPHSGFPGESSGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQ 423

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           A A L N G+L PPTF+     E    +R V+     + +  ++   VT G  + A + G
Sbjct: 424 AYATLGNGGKLTPPTFVRGQHNE----TRQVVTPEVARQVIDMMETVVTQGGAKGAAILG 479

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           + V GKTGTA+K     Y        F  + P T P++  +  ++ P+ K       G+ 
Sbjct: 480 YHVAGKTGTARKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLV 536

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP+   ++  +  ++ V P 
Sbjct: 537 SAPVFHKVMEGALRLMDVPPD 557


>gi|148980582|ref|ZP_01816129.1| penicillin-binding protein 3 [Vibrionales bacterium SWAT-3]
 gi|145961165|gb|EDK26481.1| penicillin-binding protein 3 [Vibrionales bacterium SWAT-3]
          Length = 585

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 149/573 (26%), Positives = 258/573 (45%), Gaps = 38/573 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNID 110
           ++  +  +       K R  + I   LV + +L  R+     I P     +    S+ + 
Sbjct: 18  KERVKSEKDSDPILIKWRFNVVIAFVLVAFSVLVGRVAYIQVIEPDNLIRQGDLRSVRVK 77

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMI 165
               +R  I DRNGE LA  +P  +++ +P  +   + + +      L  VL  LD + +
Sbjct: 78  AIPSARGIISDRNGEPLAVSVPVEAVWADPKTIFDKNGMAQIDRWYALADVL-GLDRQSM 136

Query: 166 RRKLSSE--TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
             K+SS+   +F +L+R++SP   K I    L G+G + E  R+YPA   ++H++G   I
Sbjct: 137 INKISSDKSRRFIYLQRQVSPAMAKYIRDLKLVGIGLKAESRRYYPAGEVSAHLIGVTGI 196

Query: 224 DNRGITGIEKFLDMQ-----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIV 268
           D  G+ G+E+  D       G   +     G           +  +P+ L +D R+Q I 
Sbjct: 197 DGHGLEGVERSYDKWLTGEAGKRTIRKDRYGRVVENIALEEREEGKPLELTIDQRLQAIA 256

Query: 269 HQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFE 328
           ++ + +    + A S   ++L+V TG V++MV+ P Y+P+     +     NR+    FE
Sbjct: 257 YRAIKQAVADHKATSGSAILLDVKTGAVLAMVNAPSYNPNNRADLQSFKMRNRVITDAFE 316

Query: 329 MGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNI 388
            GS  K F +   +++G      + DT N I            +     +  I + SSNI
Sbjct: 317 PGSTVKPFVVLAALENGTADADTVIDTGNGIMQIGGSRVRDTSKVGKADLALILKKSSNI 376

Query: 389 GAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLS 446
           G A++A  M ++        +GL       L    A  +P+  +W +    T+SFG+GL+
Sbjct: 377 GVAKLALDMPLEALLGMYSSVGLGEMSGLNLVGETAGIFPNRRRWSKFEIATLSFGYGLA 436

Query: 447 TTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GG 505
            TPLQ A A A L N G   P   +  + ++    S+ ++K+   + + ++L      GG
Sbjct: 437 ITPLQLAHAYATLANHGVYEPIHIVKSNDQD---FSKQIIKRENAELVLNMLEGVTQKGG 493

Query: 506 SGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKE 565
           +  RA VPG+ V  KTGT++K I   Y D   F     V P +DP+  ++  ++ P+   
Sbjct: 494 TATRAAVPGYRVAAKTGTSRKAISGGYGDE-YFAYTAGVAPVSDPRVSLVVMINEPQGDL 552

Query: 566 RNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
                 G   AP+   I++ +  +L V     K
Sbjct: 553 ---YYGGSVAAPVFSEIMKGALQILNVPADENK 582


>gi|294627719|ref|ZP_06706301.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294664074|ref|ZP_06729475.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598071|gb|EFF42226.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292606159|gb|EFF49409.1| penicillin-binding protein 3 [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 622

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 150/551 (27%), Positives = 254/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R              +  A  +       SR  I DRNGE
Sbjct: 15  RGRLTLVGIALGLCSVTLIGRAAYVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  +L+ +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDDLNARLAQKAGKEFMYLQRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 194 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGSMV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q   + +
Sbjct: 314 TKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYQSI 373

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E+    R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LTPPTFVRGQHNET----RQVITPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|325915640|ref|ZP_08177948.1| peptidoglycan synthetase FtsI [Xanthomonas vesicatoria ATCC 35937]
 gi|325538200|gb|EGD09888.1| peptidoglycan synthetase FtsI [Xanthomonas vesicatoria ATCC 35937]
          Length = 620

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/561 (26%), Positives = 260/561 (46%), Gaps = 38/561 (6%)

Query: 65  KVIAHS----KNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMS 115
           +  A S    + R+ +  +   +  + L  R     ++       +  A  +       S
Sbjct: 5   RNRARSNFNLRGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELPIATS 64

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--T 173
           R  I DRNGE LA   P  S++V P +++   + I +L   L     + +  +L+ +   
Sbjct: 65  RGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIAELAKALGQ-PLDELNARLAQKAGK 123

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
           +F +L+R+++P +   I++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E 
Sbjct: 124 EFMYLQRRINPDKAHAIVALKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLEL 183

Query: 234 FLDMQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKK 277
             D       G  +V    +G            +  + + L++D RIQ + ++EL     
Sbjct: 184 AFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALV 243

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
           + NA     V+++V+TGEV++MV++P Y+P+           NR    + E GS  K  T
Sbjct: 244 ENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLT 303

Query: 338 IAMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           +A  + +G+ T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  
Sbjct: 304 VATALTAGVVTKDTIIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAK 363

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAV 454
           +  Q   + +   G  S   +  P   +     P++W      T+S+G+GLS TPLQ A 
Sbjct: 364 VPDQTFYQSIRNFGYGSAPHSGFPGESSGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQ 423

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           A A L N G+L PPTF+     E    +R V+     + +  ++   VT G  + A + G
Sbjct: 424 AYATLGNGGKLTPPTFVRGQHNE----TRQVITPEVAREVIDMMETVVTQGGAKGAAILG 479

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           + V GKTGTA+K     Y        F  + P T P++  +  ++ P+ K       G+ 
Sbjct: 480 YHVAGKTGTARKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLV 536

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP+   ++  +  ++ V P 
Sbjct: 537 SAPVFHKVMEGALRLMDVPPD 557


>gi|312983312|gb|ADR30452.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 581

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/559 (27%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                 +G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHAGEGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|289671025|ref|ZP_06492100.1| penicillin-binding protein 3 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 622

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 150/551 (27%), Positives = 255/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R     ++       +  A  +       SR  I DRNGE
Sbjct: 15  RGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKAGKEFMYLQRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 194 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGSMV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGA +IA  +  Q   + +
Sbjct: 314 TKDTIIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAVKIAAKVPDQTFYQSI 373

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|149914520|ref|ZP_01903050.1| hypothetical protein RAZWK3B_13044 [Roseobacter sp. AzwK-3b]
 gi|149811313|gb|EDM71148.1| hypothetical protein RAZWK3B_13044 [Roseobacter sp. AzwK-3b]
          Length = 594

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 172/569 (30%), Positives = 294/569 (51%), Gaps = 18/569 (3%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
           +         E+ +   ++ R +    ++ R+ +  ++  + ++++  R+    N  P  
Sbjct: 18  NGENPDAIERENIRIRHEQMRDRARKRAEGRLFVLGIMFTLSFVLIGGRMGVLANSEPTE 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              S+   +    R DI+DR G ILAT+  T SLY +P +++ P+   ++L  + P+LD 
Sbjct: 78  PRSSVAGAQIVAQRADIVDRQGRILATNFETHSLYAQPEQLVDPERAADELVRIFPDLDR 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
             + +  + + KF W++RK+SP+Q++ +   G PG+ F   + R YP    ASHV+G   
Sbjct: 138 ARLVKDFTGKRKFLWIKRKISPEQKQAVHDIGEPGLLFGPREMRLYPNGRLASHVLGGAS 197

Query: 223 IDNRGITGIEKFLDMQGLTRVF--TTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
               G+   E  + + G+ + F        ++ +P+RL+LDL +Q  + + L    K  N
Sbjct: 198 FGREGVHAAE-VIGVAGIEKEFDARLRDPAQSHEPLRLSLDLSVQAAIERVLYGGMKLMN 256

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKE------GWFNRISYGIFEMGSIFK 334
           A+    +++ V TGE++++ S+PD+DP++  +   E        FNR   G++E+GS  K
Sbjct: 257 AKGATAILMEVKTGEIVAVASLPDFDPNDRPRPPTEGDPTDSPLFNRAVQGVYELGSTLK 316

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
           +FT+A  +D GL     + DT+ P++ GKH I D+      +++ ++   SSNIG A+IA
Sbjct: 317 IFTVAQALDMGLVNPTTIIDTKGPLRWGKHRISDFRNYGNEMSVTKVIVKSSNIGTARIA 376

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEI--QAPSYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +G +  K FL  LG L     E+ E     P  P  W  + ++TIS+GHG+ST+P+  
Sbjct: 377 QMIGGERQKAFLEDLGFLDPPPVEIVEADGAQPLLPRNWSELSTMTISYGHGISTSPMHL 436

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           A   A L N GR + PT +  +          V+ + T +    +LR+ VT G+     V
Sbjct: 437 AAGYATLANGGRKVTPTLLHGTTTAPGP---QVISEQTARVSMDMLRKVVTEGTASFGEV 493

Query: 513 PGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQ 568
           PG+ VGGKTGTA K       Y +     +F +VFP  DP+Y+++  +D P     +  +
Sbjct: 494 PGYAVGGKTGTADKPKARGGGYYEDKVLATFASVFPAHDPEYVLVVTLDEPVETSGDEPR 553

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPVFL 597
            TAG    P+   IIRR A +LG++P   
Sbjct: 554 RTAGWTAVPVAAEIIRRVAPLLGLRPQIE 582


>gi|87122633|ref|ZP_01078510.1| penicillin-binding protein 3 [Marinomonas sp. MED121]
 gi|86162091|gb|EAQ63379.1| penicillin-binding protein 3 [Marinomonas sp. MED121]
          Length = 584

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 144/569 (25%), Positives = 251/569 (44%), Gaps = 43/569 (7%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDI 119
           + +  ++ R      + ++++ ++A R+          +  +    ++  +    +R  I
Sbjct: 6   QFLKPAQWRFYFVYAIAIMLFGVIAGRLFYLTVVEKDFLQNQGEIRAVRTEIIPATRGMI 65

Query: 120 IDRNGEILATDIPTFSLYVEPHKV----------ISPDEIIEKLQIVLPNLDSEMIRRKL 169
           +DR GE LA   PT++L   P ++            P   I +L  VL       + ++ 
Sbjct: 66  LDRRGEPLAVSTPTWTLVANPKRLWAMPVDEEKGTGPKAEIARLAKVLGE-GRASLTKRF 124

Query: 170 SSET--KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
             +    F +L+R++ P   + I+   + GV    E  RFYPA   ASHVVG+  ID++G
Sbjct: 125 EQKRNSSFMYLKRQIPPHIAEDIMQAKVVGVSRTKEYKRFYPAGEVASHVVGFTGIDDQG 184

Query: 228 ITGIEKFLDM-----QGLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQE 271
             G+E   +       G  +      G            +  Q I L+LDLR+Q + ++E
Sbjct: 185 QEGLELSYEKALEGEPGKRQYVKDLTGNIIRQIGQETHAEPGQNIELSLDLRLQYLAYRE 244

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L     ++ A S   VIL+V TGEV++MV+ P Y+P++  K   +   NR    +FE GS
Sbjct: 245 LKAAVTEHRATSASAVILDVKTGEVLAMVNQPSYNPNDRSKLNYDEMRNRAVIDLFEPGS 304

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
             K FT++  + SG +T +   DT                    + +  +   SSN+  +
Sbjct: 305 TMKPFTLSAALGSGQYTTESKIDTSPGYIRFGRQTIRDLGNYGKIDLETLLVKSSNVATS 364

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTP 449
           +IA ++         Y+LG+ S ++   P   + S     +W      T+S+G+GLS + 
Sbjct: 365 KIALSLPQDAVWNLYYQLGIGSPVDIGFPGESSGSLPTHPKWHPAEIATLSYGYGLSVST 424

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRR 509
           LQ A A A L N G  +P   +   +++       V+     K +  ++R  V   S + 
Sbjct: 425 LQLAHAYATLGNRGYKVP---VTMFKQDVMPEGEQVIPSGVAKDVLKMMRSVVDK-SAKA 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A VPG+ V GKTGT  KV  K Y      + F  V P T+P+  ++  ++ PK     + 
Sbjct: 481 AKVPGYVVAGKTGTVHKVGTKGYEYDQYISLFAGVAPATNPRLAMVVMVNDPK---GREY 537

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFLK 598
                 AP+   ++  + ++L V P   +
Sbjct: 538 YGSEVSAPVFSRVMDGAMTILNVSPDLPE 566


>gi|23098920|ref|NP_692386.1| stage V sporulation protein D [Oceanobacillus iheyensis HTE831]
 gi|22777148|dbj|BAC13421.1| stage V sporulation protein D (soprulation specific
           penicillin-binding protein) (spore cortex)
           [Oceanobacillus iheyensis HTE831]
          Length = 643

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 143/573 (24%), Positives = 252/573 (43%), Gaps = 44/573 (7%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSR 116
            +R      K RI    ++  +I  ++  R+          +  +          +   R
Sbjct: 1   MKRVSTVTIKKRIVTVFLLGALIIAVIIGRLAYVQFVLGDDLAGQANELWTRDITFAAER 60

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
             I+D  GE+LA ++   ++ V P ++ +P++   +L  +L ++  + +   ++  T   
Sbjct: 61  GYILDSEGEVLAENVTAPTVIVMPRQITNPEQTATQLAKIL-DVPQDRVHETITKNTSSV 119

Query: 177 WLRR---KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            +R    K++ +Q+K I    L GV    +  R+YP     SHV+G+  IDN+G+ G+E 
Sbjct: 120 MIRPEGIKITDKQEKAIRELDLSGVYLAKDSKRYYPNGDDLSHVLGFTGIDNQGLMGLEL 179

Query: 234 FLDMQ-----GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENK 276
             D +     G   +++  KG K            +   ++  ++ ++Q I+ +EL +  
Sbjct: 180 SYDDKLKGENGSLSLYSDAKGRKLEELADEYNPPVDGLNLQTTINTKVQTIIERELDKAT 239

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKV 335
            KYN +    + +N  TG ++ M S P++DP          +  N   +  +E GS FK+
Sbjct: 240 IKYNPDGALAIAVNPKTGGILGMSSRPNFDPENYQDVDASIFGRNLPIWSTYEPGSTFKI 299

Query: 336 FTIAMGIDSGLFT-VKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQI 393
            T+A  ++ G     +D F     I+VG   IH +    +   +  E+ + S N G   +
Sbjct: 300 ITLAAALEEGAVNLEEDRFHDDGDIEVGGATIHCWKKGGHGDQSYLEVVQNSCNPGFVNL 359

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQ 451
              +G +    ++   G   K   +L          P     +   T SFG G+S TP+Q
Sbjct: 360 GQRLGTEKLFSYIDAFGFGKKTGIDLQGEGNGILFQPENVGPVELATTSFGQGVSVTPIQ 419

Query: 452 TAVAAAALINEGRLIPPTFMIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGV 502
             +A AA +N G L  P       +            ++   V+ ++T + +R  L   V
Sbjct: 420 QVMAVAAAVNGGYLYKPYIADEWIDPVNGETVEKYEPQLQNRVISEDTSEEIRYALESVV 479

Query: 503 TGGSGRRAFVPGFEVGGKTGTAQKVI-KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP 561
             G+GR A+V G+ VGGKTGTAQKV     Y +     SF+   P  DP+ +V   +D+P
Sbjct: 480 AQGTGRPAYVDGYRVGGKTGTAQKVGPNGGYMENNYIVSFIGFAPADDPEIVVYVAVDNP 539

Query: 562 KIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           K   +     G+  AP+VG II  S   + V+P
Sbjct: 540 KDTLQ---FGGVVAAPIVGTIIGDSLRAMEVEP 569


>gi|237747022|ref|ZP_04577502.1| FtsI cell division protein [Oxalobacter formigenes HOxBLS]
 gi|229378373|gb|EEO28464.1| FtsI cell division protein [Oxalobacter formigenes HOxBLS]
          Length = 590

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 140/557 (25%), Positives = 248/557 (44%), Gaps = 36/557 (6%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPD 118
           +  ++  ++R+   + +  + ++ L  R +         +  +  +      E   +R  
Sbjct: 28  KVSLSPMRSRL--VLFMLFLAFVGLIARALWLQGISTDFLQKQGESRYARTLELPATRGK 85

Query: 119 IIDRNGEILATDIPTFSLYVEPHKV-ISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQW 177
           I+DRNG +LA+ +P  +++  P  V   P + I KL  +L  +    +  KL S+  F +
Sbjct: 86  ILDRNGHVLASSVPVKAIWAIPEDVMTQPRDKIGKLASLL-GMSQNALYAKLDSDRSFVY 144

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD- 236
           L+R++       I+  G+ G+  R E  RFYP     +HVVG+ ++++ G  GIE     
Sbjct: 145 LKRQVDNDVADEIVKLGIAGIQTRKEYKRFYPEGEVMAHVVGFTNVEDVGQEGIELASQD 204

Query: 237 ----MQGLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
                +G  RV     G             + + + L++D ++Q I ++ L E   K+ A
Sbjct: 205 VLAGTKGSRRVIKDRLGHIVEDIRAIREPMDGKDLVLSIDSKLQYIAYKYLNEAIAKHKA 264

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
           ++   ++L+  TGEV++MV++P ++P++  +       NR+    FE GS+ K  T+A+ 
Sbjct: 265 KAGSVLVLDTRTGEVLAMVNMPSFNPNDRRRLTGAQLRNRVMTDTFEPGSVMKPLTVALA 324

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           ++ G      +  T                 N  +++ ++   SSNIG A+IA  M  Q 
Sbjct: 325 LEKGNVKPGTMIPTGTGKMTIGTATIGDTHPNGTISVAQVIEKSSNIGTAKIALQMKPQE 384

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             E    +G   +     P   A        W+ I   T+S+GHG+S +  Q A +    
Sbjct: 385 MWEMFTSVGFGQQPRFGFPGAVAGRVRPFKSWRPIEQATMSYGHGISVSLFQMAQSYMIF 444

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVG 518
             +G +IP +F+ R   +     R ++ K T   MR +L       G+ RRA V G+ V 
Sbjct: 445 ARDGDMIPLSFLKR---DELPEGRQIISKKTALEMRQMLEMVTGAEGTARRAQVAGYRVA 501

Query: 519 GKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPM 578
           GKTGTA K+   RY       SF+   P +DP+ I+   +D P +        G   AP+
Sbjct: 502 GKTGTAYKIENGRYVR-KYVGSFVGFAPASDPRVIIAVMIDEPTV----GHYGGAAAAPV 556

Query: 579 VGNIIRRSASMLGVKPV 595
              +   +   + V P 
Sbjct: 557 FSAVAADTLRAMNVSPD 573


>gi|71898208|ref|ZP_00680382.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
 gi|71731947|gb|EAO34004.1| Peptidoglycan glycosyltransferase [Xylella fastidiosa Ann-1]
          Length = 613

 Score =  381 bits (979), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/564 (26%), Positives = 257/564 (45%), Gaps = 38/564 (6%)

Query: 62  RRRKVIAHS----KNRIGMT-----IVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEY 112
           + R     S    + R+ +      +    +I     +++I       +  A  +     
Sbjct: 2   KNRNNRFRSHFNLRGRLLLVGTALGLCSMTLIASAAYVQLINSDFYQRQAQARYLRELPI 61

Query: 113 GMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--S 170
             SR  I DRNGE LA   P  S++  P +++   + I KL  VL ++  + +R +L   
Sbjct: 62  PTSRGMITDRNGEPLAVSTPVESIWGNPQELLRNPDAISKLAKVL-DVPMDELRTRLLQK 120

Query: 171 SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITG 230
           ++ +F +L+R+++P     +L   +PGV  + E  RFYP +   +HV+G+ +ID+RG  G
Sbjct: 121 ADKEFMYLKRRINPDVAHHVLGLQIPGVFAQREFRRFYPQSEAMAHVLGFTNIDDRGQEG 180

Query: 231 IEKFLD-----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVE 274
           +E   D       G  RV    +G            +  + + L +D RIQ + ++EL  
Sbjct: 181 LELSFDDWLTGKPGSKRVVRDARGAIVESVDAIRSAQPGKDLVLTIDRRIQFLAYKELRN 240

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
              +  A     V+++V+ GE+++MV++P Y+P+           NR    + E GS  K
Sbjct: 241 AIVENQAAGGSIVVMDVNNGEILAMVNLPTYNPNAVNGINSSARRNRAVTDLVEPGSTMK 300

Query: 335 VFTIAMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
             T+A  + +G+ T   + D     + +G+  I D    N +L +  +   SSNIGAA+I
Sbjct: 301 PLTVATALQAGVVTPDTVIDTNPGYLSLGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKI 360

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQ 451
              +  +   E +   G  +   +  P   +   P    W      T+S+G+GLS TPLQ
Sbjct: 361 VAKVPDKTFYELVQGFGYGTAPHSGFPGESSGVLPLPARWSGTSKTTMSYGYGLSVTPLQ 420

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
            A A A L N G+L+PPTF+     E+    R V+     + +  ++   VT G  + A 
Sbjct: 421 IAQAYATLGNGGKLVPPTFVKGHHAEA----RQVVDAKVAQQVIGMMETVVTRGGAKAAA 476

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           + G+ V GKTGTA+K     Y        F  + P T P++  +  ++ P+ K       
Sbjct: 477 ILGYHVAGKTGTARKTGANGYESGHYNALFAGLVPATRPRFATVIVINDPQGK---AYYG 533

Query: 572 GINVAPMVGNIIRRSASMLGVKPV 595
           G+  AP+   ++  +  ++ V P 
Sbjct: 534 GLVSAPVFHRVMEGALRLMDVPPD 557


>gi|217979583|ref|YP_002363730.1| Peptidoglycan glycosyltransferase [Methylocella silvestris BL2]
 gi|217504959|gb|ACK52368.1| Peptidoglycan glycosyltransferase [Methylocella silvestris BL2]
          Length = 599

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 209/536 (38%), Positives = 330/536 (61%), Gaps = 4/536 (0%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
            +  S  RI +   V + +Y ++A ++I +G    + I    + D    +RPDI+DRNG+
Sbjct: 37  NLGKSPLRIKLVACVFIGLYAVIAGKLIYFGLHQEQSIGSKRSGDIVAAARPDILDRNGD 96

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           +LATDI   S++ EP ++I  DE +E L  VLP++D+  +R++L S   F W++R ++PQ
Sbjct: 97  VLATDIKVMSVFAEPRRIIDKDEAVELLTAVLPDVDASDLRKRLGSRKGFIWVKRAVTPQ 156

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           QQ+ +   GLPGVGF  E  R YP    A+HV+G+ ++D  GI+G+EK++D QGL  +  
Sbjct: 157 QQQEVYRLGLPGVGFLPENKRVYPNGPIAAHVLGFANLDGVGISGLEKYIDGQGLADLHG 216

Query: 246 TNKG--EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                  ++L PI  +LDL+    V  EL +   K+ A++   VIL+V+TGEV+++ S+P
Sbjct: 217 AGFSLTPESLAPITSSLDLKATYAVRDELAKGVAKFKAKAGAVVILDVNTGEVVALASLP 276

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           DYDP+           NR+S G++EMGS FK  ++AM +D G   +    D R+ ++ G+
Sbjct: 277 DYDPNTPADALDPNHINRVSVGVYEMGSTFKAISVAMALDQGKVNLNSRVDARSSLRYGR 336

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHD+H QNR+LT+PE+F +SSNIGAA++A  +G++GHK FL ++G L++L TELPE  
Sbjct: 337 FTIHDFHAQNRVLTVPEVFTFSSNIGAARLALMVGVEGHKAFLRKVGQLTRLHTELPETA 396

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
            P  P  W  ++++TI+FG GL+ +PLQ  +A  AL N G L+ PTF+ R  + +++ + 
Sbjct: 397 DPLVPKNWGELNTMTIAFGQGLNVSPLQAMMAVGALANGGLLVNPTFLKRDEQAAKRNAP 456

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            V+K  T +++R L+R     GS ++A +PG+ +GGKTGTA K++  RY+    F +F+A
Sbjct: 457 RVIKPETSESLRYLMRLNAEIGSAKKADIPGYFIGGKTGTADKIVHGRYAKDRVFTTFMA 516

Query: 544 VFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAPMVGNIIRRSASMLGVKPVFL 597
           + P   P+Y++L+ MD P+          A  N   + G II R   +LG+ P F 
Sbjct: 517 LMPADKPKYLILTLMDEPQGLPETAGYRTAAWNSGVVTGRIIERVGPLLGLPPRFE 572


>gi|212635036|ref|YP_002311561.1| FtsI protein [Shewanella piezotolerans WP3]
 gi|212556520|gb|ACJ28974.1| FtsI [Shewanella piezotolerans WP3]
          Length = 578

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 138/565 (24%), Positives = 252/565 (44%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R++     + R+ + +    +++  L  R           +  E    ++      +
Sbjct: 4   QAKRKQKPQLIQWRLYVVVAFVCMLFTSLIGRAAYIQIIEPEKLRHESDMRTLRTTSREV 63

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRR-K 168
            R  I DRNGE+LA  +P  ++Y +P  V   +        + L  VL     ++++R +
Sbjct: 64  QRGLITDRNGEMLAVSVPVKAVYADPKVVHDENGFVDMRRWQALADVLHEPKEKILKRVQ 123

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P     I    LPGV  + E  R+YP +  ++ +VG  +ID+ GI
Sbjct: 124 SNPRKRFTYLKRQVTPAVADYIKKLKLPGVYLKPESRRYYPTSEISAQLVGITNIDDLGI 183

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            GIE   +          +V  +  G            ++   + L++D RIQ + ++E+
Sbjct: 184 EGIENTYNDWLTGTPSKQKVRKSRDGHVVERLDMVQEGESPNDLVLSIDQRIQQLAYREI 243

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
            +  +   A S   V+L+V+TGEV++M + P Y+P+     +     NR     +E GS 
Sbjct: 244 KKATEANQATSASIVVLDVNTGEVLAMANTPSYNPNSRENLQSYRMRNRALTDAYEPGST 303

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G   + D+  T          I         L++  I  +SSN+G  +
Sbjct: 304 IKPFVVAAALEAGTIKLDDIIKTNPGRMRIGGKIVRDTRNYGDLSLAGILVHSSNVGMTK 363

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           IA +M +Q        +GL +     L    A       +W      T+SFG+GL  TPL
Sbjct: 364 IALSMPVQELLGSYQAMGLGNYSGINLEGESAGLIHDRRRWSEFERATLSFGYGLMATPL 423

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L ++G L P + +   +   +     V+  +  + +  +L      GG+ R+
Sbjct: 424 QIARMYATLGSKGVLYPTSILKLKQ---KPEGTQVISADVAQNVMEMLVGVTEKGGTARK 480

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GKTGTA+K +   Y +      F  V P  +P+  +   ++ PK    ++ 
Sbjct: 481 AHIEGYPVAGKTGTARKAVAGGYGED-YVAIFAGVAPVHNPRLAIAVVVNEPK---GDRY 536

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G   AP+  +++  +  ML V+P
Sbjct: 537 YGGDIAAPVFASVMSGALQMLNVEP 561


>gi|166710647|ref|ZP_02241854.1| penicillin-binding protein 3 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 625

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/551 (27%), Positives = 255/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R     ++       +  A  +        R  I DRNGE
Sbjct: 18  RGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELPIATLRGMITDRNGE 77

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 78  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKASKEFMYLQRRIN 136

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 137 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 196

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 197 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGAMV 256

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 257 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 316

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q   + +
Sbjct: 317 TKDTVIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYQSI 376

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 377 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 436

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  R A + G+ V GKTGTA
Sbjct: 437 LTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGARGAAILGYHVAGKTGTA 492

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 493 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHKVME 549

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 550 GALRLMDVPPD 560


>gi|24375710|ref|NP_719753.1| peptidoglycan synthetase FtsI [Shewanella oneidensis MR-1]
 gi|24350644|gb|AAN57197.1|AE015855_8 peptidoglycan synthetase FtsI [Shewanella oneidensis MR-1]
          Length = 583

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/565 (22%), Positives = 237/565 (41%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q  +++       R+ + +     ++  L  R           +  E    ++      +
Sbjct: 9   QASKKQKPQLIHWRLYVVVGFVFAMFTCLVGRAAYIQIIEPDKLRHESDMRTLRTTSREV 68

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRR-K 168
            R  I DRNG++LA  +P  +++ +P +V   +   +      L  VL     +++ + +
Sbjct: 69  QRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNGFADMRRWQALADVLHEPVEDVLDKVR 128

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P     I    LPGV  + E  R+YP     + ++G  +ID+ GI
Sbjct: 129 SNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGITNIDDVGI 188

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            G+E   +          +V  +  G            ++   + L++D RIQ + ++EL
Sbjct: 189 EGVENAYNSWLTGTPSKQKVRKSRDGHVVERLDIVQEGESPNDLVLSIDHRIQQLAYREL 248

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +   A S   V+L++ TGEV++MV+ P ++P+     +     NR     FE GS 
Sbjct: 249 KRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSFNPNSRDNFQTFRMRNRAMTDTFEPGST 308

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G     D+  T                    +T+  I   SSN+G ++
Sbjct: 309 IKPFVVAAALEAGTVKSTDVIPTSPGWMRLGGRQVRDASNYGDMTLARILAKSSNVGISK 368

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           +A ++ +Q        +GL S     L    A       +W      T+SFG+GL+ T L
Sbjct: 369 LALSIPVQQLLGTYQSMGLGSFSGINLTGESAGLIQDRHRWSDFERATLSFGYGLTATTL 428

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L N G L P + +     +       V+ +   K +  ++      GG+G  
Sbjct: 429 QLARMYATLGNGGTLFPVSILKL---KKPPEGERVISEAVAKDVLQMMVSVTEKGGTGTL 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GK+GT++K +   Y D      F  V P  +P+  ++  ++ PK       
Sbjct: 486 AHIDGYPVAGKSGTSRKAVAGGYGDD-YVALFAGVAPVNNPKLAIVVVVNEPKGDL---Y 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G    P    ++  +  ML V+P
Sbjct: 542 YGGSVAGPAFAKVMSGALQMLNVEP 566


>gi|319639030|ref|ZP_07993788.1| PenA protein [Neisseria mucosa C102]
 gi|317399934|gb|EFV80597.1| PenA protein [Neisseria mucosa C102]
          Length = 582

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 166/568 (29%), Positives = 271/568 (47%), Gaps = 38/568 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNID 110
           Q L    + K    S  RIG+ +    + +  L +R +       E +        +   
Sbjct: 10  QMLSGTTKTKKPLTSNGRIGLVLGAVALAFTGLLVRGVYLQTSQHEFLKNQGDQRFVRTL 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRK 168
               SR  I DRNG  LA   PT SLY  P  +     DE +EKL  +  ++  E+++ K
Sbjct: 70  PLPASRGMITDRNGATLALSAPTESLYAMPSGMEEMPTDEQLEKLSAI-ADVPVEVLKNK 128

Query: 169 LSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           LS + K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G
Sbjct: 129 LSKKDKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKG 188

Query: 228 ITGIEKFLD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVH 269
             G+E   +       G   V   NKG              KN Q + L+LD RIQ + +
Sbjct: 189 QEGLELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAY 248

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
           +EL +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E 
Sbjct: 249 EELNKAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEP 308

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K FTIA  +DSG     D F+T                    L +  I + SSN+G
Sbjct: 309 GSAMKPFTIAKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLST 447
            ++++     +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  
Sbjct: 367 TSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGS 506
           + LQ A A   L ++G L+P   +   ++      + V+K +T K +R L+      GG+
Sbjct: 427 SLLQLARAYTVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GTAGAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA--- 540

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
           N    G+   P+   ++  S ++LGV P
Sbjct: 541 NGYYGGVVAGPVFKEVMSGSLNILGVSP 568


>gi|261379349|ref|ZP_05983922.1| peptidoglycan synthetase FtsI [Neisseria subflava NJ9703]
 gi|284797789|gb|EFC53136.1| peptidoglycan synthetase FtsI [Neisseria subflava NJ9703]
          Length = 582

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 166/568 (29%), Positives = 270/568 (47%), Gaps = 38/568 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNID 110
           Q L    + K    S  RIG+ +    + +  L +R +       E +        +   
Sbjct: 10  QMLSGTTKTKKPLTSNGRIGLVLGAVALAFTGLLVRGVYLQTSQHEFLKNQGDQRFVRTL 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRK 168
               SR  I DRNG  LA   PT SLY  P  +     DE +EKL  +  ++  E+++ K
Sbjct: 70  PLPASRGMITDRNGATLALSAPTESLYAMPSGMEEMPTDEQLEKLSAI-ADVPVEVLKNK 128

Query: 169 LSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           LS + K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G
Sbjct: 129 LSKKDKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKG 188

Query: 228 ITGIEKFLD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVH 269
             G+E   +       G   V   NKG              KN Q + L+LD RIQ + +
Sbjct: 189 QEGLELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAY 248

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
            EL +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E 
Sbjct: 249 DELNKAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEP 308

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K FTIA  +DSG     D F+T                    L +  I + SSN+G
Sbjct: 309 GSAMKPFTIAKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLST 447
            ++++     +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  
Sbjct: 367 TSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGS 506
           + LQ A A   L ++G L+P   +   ++      + V+K +T K +R L+      GG+
Sbjct: 427 SLLQLARAYTVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GTAGAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA--- 540

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
           N    G+   P+   ++  S ++LGV P
Sbjct: 541 NGYYGGVVAGPVFKEVMSGSLNILGVSP 568


>gi|56476233|ref|YP_157822.1| penicillin-binding 3 precursor PBP-3 transmembrane protein
           [Aromatoleum aromaticum EbN1]
 gi|56312276|emb|CAI06921.1| penicillin-binding 3 precursor PBP-3 transmembrane protein
           [Aromatoleum aromaticum EbN1]
          Length = 584

 Score =  381 bits (978), Expect = e-103,   Method: Composition-based stats.
 Identities = 138/531 (25%), Positives = 238/531 (44%), Gaps = 26/531 (4%)

Query: 84  IYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKV 143
           +   L ++      +  +  +      E   +R  +IDR+G++LA   P  S++  P   
Sbjct: 39  VGRALYLQGFNNEFLQAKGESRYARAIEVPATRGRVIDRHGDVLAISTPVRSIWAIPSDA 98

Query: 144 ISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLE 203
                   KL  +L     + +  +L++   F +L+R+L P+  + + +  LPG+  + E
Sbjct: 99  RLSPADARKLAELL-ETSVDELNGRLATSHDFVYLKRQLPPELAQEVAALKLPGIHQQQE 157

Query: 204 KSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTNKG--------- 249
             R+YP     +HV+G+  +D++G  G+E   D       G  RV    +G         
Sbjct: 158 YRRYYPGGEVMAHVLGFTGVDDKGQEGVELAFDKLLTGTPGARRVIRDRRGQVVEDVEAI 217

Query: 250 --EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDP 307
               + Q + LA+D +IQ + H  L +  + + A++   V+L+V TGEV+++V+ P Y+P
Sbjct: 218 RPPHDGQDLVLAMDAKIQYLAHSALNQAMQTHKAKAGAAVVLDVRTGEVLALVNAPTYNP 277

Query: 308 HEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIH 367
           +           NR+    +E GS  K F + + +D G      + DT            
Sbjct: 278 NNRTNLSGAQLRNRVFTDTYEPGSTMKPFIVGLALDRGKVEPTTVIDTTPGRVSIGRSTI 337

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP-- 425
               ++  LT+ E+ + SSN+G  ++A  +  +        LG  + L+   P   +   
Sbjct: 338 SDSHRHGPLTVAEVIQKSSNVGTVKMAMNLAPEEMWRMFNELGFGAPLDLGFPGEASGRL 397

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
                WK I   T+SFGHG+S + +Q A A  A   +G L+P +      +      + V
Sbjct: 398 RPVKTWKPIEQATMSFGHGISVSLIQMAHAYLAFARDGELLPLSLTR--VDTPLAAGKRV 455

Query: 486 LKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
              +T + MR +L      GG+  RA + G+ V GKTGTA K+   RY++    +SF+  
Sbjct: 456 YSVDTAREMRYMLELAAGPGGTAPRAQIRGYRVAGKTGTAHKLEGGRYAN-KYVSSFVGF 514

Query: 545 FPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            P +DP+ IV   +D P      Q   G   AP+   I   +  +LGV P 
Sbjct: 515 APASDPRIIVAVMIDEPSA---GQYFGGTVAAPIFAQITEGALRVLGVAPD 562


>gi|188585924|ref|YP_001917469.1| Peptidoglycan glycosyltransferase [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350611|gb|ACB84881.1| Peptidoglycan glycosyltransferase [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 704

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 146/567 (25%), Positives = 244/567 (43%), Gaps = 39/567 (6%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSR 116
           ++R+ +  +K R+ +     L+I I L  R+          +H +           G  R
Sbjct: 3   KKRQHLLPTKRRLVLIFFFVLLITISLISRLGYIQLVMGEELHEKAWEQWNRSIPTGSPR 62

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
            +I+DRNGE+L   +   SL   P ++ +P  + E+L  +L + D E +  KL+ +T+  
Sbjct: 63  GEILDRNGELLVGSVTADSLIAIPQQIENPQLLSERLAAIL-DRDQEELFEKLTEDTEQV 121

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
            + R L  +  +++ + G PG+    E  R+YP    AS V+G+V +D +G  GIE   D
Sbjct: 122 IVERILDKEDSRKVKALGDPGLKTTSETERYYPHGRLASQVLGFVGVD-QGWAGIEYQYD 180

Query: 237 -----MQGLTRVFTTNK------------GEKNLQPIRLALDLRIQNIVHQELVENKKKY 279
                 +G        +              K+ Q ++  LD RIQ I+ +EL     +Y
Sbjct: 181 EELKGQEGWLIFQADARQQELPHGVQQFVPPKDGQKLQTTLDSRIQYIMERELERAMVEY 240

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
             E    V +  +TGE++ M S PDY P E     +           FE GS FK+ T++
Sbjct: 241 KPEGAMAVAMEPNTGEILGMASKPDYYPGEYKDFDESLRRITPINNTFEPGSTFKLVTLS 300

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGK-HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
             I+ G +   + F     I+V    +       +  +   E+   S N G   +   +G
Sbjct: 301 AAIEEGKYNPDEAFYCPGHIEVSGAEIGCWTGDGHGAIDFTEVVYGSCNPGFVTLGQRLG 360

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +++   G  S+   +LP         P Q   +   T SFG G+S TP+Q  VA 
Sbjct: 361 TETLFDYIQGYGFGSRTGIDLPGETLGLLFGPDQVGPVELATTSFGQGISVTPIQQVVAV 420

Query: 457 AALINEGRLIPPTFMIRSREESEKV--------SRIVLKKNTVKTMRSLLREGVTGGSGR 508
           +A+ N G +  P    +  +E   V         R  + + T + +  ++R  V  GSG+
Sbjct: 421 SAIANGGYINEPRIADKFLDEEGNVVKDKEVNTVRRAISEKTSQEVSEIMRGVVNEGSGQ 480

Query: 509 RAFVPGFEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERN 567
            A + G+E+ GKTGTA+KV     Y       SF+   P  DP+ ++   +D+P      
Sbjct: 481 NAAIDGYEIAGKTGTAEKVGPEGGYVPGELIVSFVGFAPADDPEILIYVAVDTPTEGP-- 538

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKP 594
                   AP+  N++      L V P
Sbjct: 539 -AWGSQVAAPVFRNMMVDILDYLEVPP 564


>gi|289663642|ref|ZP_06485223.1| penicillin-binding protein 3 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 622

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 151/551 (27%), Positives = 256/551 (46%), Gaps = 34/551 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIR-----IIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R+ +  +   +  + L  R     ++       +  A  +       SR  I DRNGE
Sbjct: 15  RGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELPIATSRGMITDRNGE 74

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLS 183
            LA   P  S++V P +++   + I +L   L     + +  KL+ +   +F +L+R+++
Sbjct: 75  PLAVSTPVESIWVNPQELLRNPDRIPELAKALGQ-PLDELNAKLAQKAGKEFMYLQRRIN 133

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
           P +   I+   +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   D       
Sbjct: 134 PDKAHAIVDLKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAFDEWLRGKP 193

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  +V    +G            +  + + L++D RIQ + ++EL     + NA     V
Sbjct: 194 GSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRNALVENNAAGGSMV 253

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++V+TGEV++MV++P Y+P+           NR    + E GS  K  T+A  + +G+ 
Sbjct: 254 VMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMKPLTVATALTAGVV 313

Query: 348 TVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           T   + D     + VG+  I D    N +L +  +   SSNIGAA+IA  +  Q   + +
Sbjct: 314 TKDSIIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKIAAKVPDQTFYQSI 373

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
              G  S   +  P   A     P++W      T+S+G+GLS TPLQ A A A L N G+
Sbjct: 374 RNFGYGSAPHSGFPGESAGVVLQPARWSGPSKTTMSYGYGLSVTPLQIAQAYATLGNGGK 433

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           L PPTF+     E    +R V+     + +  ++   VT G  + A + G+ V GKTGTA
Sbjct: 434 LTPPTFVRGQHNE----TRQVITPEVARQVIDMMETVVTQGGAKGAAILGYHVAGKTGTA 489

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K     Y        F  + P T P++  +  ++ P+ K       G+  AP+   ++ 
Sbjct: 490 RKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKV---YYGGLVSAPVFHRVME 546

Query: 585 RSASMLGVKPV 595
            +  ++ V P 
Sbjct: 547 GALRLMDVPPD 557


>gi|37678792|ref|NP_933401.1| cell division protein FtsI [Vibrio vulnificus YJ016]
 gi|37197533|dbj|BAC93372.1| cell division protein FtsI [Vibrio vulnificus YJ016]
          Length = 576

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 149/554 (26%), Positives = 249/554 (44%), Gaps = 36/554 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +    + +  L +R+     I P     E    S+ +     +R  I DRNGE
Sbjct: 24  RWRFHLVLGFVFLAFAALVVRLAFIQVIEPDNLIREGDLRSIRVKALPSARGIISDRNGE 83

Query: 126 ILATDIPTFSLYVEP-----HKVISPDEIIEKLQIVLPNLDSEMIRRK-LSSETKFQWLR 179
            LA  +P  +++ +P      K +   +    L  VL     E+I R   +   +F +L+
Sbjct: 84  PLAVSVPVEAVWADPVTIFKEKALDNKQRWYALADVLGLQREELIERIERNENRRFIYLQ 143

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ- 238
           R++SP     I    +PGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 144 RQVSPAMANYIRELKIPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDNWL 203

Query: 239 ----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
               G   +     G           +  + + L +D R+Q I ++ + +    + A S 
Sbjct: 204 TGEAGKQTIRKDRYGRVVENIAYEDRQEGKSLELTIDQRLQAIAYRAIKQAVADHRATSG 263

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TG V++MV+ P Y+P+     +     NRI     E GS  K F I   +++
Sbjct: 264 SAVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRIITDSLEPGSTVKPFVILAALEN 323

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G+ T   + DT N I            +     + EI + SSNIG  +++  M ++    
Sbjct: 324 GVATKDTVIDTGNGILQVGGSRVRDTSKVGKADLTEILKKSSNIGVTKLSMEMPVEAILG 383

Query: 405 FLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +GL       L       +P+  +W  I   T+SFG+GLS TP+Q A A A L NE
Sbjct: 384 MYNSVGLGEPSGLNLVGEVTGIFPTRSRWSPIERATLSFGYGLSITPIQLAHAYATLGNE 443

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G   P   +  +  +   +++ V+ K   + + ++L      GGS RRA VPG+ VG KT
Sbjct: 444 GMYEPIHIIKSNDRD---MAKQVVSKQHAREVLNMLETVTQKGGSARRAAVPGYRVGAKT 500

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT++K     YSD         V P +DP+  ++  ++ P+  +      G   +P+   
Sbjct: 501 GTSRKATAGGYSDE-YITYTAGVAPVSDPRIALVVVVNEPQGDD---YYGGSVASPVFSE 556

Query: 582 IIRRSASMLGVKPV 595
           I++ +  +L V P 
Sbjct: 557 IMKGALQILNVAPD 570


>gi|326423736|ref|NP_759573.2| cell division protein FtsI [Vibrio vulnificus CMCP6]
 gi|319999099|gb|AAO09100.2| Cell division protein ftsI (Peptidoglycan synthetase) [Vibrio
           vulnificus CMCP6]
          Length = 576

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/554 (26%), Positives = 249/554 (44%), Gaps = 36/554 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +    + +  L +R+     I P     E    S+ +     +R  I DRNGE
Sbjct: 24  RWRFHLVLGFVFLAFAALVVRLAFIQVIEPDNLIREGDLRSIRVKALPSARGIISDRNGE 83

Query: 126 ILATDIPTFSLYVEP-----HKVISPDEIIEKLQIVLPNLDSEMIRRK-LSSETKFQWLR 179
            LA  +P  +++ +P      K +   +    L  VL     E+I R   +   +F +L+
Sbjct: 84  PLAVSVPVEAVWADPVTIFKEKALDNKQRWYALADVLGLQREELIERIERNESRRFIYLQ 143

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ- 238
           R++SP     I    +PGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 144 RQVSPAMANYIRELKIPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDNWL 203

Query: 239 ----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
               G   +     G           +  + + L +D R+Q I ++ + +    + A S 
Sbjct: 204 TGEAGKQTIRKDRYGRVVENIAYEDRQEGKSLELTIDQRLQAIAYRAIKQAVADHRATSG 263

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TG V++MV+ P Y+P+     +     NRI     E GS  K F I   +++
Sbjct: 264 SAVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRIITDSLEPGSTVKPFVILAALEN 323

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G+ T   + DT N I            +     + EI + SSNIG  +++  M ++    
Sbjct: 324 GVATKDTVIDTGNGILQVGGSRVRDTSKVGKADLTEILKKSSNIGVTKLSMEMPVEAILG 383

Query: 405 FLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +GL       L       +P+  +W  I   T+SFG+GLS TP+Q A A A L NE
Sbjct: 384 MYNSVGLGEPSGLNLVGEVTGIFPTRSRWSPIERATLSFGYGLSITPIQLAHAYATLGNE 443

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G   P   +  +  +   +++ V+ K   + + ++L      GGS RRA VPG+ VG KT
Sbjct: 444 GMYEPIHIIKSNDRD---MAKQVVSKQHAREVLNMLETVTQKGGSARRAAVPGYRVGAKT 500

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT++K     YSD         + P +DP+  ++  ++ P+  +      G   +P+   
Sbjct: 501 GTSRKATAGGYSDE-YITYTAGIAPVSDPRIALVVVVNEPQGDD---YYGGSVASPVFSE 556

Query: 582 IIRRSASMLGVKPV 595
           I++ +  +L V P 
Sbjct: 557 IMKGALQILNVAPD 570


>gi|332799088|ref|YP_004460587.1| stage V sporulation protein D [Tepidanaerobacter sp. Re1]
 gi|332696823|gb|AEE91280.1| stage V sporulation protein D [Tepidanaerobacter sp. Re1]
          Length = 693

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/548 (23%), Positives = 238/548 (43%), Gaps = 40/548 (7%)

Query: 82  LVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPH 141
            ++  +  I+ ++   +    +    +       R DI DRN   LA      ++   P 
Sbjct: 25  ALLGRVFWIQFVRGEELKNRALGQWTSDVPIEPKRGDICDRNNNPLAISATVDTVVASPP 84

Query: 142 KVISPDEIIEKLQIVLPNLDSEMIRRKLS----SETKFQWLRRKLSPQQQKRILSFGLPG 197
            +   ++    L   L ++D E + + L+     +    +++RK++ ++ + I +  L G
Sbjct: 85  DIEDIEKTAALLSDAL-DMDQEELEKTLNEAKTEKKGAIYIKRKITDEESEAIRNLNLKG 143

Query: 198 VGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVFTTN----- 247
           + F  E  RFYP  +  SHV+G+  ID++G+ G+E   D       G             
Sbjct: 144 IYFTKENKRFYPERNLCSHVLGFTGIDSQGLDGVELIYDKYLKGNPGRIVSEKDALSRKL 203

Query: 248 -------KGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMV 300
                     ++   + L +D  IQ+I  +EL +   ++ A+    ++++   GE+++M 
Sbjct: 204 PFGVDKYVPPEDGLNLVLTIDKIIQHIAERELEKALAEHKAKRGTIIVMDPKNGEILAMS 263

Query: 301 SIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIK 360
           + PDYDP+   +  ++ W N      +E GS FK+ T +  ++ G+   +D F     + 
Sbjct: 264 NKPDYDPNIYSEFSQQLWRNAAISDAYEPGSTFKIVTASAALEEGVVRPEDKFYDPGYVM 323

Query: 361 VGKHVI-HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETEL 419
           V    I   YH  +   T  +I   S N G   +A  +G     +++   G       +L
Sbjct: 324 VSGVRIGCWYHGGHGSQTFIQIVENSCNPGFVDVAMKLGKDRFMKYIKGFGFGEATGIDL 383

Query: 420 PEIQAPSYPSQW-KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES 478
           P              +   TISFG G+S TP+Q   A A + N+G+++ P       ++ 
Sbjct: 384 PGEALGLIDPSKVGPVELATISFGQGISVTPIQLISALATIANDGKMVQPHVAKAVTDKD 443

Query: 479 EKVS--------RIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKK 530
            K+         R V+  +T + M+++L   VT G+G +  + G+ VGGKTGTA+K    
Sbjct: 444 GKIIQEFSFEPLRQVISYDTAQEMKTILESVVTNGTGGKGKIEGYRVGGKTGTAEK---- 499

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASML 590
            YS      S+    P  DP+  +L  +D P     + +  G    P+   ++  S + L
Sbjct: 500 -YSPGKYVVSYEGFAPCDDPKLAILVIIDEP---SGDVIYGGTIAGPVFQKVMADSLNYL 555

Query: 591 GVKPVFLK 598
           G+KP   +
Sbjct: 556 GIKPEIPQ 563


>gi|320157429|ref|YP_004189808.1| cell division protein FtsI (Peptidoglycan synthetase) [Vibrio
           vulnificus MO6-24/O]
 gi|319932741|gb|ADV87605.1| cell division protein FtsI (peptidoglycan synthetase) [Vibrio
           vulnificus MO6-24/O]
          Length = 576

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/554 (26%), Positives = 248/554 (44%), Gaps = 36/554 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +    + +  L +R+     I P     E    S+ +     +R  I DRNGE
Sbjct: 24  RWRFHLVLGFVFLAFAALVVRLAFIQVIEPDNLIREGDLRSIRVKALPSARGIISDRNGE 83

Query: 126 ILATDIPTFSLYVEP-----HKVISPDEIIEKLQIVLPNLDSEMIRRK-LSSETKFQWLR 179
            LA  +P  +++ +P      K +   +    L  VL     E+I R   +   +F +L+
Sbjct: 84  PLAVSVPVEAVWADPVTIFKEKALDNKQRWYALADVLGLQREELIERIERNENRRFIYLQ 143

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ- 238
           R++SP     I    +PGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 144 RQVSPAMANYIRELKIPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDNWL 203

Query: 239 ----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
               G   +     G           +  + + L +D R+Q I ++ + +    + A S 
Sbjct: 204 TGEAGKQTIRKDRYGRVVENIAYEDRQEGKSLELTIDQRLQAIAYRAIKQAVADHRATSG 263

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TG V++MV+ P Y+P+     +     NRI     E GS  K F I   +++
Sbjct: 264 SAVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRIITDSLEPGSTVKPFVILAALEN 323

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G+ T   + DT N I            +     + EI + SSNIG  +++  M ++    
Sbjct: 324 GVATKDTVIDTGNGILQVGGSRVRDTSKVGKADLTEILKKSSNIGVTKLSMEMPVEAILG 383

Query: 405 FLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +GL       L       +P+  +W  I   T+SFG+GLS TP+Q   A A L NE
Sbjct: 384 MYNSVGLGEPSGLNLVGEVTGIFPTRSRWSPIERATLSFGYGLSITPIQLVHAYATLGNE 443

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G   P   +  +  +   +++ V+ K   + + ++L      GGS RRA VPG+ VG KT
Sbjct: 444 GMYEPIHIIKSNDRD---MAKQVVSKQHAREVLNMLETVTQKGGSARRAAVPGYRVGAKT 500

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT++K     YSD         V P +DP+  ++  ++ P+  +      G   +P+   
Sbjct: 501 GTSRKATAGGYSDE-YITYTAGVAPVSDPRIALVVVVNEPQGDD---YYGGSVASPVFSE 556

Query: 582 IIRRSASMLGVKPV 595
           I++ +  +L V P 
Sbjct: 557 IMKGALQILNVAPD 570


>gi|315646025|ref|ZP_07899146.1| stage V sporulation protein D [Paenibacillus vortex V453]
 gi|315278786|gb|EFU42100.1| stage V sporulation protein D [Paenibacillus vortex V453]
          Length = 647

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 140/550 (25%), Positives = 244/550 (44%), Gaps = 44/550 (8%)

Query: 85  YIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVE 139
           +  L IR+          +  +          +   R +I+DRNG  L T+I T +++  
Sbjct: 23  FSALIIRLAYVQIGKGAELSAKAEDLWRRDIPFAAQRGEILDRNGTALVTNITTPTIWAI 82

Query: 140 PHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RRKLSPQQQKRILSFGLP 196
           P +V  PD   + L   L  ++   I++ ++  ++ + +    RK++ +  + I    LP
Sbjct: 83  PVQVKDPDHTAKTLAG-LIGMNEADIKKIITKRSRLERINPGGRKITMELAQEIRDLKLP 141

Query: 197 GVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE- 250
           G+    +  R+YP    A+H++G+    ++G+TG+E   + +     G     +   G  
Sbjct: 142 GIVVAEDNKRYYPYGDLAAHILGFTGAYSQGLTGLEAKHEDKLKGFDGGISYLSDAGGRI 201

Query: 251 -----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISM 299
                      ++   + L +D  IQ+I+ +EL +   KY A    ++ +N  TGE+++M
Sbjct: 202 MPGSSEKYVEPRDGLNLELTIDKSIQSIMERELDQAMVKYQANGAWSIAMNPKTGEILAM 261

Query: 300 VSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLFDTRN 357
            S P Y P        E +  N   +  +E GS FK+ T+A  ++        D F    
Sbjct: 262 ASRPGYSPASYQDFSAETYNRNLPIWMTYEPGSTFKIITLAAALEEDKVDLKNDHFFDGG 321

Query: 358 PIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
            ++VG           +   T  E+ + S N G   +   +G +   +++   G  +K  
Sbjct: 322 AVEVGGARLRCWKKGGHGSQTFMEVVQNSCNPGFVALGQKLGKESLFQYIRDFGFGAKTG 381

Query: 417 TELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            +L   +        +   +   T +FG G+S TP+Q   A +A IN G+L  P      
Sbjct: 382 IDLNGEENGILFKLDKVGPVELATTAFGQGVSVTPIQQVAAVSAAINGGKLFKPHVAKAW 441

Query: 475 REES---------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQ 525
                         ++ R V+ + T K +R  L   V  G+GR AF+ G+ VGGKTGTAQ
Sbjct: 442 INPETGETVEEIEPELVRQVISEETSKQVREALESVVAKGTGRPAFIDGYRVGGKTGTAQ 501

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           KVI  RYS T +  SF+   P  DP+ +V + +D+PK  +      G+  AP+V NI+  
Sbjct: 502 KVINGRYSSTEHIVSFIGFAPADDPEIVVYTAVDNPKGIQ----FGGVVAAPIVQNILED 557

Query: 586 SASMLGVKPV 595
           +   + V P 
Sbjct: 558 ALHYMNVPPR 567


>gi|308048062|ref|YP_003911628.1| peptidoglycan synthetase FtsI [Ferrimonas balearica DSM 9799]
 gi|307630252|gb|ADN74554.1| peptidoglycan synthetase FtsI [Ferrimonas balearica DSM 9799]
          Length = 596

 Score =  381 bits (977), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/566 (22%), Positives = 249/566 (43%), Gaps = 36/566 (6%)

Query: 60  QKRRRKVIAHSK-NRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYG 113
           ++ ++K+       R+ +      +++  +  R           +  E    ++ ++   
Sbjct: 14  KQAKQKLKPTPFLWRLRLVTFAIALVFSGIVARAAYIQVIAPDRLRHESDLRTLRLETRD 73

Query: 114 MSRPDIIDRNGEILATDIPTFSLYVEPHKVI-----SPDEIIEKLQIVLPNLDSEMIRR- 167
           + R  I DRNGE+LA  +P  +++ +P +V              L  VL   ++E++ R 
Sbjct: 74  VQRGMITDRNGEMLAVSVPVQAVWADPKRVFEGNGFDDPRRWRALADVLEVPEAELVERV 133

Query: 168 KLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           K   + +F +LRR+++P   + I    +PGVG + E  R+YPA      ++G  +ID++G
Sbjct: 134 KQDPKRRFLYLRRQVTPAVAEYIAKLRIPGVGLKPESRRYYPAGEATGQLIGLTNIDDKG 193

Query: 228 ITGIEKFLDMQGLTRVFTTNKGEKNL----------------QPIRLALDLRIQNIVHQE 271
           I G+E+  D             +                     + L+LD+R+Q++ ++ 
Sbjct: 194 IEGLERNYDDWLTGSPEKVRVRKGLGGEVVENLSVVAEGEHPNDLVLSLDMRLQSLAYRA 253

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           L +  + + A S   VI+++ TGE+++M + P ++P++    +     NR     +E GS
Sbjct: 254 LKKATQYHMATSGSLVIIDIPTGEILAMANTPSFNPNQRSGIQAYQMRNRAITDAYEPGS 313

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
           + K   +A  ++ GL T   + DT          +           +  +   SSNIG A
Sbjct: 314 VVKPLVVAAAMEKGLVTPDTVMDTSPGWMRVSGGLVRDTRNFGKQDVTHLLVKSSNIGMA 373

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTP 449
           ++A  M +     F    GL +     L      +     +W      T++FG+GL++TP
Sbjct: 374 KMALQMEVDELLAFYADFGLGTYSGINLDGETTGNVPKRRRWSEHERATLAFGYGLTSTP 433

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGR 508
           LQ A   A L   G   P + +   R+        VL     K M ++L +    GG+  
Sbjct: 434 LQLARMYAILGANGVARPASILK-LRDGQVPEGEQVLSPKVAKQMLAILTQVTEPGGTAT 492

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           RA + G++V GKTGT++K +   Y +    + F  + P+ +P+  +   ++ P+    + 
Sbjct: 493 RAAIDGYKVAGKTGTSRKAVAGGYGED-YVSLFAGLAPSDNPRLAMAVVINEPQ---GDA 548

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
              G+  AP+   ++  +  +L V+P
Sbjct: 549 YYGGVVAAPVFSEVMAGALQLLNVEP 574


>gi|114045890|ref|YP_736440.1| peptidoglycan synthetase FtsI [Shewanella sp. MR-7]
 gi|113887332|gb|ABI41383.1| peptidoglycan synthetase FtsI [Shewanella sp. MR-7]
          Length = 583

 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/565 (22%), Positives = 236/565 (41%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q  +++       R+ + +     ++  L  R           +  E    ++      +
Sbjct: 9   QASKKQKPQLIHWRLYVVVGFVFAMFSCLVGRAAYIQIIEPDKLRHESDMRTLRTTSREV 68

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRR-K 168
            R  I DRNG++LA  +P  +++ +P +V   +        + L  VL     +++ + +
Sbjct: 69  QRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNGFTDMRRWQALADVLHEPVEDVLEKVR 128

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P     I    LPGV  + E  R+YP     + ++G  +ID+ GI
Sbjct: 129 SNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGITNIDDVGI 188

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            G+E   +          +V  +  G            ++   + L++D RIQ + ++EL
Sbjct: 189 EGVENAYNSWLTGTPSKQKVRKSRDGHVVERLDIVQEGESPNDLVLSIDQRIQQLAYREL 248

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +   A S   V+L++ TGEV++MV+ P Y+P+     +     NR     FE GS 
Sbjct: 249 KRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSYNPNSRDNLQTFRMRNRAMTDTFEPGST 308

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G     D+  T                    +T+  I   SSN+G ++
Sbjct: 309 IKPFVVAAALEAGTVKSTDVIPTSPGWMRLGGRQVRDATNYGDMTLARILAKSSNVGISK 368

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           +A ++ +Q        +GL S     L    A       +W      T+SFG+GL+ T L
Sbjct: 369 LALSIPVQQLLGTYQSMGLGSFSGINLTGESAGLIQDRHRWSDFERATLSFGYGLTATTL 428

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L N G L P + +     +       V+ +     +  ++      GG+G  
Sbjct: 429 QLARMYATLGNGGTLYPVSILKL---KKPPEGERVISQEVAHDVLQMMVGVTEKGGTGTL 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GK+GT++K +   Y D      F  V P  +P+  ++  ++ PK       
Sbjct: 486 AHIDGYPVAGKSGTSRKAVAGGYGDD-YVALFAGVAPVNNPKLAIVVVVNEPKGDL---Y 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G    P    ++  +  ML V+P
Sbjct: 542 YGGSVAGPAFAKVMSGALQMLNVEP 566


>gi|328542960|ref|YP_004303069.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [polymorphum gilvum
           SL003B-26A1]
 gi|326412706|gb|ADZ69769.1| Beta-lactamase, class A:Penicillin-binding protein, transpeptidase
           domain:ATP/GTP-binding site motif A [Polymorphum gilvum
           SL003B-26A1]
          Length = 571

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 239/531 (45%), Positives = 344/531 (64%), Gaps = 3/531 (0%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQY-GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           ++R+ + +     +Y+++  R++                 D    SRPD++DRNGEILAT
Sbjct: 32  RSRVYLAMAAFAAVYLLIGGRLVLLAQMDETPAAEFISAQDAVAASRPDLVDRNGEILAT 91

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T S+Y EP K++  +E++E L  V P L+S+ +R++LSS   F WL+R++SP QQ+ 
Sbjct: 92  DIRTASVYAEPRKIVDVEEVLEGLGSVFPELNSDTMRQRLSSRAGFIWLKREISPAQQQA 151

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           I   GLPG+GF  EK RFYP    A H+VG V+IDN+G+ G+EK +D   L+ + +    
Sbjct: 152 IHRLGLPGIGFLWEKQRFYPGGPTAGHIVGSVNIDNQGLAGMEKHVDDAWLSDLRSIGFA 211

Query: 250 E-KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
             + ++P+RLA+DLR+Q++V  EL +  ++Y A +   ++L+  TGEV++M S+PDYDP+
Sbjct: 212 SDRPMEPVRLAVDLRVQHVVRDELAKAMERYQAIAAVGIVLDAHTGEVVAMSSLPDYDPN 271

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHD 368
              +   +   NR + G+FEMGS+FK FT AM +DSG  +++D FD   PI+ G   I D
Sbjct: 272 NREEALDKDKLNRATGGVFEMGSVFKTFTTAMALDSGRVSMRDSFDATRPIRAGGRTISD 331

Query: 369 YHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP 428
           +H +NRIL++PEIF YSSNIG A++  A GI   + FL +LG+  +L TELPE   P  P
Sbjct: 332 FHGKNRILSVPEIFIYSSNIGTAKMMLATGIDEQQAFLKKLGMTERLPTELPENATPLLP 391

Query: 429 SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKK 488
            +W  + ++T+SFGHG+S TP+QTAVAAAAL+N GRLIPPTF+ R  + +  ++  V+ +
Sbjct: 392 KRWGELAAITVSFGHGISVTPMQTAVAAAALVNGGRLIPPTFLPRDEQTANSLATRVISE 451

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
              + MR L R  V  GSG+RA VPG+ VGGKTGTA+KV   RY      NSFL+ FP  
Sbjct: 452 EASRAMRYLFRLNVLSGSGKRAEVPGYLVGGKTGTAEKVENGRYVSNKRRNSFLSAFPMD 511

Query: 549 DPQYIVLSFMDSPKIKERN-QLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           DP+Y+VL  +D PK +      TAG+N AP+ G IIRR+A MLGV P F +
Sbjct: 512 DPRYVVLVVLDEPKPEREGLAATAGLNTAPVTGAIIRRAAPMLGVLPQFGE 562


>gi|90423691|ref|YP_532061.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB18]
 gi|90105705|gb|ABD87742.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB18]
          Length = 582

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 217/545 (39%), Positives = 334/545 (61%), Gaps = 6/545 (1%)

Query: 58  LFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-HPEPIAPSMNIDEYGMSR 116
           L   R       ++ R+G  ++    IY ++  R++    +        +   D    +R
Sbjct: 21  LLYGRNVDRSIKARARVGFAMLAFAAIYSVIGFRLVTIAVVGDSHGGRRAAAQDAVATAR 80

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
           PDI+DRNGE+LATD+ T SL+ EP ++I  DE +E L   LP+LD+  +R +LSS+  F 
Sbjct: 81  PDIVDRNGEVLATDVKTPSLFGEPRRIIDQDEAVELLTATLPDLDTAEVRERLSSKKGFV 140

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           WL+R+++P QQ+ I   G+PG+GF  E  R YP+    SH++G V+IDN+GI GIEK+LD
Sbjct: 141 WLKREITPLQQQEIRKLGIPGIGFLRENKRVYPSGPAVSHLIGLVNIDNQGIAGIEKWLD 200

Query: 237 MQGLTRVFTTNKGEKNL-QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
             GL  +         L +P+ LA+DLR+++ +  EL++ K+KY+A++   ++ NV TGE
Sbjct: 201 TNGLADLHRAGFASDRLQKPVELAVDLRVEHALRDELMKAKEKYSAKAASGLVSNVRTGE 260

Query: 296 VISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDT 355
           +++MVS+PD+DP+   +       NR++ G++EMGS FK  T+AM +DSG   +  L+D 
Sbjct: 261 IVAMVSLPDFDPNNPREAHDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKANLNTLYDA 320

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
           R  +  GK  IHD H   R +T+ E+F YSSNIGAA++A A G++ HK FL ++G + +L
Sbjct: 321 RGALHFGKFAIHDSHSLGRAITLTEVFTYSSNIGAARVALAQGVEAHKAFLKKVGQMDRL 380

Query: 416 ETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSR 475
            TELPE  AP  P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ R+ 
Sbjct: 381 RTELPESAAPILPKRWSELNTITISFGHGIAVAPLQAVMGINAMVNGGYLIPPTFLKRTE 440

Query: 476 EESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF--VPGFEVGGKTGTAQKVIKKRYS 533
           +++ ++ + V++K+T   +R L+R     G+ + A     G+ +GGKTGTA+KV+  RYS
Sbjct: 441 QQALEIGKRVVRKDTSDKIRYLMRLNAEIGTAKSAEAIAKGYYIGGKTGTAEKVVGGRYS 500

Query: 534 DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLG 591
                NSF A+ P  +PQ+ VL  +D PK         T+G N  P  G +I R A +LG
Sbjct: 501 KKQVLNSFTAILPADNPQFQVLVMLDEPKALPETHGFITSGWNAVPAGGKVIARIAPLLG 560

Query: 592 VKPVF 596
           + P F
Sbjct: 561 IAPRF 565


>gi|330820159|ref|YP_004349021.1| Penicillin-binding protein [Burkholderia gladioli BSR3]
 gi|327372154|gb|AEA63509.1| Penicillin-binding protein [Burkholderia gladioli BSR3]
          Length = 623

 Score =  380 bits (975), Expect = e-103,   Method: Composition-based stats.
 Identities = 133/547 (24%), Positives = 239/547 (43%), Gaps = 31/547 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E    R  I+DRNG +L
Sbjct: 30  RSKFVVILIFLAFAALIARAFWVQVANQDFYLGQGEKRYQRTIELDAMRGRIVDRNGAML 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V S       L  +L  + +  ++R+LS + +F  L+R++ P+  
Sbjct: 90  AVSLNTYEIWANPKQVDS--AAYGPLAKLL-EMPAAEVKRRLSVDKQFVLLKRQIDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-----LDMQGLTR 242
            R+    L G+    +  RFYP    A+HVVG+ +I++RG  G+E       L   G   
Sbjct: 147 ARLDKLDLAGITQIADSKRFYPEGESAAHVVGFTNIEDRGQEGVELAANGLLLGTAGQRE 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   + L +D R+Q + + +L       +A++   V+L+ 
Sbjct: 207 VIRDRLGRIISDTRPQVPARHGATVELTIDRRVQQLANAQLKAAVLANHAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            +GE++++ + P +DP++  +       NR     FE GS  K   +A+ ID G    + 
Sbjct: 267 RSGEILALANYPTFDPNDRSRLTGAQLRNRAVIDTFEPGSTVKPLVVALSIDEGKVRPQS 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           L +T          +      +  LT+ +  + SSN+  A+++  +  Q   +     G+
Sbjct: 327 LVNTSPGTWKIGPAVIHDTSNHGTLTVAQALQKSSNVALAKLSLNLSAQTIWDKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               +   P + +       +W+ I   T+++G+GLS + LQ A    A   +G L P  
Sbjct: 387 GHAPDLTFPGVASGRLRPYQRWRPIEQATMAYGYGLSMSLLQIAQMYTAYAGDGTLHPVR 446

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKVI 528
            +   +  + +    V +  T   +RS+L   V  GG+GR A V G+ VGGKTGTA+K +
Sbjct: 447 LLRDDQAPALQ-GHRVTRPETAAAIRSMLEMAVGEGGTGRAARVDGYRVGGKTGTARKQV 505

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y+       F  + P +DP+ IV   +D P  K       G    P+  +++  +  
Sbjct: 506 GASYAQGKYRALFAGMAPMSDPRVIVAVMIDEPSGK---GYYGGTVAGPVFSSVMGGTLQ 562

Query: 589 MLGVKPV 595
           +LGV P 
Sbjct: 563 LLGVPPD 569


>gi|294142810|ref|YP_003558788.1| peptidoglycan synthetase FtsI [Shewanella violacea DSS12]
 gi|11761329|dbj|BAB19196.1| FtsI [Shewanella violacea]
 gi|293329279|dbj|BAJ04010.1| peptidoglycan synthetase FtsI [Shewanella violacea DSS12]
          Length = 580

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 134/570 (23%), Positives = 244/570 (42%), Gaps = 39/570 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIH-----PEPIAPSMNIDEYGM 114
           Q +R++       R+ + +    +++  L  R      +       E    S+      +
Sbjct: 6   QAKRKQKPQLIHWRLYVVVAFVCLLFTSLIGRAAYIQILEPEKLRHESDMRSLRTTSREV 65

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPD-----EIIEKLQIVLPNLDSEMIRRKL 169
            R  I DRNGE+LA  +P  ++Y +P  V   +      + + L  VL     + I +++
Sbjct: 66  QRGLITDRNGEMLAISVPVKAVYADPKVVNDKNGFADMRLWQALADVLHE-PEDKILKRV 124

Query: 170 S--SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
               + +F +L+R+++P     I    LPG+  + E  R+YP +   + ++G  +ID+ G
Sbjct: 125 QDHPKRRFTYLKRQVTPAVADYIKKLKLPGIYLKAESRRYYPTSEIIAQLIGITNIDDVG 184

Query: 228 ITGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQE 271
           I GIE   +          +V  +  G            ++   + L++D RIQ + ++E
Sbjct: 185 IEGIENTYNDWLTGTPSKQKVRKSRDGHVVERLDMVQEGESPNDLVLSIDQRIQQLAYRE 244

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           +    +   A S   V+++V+TGEV++M + P Y+P+     +     NR     +E GS
Sbjct: 245 IKRVTEINKATSASIVVIDVNTGEVLAMANTPSYNPNSRDHLQSYRMRNRALTDAYEPGS 304

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
             K F +A  +++G      +F T          I         L++ E+  +SSN+G  
Sbjct: 305 TIKPFAVAAALEAGTINKNQIFKTSPGRIRIGGKIVRDGRNYGDLSLGEVLVHSSNVGMT 364

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTP 449
           QIA +M +Q    +   +GL +     L            +W      T+SFG+ L+ TP
Sbjct: 365 QIALSMPVQELLGYYQAMGLGNYSGINLAGESTGLLHDRRRWSEFERATLSFGYALTVTP 424

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGR 508
           LQ A   A L  +G L P + +     + +     V+     + +  +L      GG+  
Sbjct: 425 LQIARMYAMLGGKGILYPSSILKL---KKKPEGVQVISPEVAQHVMEMLIGVTEPGGTAT 481

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           +A + G+ V GKTGTA+K +   Y +      F  V P  +P+  +   ++ PK  +   
Sbjct: 482 KAHIEGYPVAGKTGTARKAVAGGYGED-YVAMFAGVAPVHNPRLAIAVVVNEPKGDK--- 537

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
              G    P    ++  +  ML V+P+  K
Sbjct: 538 YYGGDVAGPAFAKVMSGALQMLNVEPITSK 567


>gi|149201996|ref|ZP_01878970.1| Peptidoglycan glycosyltransferase [Roseovarius sp. TM1035]
 gi|149145044|gb|EDM33073.1| Peptidoglycan glycosyltransferase [Roseovarius sp. TM1035]
          Length = 594

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 171/576 (29%), Positives = 296/576 (51%), Gaps = 19/576 (3%)

Query: 37  RNMESGH-NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQY 95
           R +E+ +          E+ +   ++ R +    ++ R+ +   V ++ + ++  R+   
Sbjct: 11  RILEARNRGENPDAIERENLRLRHEEMRDRARRRAEGRLLVLAGVFILAFGVVGGRMGVL 70

Query: 96  GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQI 155
               P     S+   +    R DI+DR G ILAT+  T SLY +P ++I P++  +KL  
Sbjct: 71  AGTEPSEPTTSVAGAQIFAQRADIVDREGRILATNFDTHSLYAQPQQMIDPEQAADKLVE 130

Query: 156 VLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHAS 215
           + P+LD   + +  +   KF W+++KLSP+Q++ +   G PG+ F   + R YP    A+
Sbjct: 131 IFPDLDRARLIKDFTGPRKFLWIKKKLSPEQKQAVHDIGEPGLLFGPREMRLYPNGRLAA 190

Query: 216 HVVGYVDIDNRGITGIEKFLDMQGLTRVF--TTNKGEKNLQPIRLALDLRIQNIVHQELV 273
           HV+G       G+   E    + G+ R          +  +P+RL+LDL +Q  + + L 
Sbjct: 191 HVLGGTSFGREGVHAAELV-GVAGIERHQDARLRDPAQAHEPLRLSLDLSVQAAMERVLF 249

Query: 274 ENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGK------KEGWFNRISYGIF 327
              K  NA+    ++++  +GEV+++ S+PD+DP++               FNR   G++
Sbjct: 250 GGMKIMNAKGAAGILMDAHSGEVVAVASLPDFDPNDRPALPTSGSPSDSPLFNRAVQGVY 309

Query: 328 EMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSN 387
           E+GS  KVF +A  +D GL   + + +T++P++ GK  I D+      L+  ++   SSN
Sbjct: 310 ELGSTLKVFPVAQALDLGLINPETMINTKSPMQWGKFRIRDFKNYGPELSATKVIVKSSN 369

Query: 388 IGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI--QAPSYPSQWKRIHSLTISFGHGL 445
           +G A+IA  +G +  +EFL +LG ++ +  E+ E     P  P  W  + ++TIS+GHGL
Sbjct: 370 VGTARIALEIGAKRQREFLDQLGFIAPVHLEIAEASGSTPLLPKNWSDLSTMTISYGHGL 429

Query: 446 STTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGG 505
           S +P+  A   A + N GRL+ PT +   R+ +      ++ + T   MR +LR+ V+ G
Sbjct: 430 SISPMHLAAGYATIANGGRLVTPTLL---RDPTRAPGERIITEATSAAMRRMLRQVVSEG 486

Query: 506 SGRRAFVPGFEVGGKTGTAQKV--IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP-- 561
           +     VPG+ VGGKTGTA K       Y      ++F ++FP  DP+Y+++  +D P  
Sbjct: 487 TASLGEVPGYAVGGKTGTADKPKERGGGYHKDKVISTFASIFPAHDPKYVLVVTLDEPVE 546

Query: 562 KIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
                 + TAG    P+   IIRR A +LGV+P   
Sbjct: 547 TSGSEARRTAGWTAVPVAAEIIRRVAPLLGVRPEIE 582


>gi|193222411|emb|CAL62931.2| Peptidoglycan glycosyltransferase [Herminiimonas arsenicoxydans]
          Length = 589

 Score =  379 bits (974), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/548 (26%), Positives = 249/548 (45%), Gaps = 33/548 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +    ++ LA R +         +  +  +      E   +R  I DRNG++L
Sbjct: 33  RSRVVLFLIFAAFLALAGRALWLQGMSTDFLQKQGASRYARTLELPATRGKITDRNGQVL 92

Query: 128 ATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A+ IP  +++  P  V+  P E ++ L  +L ++    +RRKL S+  F +L+R++    
Sbjct: 93  ASSIPVRAVWAIPDDVLEAPKEKLQALAKLL-DMSERDLRRKLDSDRGFVYLKRQVELDT 151

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLT 241
             +IL  G+ G+  R E  R+YP     +H+VG+ +++++G  G+E           G  
Sbjct: 152 VDKILKLGIAGIDTRKEYKRYYPEGEVMAHIVGFTNVEDKGQEGMELAFQKTLVGVTGNR 211

Query: 242 RVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           RV     G             + + + L++D +IQ I    L E  + + A++ G V+L+
Sbjct: 212 RVIKDRLGRIVEDIESVREPHDGKDLTLSIDSKIQYIAFSALKEAVELHKAKAGGIVVLD 271

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TGEV+++ ++P Y+P+           NR+    FE GS  K FTIA+ +++   T  
Sbjct: 272 AKTGEVLALANLPTYNPNNRSVLTGAQLRNRVLTDTFEPGSTLKPFTIALALENKHITPN 331

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            +  T                   +L++ ++   SSN+G A+IA  M  Q   +    +G
Sbjct: 332 TMIQTAPGKLTIGKATIGDAHAGGLLSVSQVIEKSSNVGTAKIALEMEPQEMWDMFTSVG 391

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
              + +   P   A        W+ I   T+S+GHG+ST+ LQ A A      +G +IP 
Sbjct: 392 FGQQPKVGFPGAVAGRVRPYKSWRPIEQATMSYGHGISTSLLQIAHAYMIFARDGEMIPL 451

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQKV 527
           TF    R   + +S+ V+ +   +  R +L       G+  RA VPG+ V GKTGTA K+
Sbjct: 452 TF---QRSSDQPISQRVISEKNARLTRGMLEMAAGPTGTAPRAQVPGYRVAGKTGTAYKL 508

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
            K +Y       SF+   P +DP+ IV   +D P      +   G   AP+   +   + 
Sbjct: 509 EKGQYVR-KYVASFVGFAPVSDPRIIVAVMIDEP---AVGRHYGGQVAAPVFSVVTANAL 564

Query: 588 SMLGVKPV 595
             + V P 
Sbjct: 565 RSMNVAPD 572


>gi|163751818|ref|ZP_02159034.1| peptidoglycan synthetase FtsI [Shewanella benthica KT99]
 gi|161328303|gb|EDP99464.1| peptidoglycan synthetase FtsI [Shewanella benthica KT99]
          Length = 580

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 134/566 (23%), Positives = 242/566 (42%), Gaps = 39/566 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q +R++       R+ + +    +++  L  R           +  E    S+      +
Sbjct: 6   QAKRKQKPQLIHWRLYVVVGFVCLLFTSLIGRAAYIQIIEPEKLRHESDMRSLRTTSREV 65

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPD-----EIIEKLQIVLPNLDSEMIRRKL 169
            R  I DRNGE+LA  +P  ++Y +P  V          + + L  VL     + I  ++
Sbjct: 66  QRGLITDRNGEMLAVSVPVKAVYADPKVVYDKKGFADMRLWKALADVLHE-PEDKILSRI 124

Query: 170 --SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
             + + +F +L+R+++P     I    LPG+  + E  R+YP +   + ++G  +ID+ G
Sbjct: 125 KANPKRRFTYLKRQVNPAVADYIKKLKLPGIYLKAESRRYYPTSEITAQLIGITNIDDVG 184

Query: 228 ITGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQE 271
           I GIE   +          +V  +  G            ++   + L++D RIQ + ++E
Sbjct: 185 IEGIENTYNDWLTGTPSKQKVRKSRDGHVVERLDMVQEGESPNDLVLSIDQRIQQLAYRE 244

Query: 272 LVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGS 331
           +    K   A S   V+++V+TGE+++M + P Y+P+     +     NR     +E GS
Sbjct: 245 IKRVTKINQATSASIVVIDVNTGEILAMANTPSYNPNSRDNLQSYRMRNRALTDAYEPGS 304

Query: 332 IFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAA 391
             K F +A  +++G      +F T          I         L++ E+  +SSN+G  
Sbjct: 305 TIKPFVVAAALEAGAIDKDQIFKTSPGRIRIGGKIVRDGRNYGDLSLGEVLVHSSNVGMT 364

Query: 392 QIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTP 449
           QIA +M +Q    +   +GL +     L            +W      T+SFG+ L+ TP
Sbjct: 365 QIALSMPVQELLGYFQAMGLGNYSGINLAGESTGLLHDRRRWSEFERATLSFGYALTVTP 424

Query: 450 LQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGR 508
           LQ A   A L  +G L P + +   +   +     V+     + +  +L      GG+ R
Sbjct: 425 LQIARMYAMLGAKGVLYPSSILKLKQ---KPEGVQVISAEVAQLVMEMLIGVTEAGGTAR 481

Query: 509 RAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ 568
           +A + G+ V GKTGTA+K +   Y +      F  V P  +P+  +   ++ PK  +   
Sbjct: 482 KAHIEGYPVAGKTGTARKAVAGGYGED-YVAMFAGVAPVHNPRLAIAVVVNEPKGDK--- 537

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKP 594
              G    P    ++  +  ML V+P
Sbjct: 538 YYGGDVAGPAFAKVMSGALQMLNVEP 563


>gi|91228508|ref|ZP_01262430.1| penicillin-binding protein 3 [Vibrio alginolyticus 12G01]
 gi|91187942|gb|EAS74252.1| penicillin-binding protein 3 [Vibrio alginolyticus 12G01]
          Length = 597

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/579 (25%), Positives = 252/579 (43%), Gaps = 38/579 (6%)

Query: 49  GCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPI 103
           G    D + +        +   + R  + +      + +L  R+     I P     +  
Sbjct: 25  GDKKNDNKAVKVAVEESFL--IRWRFHLLLFFVFCAFALLVARVAYIQIIEPDNLIKQGD 82

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLP 158
             S+ +     +R  I DRNGE LA  +P  +++ +P  +   + +        L  VL 
Sbjct: 83  LRSVRVKSIPSARGIISDRNGEPLAVSVPVEAVWADPATIFKENALSQTKSWHALADVLG 142

Query: 159 NLDSEMIRR-KLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHV 217
                +I + K + + +F +L+R++SP     I    LPGVG + E  R+YPA   ++H+
Sbjct: 143 IDRQGLIDKIKRNEKRRFIYLQRQVSPAMANYIRELKLPGVGLKSESRRYYPAGEVSAHL 202

Query: 218 VGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE----------KNLQPIRLALDL 262
           VG   ID  G+ G+E+  D       G   +     G           +  + ++L +D 
Sbjct: 203 VGVTGIDGHGLEGVERSYDEWLTGAAGKKTIRKDRYGRVVENIAWQDKQEGKSLQLTIDQ 262

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           R+Q I ++ + +    + A S   V+L+V TG V++MV+ P Y+P+     +     NR+
Sbjct: 263 RLQAIAYRAIKQAVADHRATSGSVVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYQMRNRV 322

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIF 382
                E GS  K F I   +++G+     + DT N +            +    ++  I 
Sbjct: 323 ITDSMEPGSTIKPFVILAALENGIADKDTIVDTGNGVLRLGGSRVRDVSRVGKASLTTIL 382

Query: 383 RYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTIS 440
           + SSNIG  ++A  M ++        +G        L       +P  ++W  I   TI+
Sbjct: 383 KKSSNIGVTKLAMQMPVEALLGLYSSVGFGELSGLNLVGEVTGIFPTRTRWSPIERATIA 442

Query: 441 FGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE 500
           FG+GLS TP+Q A A A L N G+  P   +  +  +   +SR V+     + +  +L  
Sbjct: 443 FGYGLSITPIQLAHAYATLGNLGKYEPIHIIESNDHD---MSRQVVSAKYARQVLDMLET 499

Query: 501 GVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
               GGS RRA VPG+ VG KTGT++K     YSD         + P +DP+  ++  ++
Sbjct: 500 VTQKGGSARRAAVPGYRVGAKTGTSRKASAGGYSDE-YITYTAGLAPVSDPRIALVVIVN 558

Query: 560 SPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            P+  +      G   +P+   I++ +  +L V P   K
Sbjct: 559 EPQGDD---YYGGSVASPVFSEIMKGALQILNVAPDENK 594


>gi|113971904|ref|YP_735697.1| peptidoglycan synthetase FtsI [Shewanella sp. MR-4]
 gi|117922181|ref|YP_871373.1| peptidoglycan synthetase FtsI [Shewanella sp. ANA-3]
 gi|113886588|gb|ABI40640.1| peptidoglycan synthetase FtsI [Shewanella sp. MR-4]
 gi|117614513|gb|ABK49967.1| peptidoglycan synthetase FtsI [Shewanella sp. ANA-3]
          Length = 583

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 129/565 (22%), Positives = 236/565 (41%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q  +++       R+ + +     ++  L  R           +  E    ++      +
Sbjct: 9   QASKKQKPQLIHWRLYVVVGFVFAMFSSLVGRAAYIQIIEPDKLRHESDMRTLRTTSREV 68

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRR-K 168
            R  I DRNG++LA  +P  +++ +P +V   +        + L  VL     +++ + +
Sbjct: 69  QRGLITDRNGDMLAVSVPVRAVWADPKQVNDNNGFTDMRRWQALADVLHEPVEDVLEKVR 128

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P     I    LPGV  + E  R+YP     + ++G  +ID+ GI
Sbjct: 129 SNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGITNIDDVGI 188

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            G+E   +          +V  +  G            ++   + L++D RIQ + ++EL
Sbjct: 189 EGVENAYNSWLTGTPSKQKVRKSRDGHVVERLDIVQEGESPNDLVLSIDQRIQQLAYREL 248

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +   A S   V+L++ TGEV++MV+ P Y+P+     +     NR     FE GS 
Sbjct: 249 KRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSYNPNSRDNLQTFRMRNRAMTDTFEPGST 308

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G     D+  T                    +T+  I   SSN+G ++
Sbjct: 309 IKPFVVAAALEAGTVKSTDVIPTSPGWMRLGGRQVRDATNYGDMTLARILAKSSNVGISK 368

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           +A ++ +Q        +GL S     L    A       +W      T+SFG+GL+ T L
Sbjct: 369 LALSIPVQQLLGTYQSMGLGSFSGINLTGESAGLIQDRHRWSDFERATLSFGYGLTATTL 428

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L N G L P + +     +       V+ +     +  ++      GG+G  
Sbjct: 429 QLARMYATLGNGGTLYPVSILKL---KKPPEGERVISQEVAHDVLQMMVGVTEKGGTGTL 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GK+GT++K +   Y D      F  V P  +P+  ++  ++ PK       
Sbjct: 486 AHIDGYPVAGKSGTSRKAVAGGYGDD-YVALFAGVAPVNNPKLAIVVVVNEPKGDL---Y 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G    P    ++  +  ML V+P
Sbjct: 542 YGGSVAGPAFAKVMSGALQMLNVEP 566


>gi|269967391|ref|ZP_06181451.1| penicillin-binding protein 3 [Vibrio alginolyticus 40B]
 gi|269827979|gb|EEZ82253.1| penicillin-binding protein 3 [Vibrio alginolyticus 40B]
          Length = 597

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/579 (25%), Positives = 252/579 (43%), Gaps = 38/579 (6%)

Query: 49  GCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPI 103
           G    D + +        +   + R  + +      + +L  R+     I P     +  
Sbjct: 25  GDKKTDNKAVKVAVEESFL--IRWRFHLLLFFVFCAFALLVARVAYIQIIEPDNLIKQGD 82

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLP 158
             S+ +     +R  I DRNGE LA  +P  +++ +P  +   + +        L  VL 
Sbjct: 83  LRSVRVKSIPSARGIISDRNGEPLAVSVPVEAVWADPATIFKENALSQTKSWHALADVLG 142

Query: 159 NLDSEMIRR-KLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHV 217
                +I + K + + +F +L+R++SP     I    LPGVG + E  R+YPA   ++H+
Sbjct: 143 IDRQGLIDKIKRNEKRRFIYLQRQVSPAMANYIRELKLPGVGLKSESRRYYPAGEVSAHL 202

Query: 218 VGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE----------KNLQPIRLALDL 262
           VG   ID  G+ G+E+  D       G   +     G           +  + ++L +D 
Sbjct: 203 VGVTGIDGHGLEGVERSYDEWLTGAAGKKTIRKDRYGRVVENIAWQDKQEGKSLQLTIDQ 262

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           R+Q I ++ + +    + A S   V+L+V TG V++MV+ P Y+P+     +     NR+
Sbjct: 263 RLQAIAYRAIKQAVADHRATSGSVVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYQMRNRV 322

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIF 382
                E GS  K F I   +++G+     + DT N +            +    ++  I 
Sbjct: 323 ITDSMEPGSTIKPFVILAALENGIADKDTIVDTGNGVLRLGGSRVRDVSRVGKASLTTIL 382

Query: 383 RYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTIS 440
           + SSNIG  ++A  M ++        +G        L       +P  ++W  I   TI+
Sbjct: 383 KKSSNIGVTKLAMQMPVEALLGLYSSVGFGELSGLNLVGEVTGIFPTRTRWSPIERATIA 442

Query: 441 FGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE 500
           FG+GLS TP+Q A A A L N G+  P   +  +  +   +SR V+     + +  +L  
Sbjct: 443 FGYGLSITPIQLAHAYATLGNLGKYEPIHIIESNDHD---MSRQVVSAKYARQVLDMLET 499

Query: 501 GVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
               GGS RRA VPG+ VG KTGT++K     YSD         + P +DP+  ++  ++
Sbjct: 500 VTQKGGSARRAAVPGYRVGAKTGTSRKASAGGYSDE-YITYTAGLAPVSDPRIALVVIVN 558

Query: 560 SPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            P+  +      G   +P+   I++ +  +L V P   K
Sbjct: 559 EPQGDD---YYGGSVASPVFSEIMKGALQILNVAPDENK 594


>gi|310659204|ref|YP_003936925.1| transpeptidase involved in septal peptidoglycan synthesis
           (penicillin-binding protein 3) [Clostridium sticklandii
           DSM 519]
 gi|308825982|emb|CBH22020.1| transpeptidase involved in septal peptidoglycan synthesis
           (penicillin-binding protein 3) [Clostridium sticklandii]
          Length = 719

 Score =  379 bits (973), Expect = e-103,   Method: Composition-based stats.
 Identities = 152/587 (25%), Positives = 245/587 (41%), Gaps = 60/587 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPD 118
           +KV+   K RI ++  + L     L +R+             E +            R  
Sbjct: 3   KKVVDIKKTRIKISAFLFLTAIFALIVRLGYIQIVAGPTYSQEAMKQQYKDTVIYPMRGI 62

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVIS--PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
           I DR G+ LA  +P   L++EP  V     D  IE L  +L  +D E I++ LSS  K  
Sbjct: 63  IYDRTGKELAVSVPKNDLWIEPDNVKDSEKDATIETLSKIL-EIDKEEIKKSLSSGKKRF 121

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
            L + +   + K+I    + G+ F     R+YP    AS+V+G+V  +N G+ G+E   +
Sbjct: 122 ALAKNIDSDKVKKIREAKISGIWFEQSSRRYYPYGKFASYVIGHVSNENVGLAGVEASFN 181

Query: 237 M-----QGLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKY 279
                  G        +  +            N + + L +D  IQ+ + + + +     
Sbjct: 182 TYLKGIPGREIFIKDARNREISTNSLSYNEPVNGRNLILTIDEVIQHHMERAVEQALVDN 241

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKE---------------------GW 318
           NA+ V  + ++  TG+++ MVS PDYDP+++                            W
Sbjct: 242 NAKRVIAIAMDPQTGDILGMVSKPDYDPNDSRTPLYPLFQEKIDAALSDEEKLKELYTMW 301

Query: 319 FNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDY-HPQNRILT 377
            N     I+E GS FKV T +  ++ GL   ++ F+     +V    I ++       +T
Sbjct: 302 RNPAVNDIYEPGSPFKVVTASAALEEGLVYPEEWFNDIGYTEVAGRKIKNWTSKPFGSIT 361

Query: 378 IPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIH 435
             +    S N    QIA  +G Q   E++   G        LP        +  +   + 
Sbjct: 362 FTKAVEQSVNSTFIQIAQRLGAQKFTEYITAFGFGKPTGIALPGEGVGMQYTVSKMGPVE 421

Query: 436 SLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES--------EKVSRIVLK 487
             T SFG  +S TP+Q   A +A+ N+G+L+ P  +    +E+         +V +  + 
Sbjct: 422 LATTSFGQSISVTPIQMVSAISAVANDGKLMKPRIVKEVTDENGEIVESFEPEVVKRAVS 481

Query: 488 KNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPT 547
           K T   M +++   V  GSG    + G+ +GGKTGTAQKVI  +Y       SF AV P 
Sbjct: 482 KTTADQMLAIMESVVANGSGSATKIDGYRIGGKTGTAQKVIDGKYQSGYYIASFSAVAPI 541

Query: 548 TDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
            DPQ  +L  +D PK              P+V  I++     LGVKP
Sbjct: 542 EDPQVALLVIVDEPKGAS---YFGSTVSGPVVRQIMQDILRYLGVKP 585


>gi|171057207|ref|YP_001789556.1| peptidoglycan glycosyltransferase [Leptothrix cholodnii SP-6]
 gi|170774652|gb|ACB32791.1| Peptidoglycan glycosyltransferase [Leptothrix cholodnii SP-6]
          Length = 614

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 135/549 (24%), Positives = 236/549 (42%), Gaps = 31/549 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + ++   V +++L  R +            +  +      E   SR  I DR+G+IL
Sbjct: 54  RARLVVLGVGVGFLVLLGRAVYIQVIGTEFYQKQGESRYARTFELPASRGRITDRHGQIL 113

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  +P  S++  P       +  + L  +L     E +  +L+    F WLRR++     
Sbjct: 114 AASVPAPSIWAIPKDFRPDAKQQQALLRLLGMTSRE-LATRLADNPNFVWLRRQVDESVA 172

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            ++ + G+ G+  + E  R YP    A+HVVG+ +++ RG  GIE     +     G   
Sbjct: 173 AQVKALGIKGLHQQREFRRQYPEGESAAHVVGFTNLEERGQEGIELAFQKELEGRAGSRS 232

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G             +   + LALD ++Q   +Q + +   ++NA++   V+L+V
Sbjct: 233 VVRDRLGRIVEDIGESREPVDGSDLALALDSKVQFFAYQRVRDAVLEHNAKAGSVVVLDV 292

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
            TGEV+++ + P Y P E          NR     FE GS  K F  A+ + +G  T   
Sbjct: 293 LTGEVLALANYPSYVPGERQGLSGAQLRNRAVTDTFEPGSTMKPFIAALALQTGRVTPDT 352

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           +  T                 + +L++ ++ + SSN+G  ++A  M  +   E    +G+
Sbjct: 353 VIQTAPGRIHFGSATISDSHPHGLLSVEQVIQKSSNVGTVKMAMQMEPREMWEMFSSVGI 412

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
             K +   P + +        W+ +   T+S+G+GLS + LQ A A      +G+L+P T
Sbjct: 413 GQKPQLAFPGLASGRLRPYKSWRPVEQATMSYGYGLSVSLLQLARAYTVFARDGQLMPVT 472

Query: 470 FMIRSREESEKVSRIVLKKNTVKTMRSLL-REGVTGGSGRRAFVPGFEVGGKTGTAQKVI 528
            +     E       V      +++R +L      GG+  +A   G+ VGGKTGTA K  
Sbjct: 473 MLK---NEVPAAGVQVFSPEVARSVRHMLNMAAAPGGTAPKAQAIGYSVGGKTGTAHKQE 529

Query: 529 KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSAS 588
              Y        F+ + P ++P+ +V   +D P      +   G   AP+   ++++S  
Sbjct: 530 GGSYVSNKYRAWFVGIAPVSNPRIVVAVMVDEP---GNGRYFGGDVAAPVFSQVVQQSLR 586

Query: 589 MLGVKPVFL 597
           MLGV P   
Sbjct: 587 MLGVPPDLE 595


>gi|304386667|ref|ZP_07368949.1| cell division protein FtsI/penicillin-binding protein [Neisseria
           meningitidis ATCC 13091]
 gi|467781|emb|CAA53903.1| penicillin-binding protein 2 [Neisseria sicca]
 gi|31296597|gb|AAP46591.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|254671180|emb|CBA08301.1| peptidoglycan synthetase precursor [Neisseria meningitidis
           alpha153]
 gi|304339252|gb|EFM05330.1| cell division protein FtsI/penicillin-binding protein [Neisseria
           meningitidis ATCC 13091]
          Length = 581

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|212219399|ref|YP_002306186.1| cell division protein [Coxiella burnetii CbuK_Q154]
 gi|212013661|gb|ACJ21041.1| division specific D,D-transpeptidase [Coxiella burnetii CbuK_Q154]
          Length = 552

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 145/551 (26%), Positives = 238/551 (43%), Gaps = 34/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R      +  V    L  R+I    +       +  A ++ +      R  I DR G  L
Sbjct: 10  RFYALWFLLSVAVAGLLWRLIDLNVLDRSFLLRQSKARALRVVNIPAYRGMITDRLGVPL 69

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQWLRRKLSPQ 185
           A   P  S+++ P    +    +++L  +L +L    I+++     + +F +L+R   P 
Sbjct: 70  AISTPVDSVWINPQLFQATPIQLKQLAHLL-HLPLSFIKKRAKKMGDRQFVYLKRGNPPF 128

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             K+I    + GV F+ E  R+YP    A+HVVG  +ID++G  G+E   +       G 
Sbjct: 129 VAKQIRGLNISGVFFQREYRRYYPEGEVAAHVVGLTNIDDQGQEGLELAYNRWLGGTPGK 188

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G                 + L++D RIQ + ++ L E    Y+A+S   V+L
Sbjct: 189 MEVLKDRLGHVIADVAVLQKPAQGHDLNLSIDHRIQYLAYKALEETVSTYHAQSGSVVVL 248

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGE+++MV+ P Y+P+         + NR    +FE GS+ K FTIA+ ++SG +  
Sbjct: 249 DVKTGEILAMVNQPSYNPNNRPTDHDGRYRNRAVTDMFEPGSVNKPFTIALALESGRYKP 308

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               +T                   ++T+ ++ + SSNI AA+I  ++  Q +   L+  
Sbjct: 309 DTQINTNPGWMKIGGYRIHDDLNYGVVTLTQLLQKSSNIAAAKILLSLTPQHYYTLLHAF 368

Query: 410 GLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G   +  +  P            W      T+++G+GL+ T LQ A   A L   G   P
Sbjct: 369 GFGERTTSGFPGESNGALIPYETWVPSVVATLAYGYGLAVTTLQLAQGYAVLAAGGIRKP 428

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            TF+  +          VL +N  KT+  +L   V  GG+G RA V G+ V GKTGTA  
Sbjct: 429 VTFVKVNES---PQGVRVLPENVAKTVIKMLETVVQKGGTGTRAQVYGYSVAGKTGTAYI 485

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
                Y       SF+ + P  +P+ +V   +  P+     Q   GI  AP+   I+  +
Sbjct: 486 AGPNGYFKHRYVASFVGIAPANNPRLVVAVVIRDPQ----GQHFGGIVAAPLFSKIMSGA 541

Query: 587 ASMLGVKPVFL 597
             +L V P   
Sbjct: 542 LRILDVPPDNS 552


>gi|31296595|gb|AAP46590.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296613|gb|AAP46599.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  379 bits (972), Expect = e-103,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPIDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|153207160|ref|ZP_01945939.1| penicillin-binding protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165918401|ref|ZP_02218487.1| penicillin-binding protein [Coxiella burnetii RSA 334]
 gi|120576821|gb|EAX33445.1| penicillin-binding protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165917907|gb|EDR36511.1| penicillin-binding protein [Coxiella burnetii RSA 334]
          Length = 548

 Score =  379 bits (972), Expect = e-102,   Method: Composition-based stats.
 Identities = 145/551 (26%), Positives = 238/551 (43%), Gaps = 34/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R      +  V    L  R+I    +       +  A ++ +      R  I DR G  L
Sbjct: 6   RFYALWFLLSVAVAGLLWRLIDLNVLDRSFLLRQSKARALRVVNIPAYRGMITDRLGVPL 65

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQWLRRKLSPQ 185
           A   P  S+++ P    +    +++L  +L +L    I+++     + +F +L+R   P 
Sbjct: 66  AISTPVDSVWINPQLFQATPIQLKQLAHLL-HLPLSFIKKRAKKMGDRQFVYLKRGNPPF 124

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             K+I    + GV F+ E  R+YP    A+HVVG  +ID++G  G+E   +       G 
Sbjct: 125 VAKQIRGLNISGVFFQREYRRYYPEGEVAAHVVGLTNIDDQGQEGLELAYNRWLGGTPGK 184

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G                 + L++D RIQ + ++ L E    Y+A+S   V+L
Sbjct: 185 MEVLKDRLGHVIADVAVLQKPAQGHDLNLSIDHRIQYLAYKALEETVSTYHAQSGSVVVL 244

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGE+++MV+ P Y+P+         + NR    +FE GS+ K FTIA+ ++SG +  
Sbjct: 245 DVKTGEILAMVNQPSYNPNNRPTDHDGRYRNRAVTDMFEPGSVNKPFTIALALESGRYKP 304

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               +T                   ++T+ ++ + SSNI AA+I  ++  Q +   L+  
Sbjct: 305 DTQINTNPGWMKIGGYRIHDDLNYGVVTLTQLLQKSSNIAAAKILLSLTPQHYYTLLHAF 364

Query: 410 GLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G   +  +  P            W      T+++G+GL+ T LQ A   A L   G   P
Sbjct: 365 GFGERTTSGFPGESNGALIPYETWVPSVVATLAYGYGLAVTTLQLAQGYAVLAAGGIRKP 424

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            TF+  +          VL +N  KT+  +L   V  GG+G RA V G+ V GKTGTA  
Sbjct: 425 VTFVKVNES---PQGVRVLPENVAKTVIKMLETVVQKGGTGTRAQVYGYSVAGKTGTAYI 481

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
                Y       SF+ + P  +P+ +V   +  P+     Q   GI  AP+   I+  +
Sbjct: 482 AGPNGYFKHRYVASFVGIAPANNPRLVVAVVIRDPQ----GQHFGGIVAAPLFSKIMSGA 537

Query: 587 ASMLGVKPVFL 597
             +L V P   
Sbjct: 538 LRILDVPPDNS 548


>gi|146281462|ref|YP_001171615.1| penicillin-binding protein 3 [Pseudomonas stutzeri A1501]
 gi|145569667|gb|ABP78773.1| penicillin-binding protein 3 [Pseudomonas stutzeri A1501]
          Length = 575

 Score =  379 bits (972), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/537 (27%), Positives = 259/537 (48%), Gaps = 30/537 (5%)

Query: 82  LVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPH 141
           ++ + I+ ++++  G +  +  A S+        R  I DRNGE LA   P  +L+  P 
Sbjct: 25  VIAWRIVDLQVMDQGFLKGQGDARSVRHIPIPAHRGLITDRNGEPLAVSTPVTTLWGNPK 84

Query: 142 KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLSPQQQKRILSFGLPGVG 199
           ++ +      +L   L   D+ ++  +L S+   +F +L R L+P+Q + IL   +PGV 
Sbjct: 85  ELQAARARWPELAKALGQ-DAAVLSERLQSQASREFMYLVRGLTPEQGQEILDLKIPGVY 143

Query: 200 FRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE---- 250
            + E  RFYPA   A+HVVG+ DID+RG  G+E   D       G  +V    +G     
Sbjct: 144 AQEEFRRFYPAGEVAAHVVGFTDIDDRGREGMELAYDEWLAGVPGKRQVLKDRRGRLIKD 203

Query: 251 -------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                  K  + + L++DLR+Q + H EL     +Y A++   V+++V TGE+++M + P
Sbjct: 204 VQVTKNAKPGKAMALSIDLRLQYLAHSELRNVVHEYGAKAASLVMVDVKTGEILAMANQP 263

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
            Y+P+     +     NR    +FE GS  K F+IA  + +G +    + +T        
Sbjct: 264 TYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSIAAALATGKYQPDSVVNTLPGWMRIG 323

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
                   +  +L++  I   SSN+G ++IA  +G +     + + G         P  +
Sbjct: 324 RYTIRDVSRGGMLSLTGILMKSSNVGISKIALDIGAEPVYAVMQQAGFGQDTGLGFPGER 383

Query: 424 APS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
             +     +W+   + ++++G+GLS T +Q A A A L N+G  +P + +   R +    
Sbjct: 384 VGNLPNHRKWRDAETASLAYGYGLSVTAVQLAHAYAVLGNQGTNVPLSLLRLDRAQDGV- 442

Query: 482 SRIVLKKNTVKTMRSLLREGV--TGGSGRRAFVPGFEVGGKTGTAQKVIK-KRYSDTLNF 538
              V+ K    T+  +LR  V   GG G RA VPG+ VGGK+GTA+K+     Y+     
Sbjct: 443 --QVIDKQISGTVLQMLRAVVEEEGGGGARAKVPGYHVGGKSGTAKKISGTGGYTKDAYR 500

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           + F  V P ++P+   +  +D P    + Q   G+  AP+ G ++ R+  ++ V P 
Sbjct: 501 SFFAGVAPLSNPRIAAVVVVDEP---SKGQYYGGLVAAPVFGKVMARALRLMNVAPD 554


>gi|302036126|ref|YP_003796448.1| peptidoglycan glycosyltransferase [Candidatus Nitrospira defluvii]
 gi|300604190|emb|CBK40522.1| Peptidoglycan glycosyltransferase [Candidatus Nitrospira defluvii]
          Length = 572

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 152/562 (27%), Positives = 252/562 (44%), Gaps = 39/562 (6%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDII 120
                ++R  +     +V ++++ +R++    +       +             +R  I 
Sbjct: 2   ASTSFRSRRIVVACGLVVAFVLVIVRLVNLQVMQSAELTVKADRQHQKNVTLEGARGTIY 61

Query: 121 DRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           DRN ++LA ++   S++  P  + +P      L  +L ++ +  + +KL  E  F WL R
Sbjct: 62  DRNSKVLAMNMDVPSVFGVPASLGNPGVTARNLSPIL-HVKATELEKKLKQEKHFVWLAR 120

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM--Q 238
           KL P+Q +R+    L GVG  +E  RFYP     SHV+G+  +D+RG+ G+E   +   +
Sbjct: 121 KLEPEQGRRLERLALDGVGVVMEGRRFYPKGPLLSHVLGFAGMDDRGLEGVELRYEQYLR 180

Query: 239 GLTRVFT---------------TNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
           G  R                    +G      + L +D  IQ I  +EL E   + NA+S
Sbjct: 181 GEKRAVVLQRDALGRAVFPKGLNEEGAAAGHSLTLTVDEVIQYIAEKELDEAVSRSNAKS 240

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              ++++  TG V++M   P +DP+       + W NR     +E GS  K    A  ++
Sbjct: 241 GTIIVMDPKTGAVLAMAVSPRFDPNTVGALAPDRWRNRALTDTYEPGSTMKAVIAAAALE 300

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
             + T   +    N      + +   H ++  +T  ++ + SSNIGAA++  A+G     
Sbjct: 301 EKVMTPGSMIYGENGQFSIANTVIHDHEKSGWITFAQMIQKSSNIGAAKVGMALGEWRVF 360

Query: 404 EFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           ++L   G   K   +LP         P QW +    +IS G  +  TPLQ   A +A+ N
Sbjct: 361 DYLKEFGFGDKTGIDLPGEAVGLLRGPRQWGKRSLASISMGQEVGVTPLQMVTAVSAIAN 420

Query: 462 EGRLIPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
            G L+ P  +   R            +  R V+  +T +T+ +LL   VT G+G +A +P
Sbjct: 421 GGVLMKPFVVSEIRNAKGQLVAQTMPQAKRRVISSDTARTLTTLLEGVVTNGTGGKAAIP 480

Query: 514 GFEVGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           GF V GKTGTAQKV      YS TL   SFL   P  DP+  ++  +D P    R +   
Sbjct: 481 GFRVAGKTGTAQKVDPRTGAYSSTLLVGSFLGYVPAEDPRLAMIVVIDEP----RGEGWG 536

Query: 572 GINVAPMVGNIIRRSASMLGVK 593
           G+  AP+   +  +  + LGV 
Sbjct: 537 GVVAAPVFRRVGEQVLNYLGVA 558


>gi|269926719|ref|YP_003323342.1| Peptidoglycan glycosyltransferase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790379|gb|ACZ42520.1| Peptidoglycan glycosyltransferase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 582

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 134/558 (24%), Positives = 245/558 (43%), Gaps = 40/558 (7%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R+   + V L   ++L  R+     I       +       + E    R  I DRNG+IL
Sbjct: 17  RLKFVLWVLLGFALVLVGRLFYLQVIQGSFLASKAEQAHQLVREIDPPRGRIYDRNGKIL 76

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A++I  + LY  P  V  P+   ++L   L  + ++ I  KL     +  +  +L+ +Q+
Sbjct: 77  ASNITVYRLYATPQYVEDPESAAQQLSP-LIGVPAKEIADKLKQGVPWVSIATRLTTEQK 135

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD----------- 236
           ++I +  +PG+GF  + +R YP  S A+ V+G+ + +N G  G+E   +           
Sbjct: 136 EKIEALHIPGIGFEPQTARAYPNGSLAAQVLGFTNFENVGSYGVEGEYNNYLSGEPGKMI 195

Query: 237 ------MQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
                    +          K    ++L +D  +Q    + L +  K+  A+    ++++
Sbjct: 196 AEQDPAGNWIPVAQRQVIPPKPGADVQLTIDATVQYYAEEVLQKTVKEQKAKGGSIIVMD 255

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI-SYGIFEMGSIFKVFTIAMGIDSGLFTV 349
             TGE+++M S P ++P E +  +    F        +E GS FK+ T+A G+ +G+ T 
Sbjct: 256 PYTGEILAMASYPTFNPQEFYNVRNTSVFANPAISSAYEPGSTFKIITMAAGLAAGVITP 315

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRIL-TIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
               D +  + V  + IH++  +     ++ E+   S+N+GAA ++  +G       +  
Sbjct: 316 DTRIDDKGYLNVYGYTIHNWDGRPHPNESMTEVLMNSANVGAAYVSTKLGEDRFYRKVQD 375

Query: 409 LGLLSKLETELPEIQAPS----YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
            G  +K   +L               W  I+  T ++G G++ TP+Q   A AA+ N G 
Sbjct: 376 FGFGAKTGIDLQGEATGILVLPSSKNWSPINLYTNAYGQGIAVTPIQLITAQAAVANGGL 435

Query: 465 LIPPTFM-------IRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           L+ P  +          +E    V R VL +   +T++S+++  V  G  + A +PG+ V
Sbjct: 436 LMRPYVVSKIERNGKVIKENRPTVVRRVLSRQVAETLKSMMKTVVEEGEYQVARIPGYSV 495

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           GGKTGTA   +  +Y   +   SF+   P   P++I L  +D PK             AP
Sbjct: 496 GGKTGTASVPVNGQYDPNVTIASFIGYSPVKHPKFIALIKIDQPK----GSRWGSEVAAP 551

Query: 578 MVGNIIRRSASMLGVKPV 595
               + R+  +   + P 
Sbjct: 552 AFKELARKLYTYYNIPPD 569


>gi|327479637|gb|AEA82947.1| penicillin-binding protein 3 [Pseudomonas stutzeri DSM 4166]
          Length = 576

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/537 (27%), Positives = 259/537 (48%), Gaps = 30/537 (5%)

Query: 82  LVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPH 141
           ++ + I+ ++++  G +  +  A S+        R  I DRNGE LA   P  +L+  P 
Sbjct: 26  VIAWRIVDLQVMDQGFLKGQGDARSVRHIPIPAHRGLITDRNGEPLAVSTPVTTLWGNPK 85

Query: 142 KVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLSPQQQKRILSFGLPGVG 199
           ++ +      +L   L   D+ ++  +L S+   +F +L R L+P+Q + IL   +PGV 
Sbjct: 86  ELQAARARWPELAKALGQ-DAAVLSERLQSQASREFMYLVRGLTPEQGQEILDLKIPGVY 144

Query: 200 FRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE---- 250
            + E  RFYPA   A+HVVG+ DID+RG  G+E   D       G  +V    +G     
Sbjct: 145 AQEEFRRFYPAGEVAAHVVGFTDIDDRGREGMELAYDEWLAGVPGKRQVLKDRRGRLIKD 204

Query: 251 -------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
                  K  + + L++DLR+Q + H EL     +Y A++   V+++V TGE+++M + P
Sbjct: 205 VQVTKNAKPGKAMALSIDLRLQYLAHSELRNVVHEYGAKAASLVMVDVKTGEILAMANQP 264

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
            Y+P+     +     NR    +FE GS  K F+IA  + +G +    + +T        
Sbjct: 265 TYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSIAAALATGKYQPDSVVNTLPGWMRIG 324

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
                   +  +L++  I   SSN+G ++IA  +G +     + + G         P  +
Sbjct: 325 RYTIRDVSRGGMLSLTGILMKSSNVGISKIALDIGAEPVYAVMQQAGFGQDTGLGFPGER 384

Query: 424 APS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKV 481
             +     +W+   + ++++G+GLS T +Q A A A L N+G  +P + +   R +    
Sbjct: 385 VGNLPNHRKWRDAETASLAYGYGLSVTAVQLAHAYAVLGNQGTNVPLSLLRLDRAQDGV- 443

Query: 482 SRIVLKKNTVKTMRSLLREGV--TGGSGRRAFVPGFEVGGKTGTAQKVIK-KRYSDTLNF 538
              V+ K    T+  +LR  V   GG G RA VPG+ VGGK+GTA+K+     Y+     
Sbjct: 444 --QVIDKQISGTVLQMLRAVVEEEGGGGARAKVPGYHVGGKSGTAKKISGTGGYTKDAYR 501

Query: 539 NSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           + F  V P ++P+   +  +D P    + Q   G+  AP+ G ++ R+  ++ V P 
Sbjct: 502 SFFAGVAPLSNPRIAAVVVVDEP---SKGQYYGGLVAAPVFGKVMARALRLMNVAPD 555


>gi|221133799|ref|ZP_03560104.1| peptidoglycan glycosyltransferase [Glaciecola sp. HTCC2999]
          Length = 580

 Score =  378 bits (971), Expect = e-102,   Method: Composition-based stats.
 Identities = 131/551 (23%), Positives = 240/551 (43%), Gaps = 35/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + IV  + ++  +  R      I P     +    S  + +  + R  I+DRNG+ L
Sbjct: 23  RFTLVIVAIVFVFAGIGARAAYIQVIEPDQLIKQGDNRSKRVRQAAVHRGLIVDRNGQEL 82

Query: 128 ATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
           A  IP  +++ +P  +   + +      E L  VL      ++ R  + + +F +L+R++
Sbjct: 83  AVSIPVQAIWADPKVIAQKNSLQDKRRWEALAKVLDRDTEALMARVSNPKRRFVYLQRQV 142

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD------ 236
           +P   + +    +PGV  + E  R+YP+   ++HV+G+ ++D++GI GIE   +      
Sbjct: 143 TPAMAQYVDDLDIPGVNLKDESRRYYPSGEVSAHVIGFTNVDDKGIEGIEYLFNDYLTGT 202

Query: 237 ---------MQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
                     +G        K  +    + L +D RIQ++ ++E+ +    Y A S   +
Sbjct: 203 PDKRLIRRDGRGRQVEVIDEKEGEKASDLVLTIDQRIQSLAYKEIKKALTVYQARSASAL 262

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           ++++ T EV++MV+ P Y+P+           NR+    FE GS  K   +   ++ G  
Sbjct: 263 VVDIETAEVLAMVNGPSYNPNNRKNTGAHRIRNRVVTDAFEPGSSVKPLAVLSALEFGSV 322

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
               + DT                    L +  I + SSN+G +++A ++  +   +  Y
Sbjct: 323 NKDSIIDTHPGWMRLGGSRVSDPRNLGELDLRTIIQKSSNMGTSKLALSVPKEFLLDTYY 382

Query: 408 RLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
            +GL+S     L    +  +    +W      T+SFG+G+S T  Q A     L N G  
Sbjct: 383 NMGLMSDTGMNLLGESSGLFHERSRWSDFELATLSFGYGISVTTAQLARMYTTLGNGGLH 442

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTA 524
              + +     +  K +  V      + +  ++       GSGR+A V G+ + GKTGT+
Sbjct: 443 RELSIIK---NQQVKEAEQVFSPENTQAVLEMMETVTQKDGSGRKAAVKGYRIAGKTGTS 499

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K I   Y D    N F  + P +DPQ +V+  ++ P         AG   AP+   I+ 
Sbjct: 500 RKAIAGGYGDN-YVNIFAGIAPVSDPQIVVVVLINEPGGDL---YHAGDTAAPVFSKIMG 555

Query: 585 RSASMLGVKPV 595
            +  ML + P 
Sbjct: 556 GALQMLNIAPD 566


>gi|316933180|ref|YP_004108162.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris DX-1]
 gi|315600894|gb|ADU43429.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris DX-1]
          Length = 584

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 215/535 (40%), Positives = 341/535 (63%), Gaps = 6/535 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-MNIDEYGMSRPDIIDRNGEI 126
           A ++ R+G+ ++   V+Y ++A ++           A   ++ D    +RPDI+DRNG+I
Sbjct: 33  AKARARVGLAMIAFAVVYGVIAFKLTTIAVFGDSHGARRGVSQDAVATARPDIVDRNGQI 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ T SL+ EP ++I  DE +E L   LP+L+++ +R +L+S+  F WL+R+++P+Q
Sbjct: 93  LATDVKTPSLFGEPRRLIDQDEAVELLTATLPDLETQEVRERLASKKGFVWLKREITPRQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q  I   G+PG+GF  E  R YP A+  SH++G V+IDN+GI GIEK+LD  GL  +   
Sbjct: 153 QAEIKKLGIPGIGFLRENKRVYPNAAEVSHLIGLVNIDNQGIAGIEKWLDNNGLADLHRA 212

Query: 247 NKGE-KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                +  +P+ LALD+R+ + +  EL++ K+KY+A++   ++ NV+TGE+++MVS+PD+
Sbjct: 213 GFASDRMQRPVELALDVRVTHALRDELLKAKEKYSAKAASGLVSNVNTGEIVAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G+FEMGS FK  T+AM +D+G  ++  ++D R P+  GK  
Sbjct: 273 DPNNPREANDPDRINRLTTGVFEMGSTFKTLTLAMALDAGKASLSTMYDARGPLHYGKFK 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD H   R +++ E+F YSSN+GAA++A +MG+  HK FL ++G L +L TELPE  +P
Sbjct: 333 IHDSHNMGRAISLSEVFTYSSNVGAARVALSMGVDAHKAFLKKVGQLDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ R+ E+++K ++ V
Sbjct: 393 LVPKRWSELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFLKRTEEDAQKFAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAF--VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
           +KK T   +R L+R     G+ + A     G+ +GGKTGT++KV+  RY+     NSF A
Sbjct: 453 VKKETSDKIRYLMRLNAEIGTAKTADQIAKGYYIGGKTGTSEKVVNGRYAKKQVLNSFTA 512

Query: 544 VFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
           + P  +PQY VL  +D PK         T+G N  P  G +I R A +LG++P F
Sbjct: 513 ILPADNPQYQVLVMLDEPKALPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|120597215|ref|YP_961789.1| peptidoglycan glycosyltransferase [Shewanella sp. W3-18-1]
 gi|146291588|ref|YP_001182012.1| peptidoglycan glycosyltransferase [Shewanella putrefaciens CN-32]
 gi|120557308|gb|ABM23235.1| peptidoglycan synthetase FtsI [Shewanella sp. W3-18-1]
 gi|145563278|gb|ABP74213.1| peptidoglycan synthetase FtsI [Shewanella putrefaciens CN-32]
 gi|319424762|gb|ADV52836.1| Peptidoglycan glycosyltransferase [Shewanella putrefaciens 200]
          Length = 583

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 130/565 (23%), Positives = 237/565 (41%), Gaps = 37/565 (6%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGM 114
           Q  +++       R+ + +     ++  L  R           +  E    ++      +
Sbjct: 9   QASKKQKPQLIHWRLYVVVGFVFALFSSLVGRAAYIQIIEPDKLRHESDMRTLRTTSREV 68

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRR-K 168
            R  I DRNG++LA  +P  +++ +P +V   +   +      L  VL    ++++ R +
Sbjct: 69  QRGLITDRNGDMLAVSVPVRAVWADPKQVNDSNSFADMRRWQALADVLHEPLADVLDRVR 128

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
            +   +F +L+R+++P     I    LPGV  + E  R+YP     + ++G  +ID+ GI
Sbjct: 129 SNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSESRRYYPGGEITAQLIGITNIDDVGI 188

Query: 229 TGIEKFLDMQG-----LTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQEL 272
            G+E   +          +V  +  G            ++   + L++D RIQ + ++EL
Sbjct: 189 EGVENAYNSWLTGTPSKQKVRKSRDGHVVEHLDIVQEGESPNDLVLSIDHRIQQLAYREL 248

Query: 273 VENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSI 332
               +   A S   V+L++ TGEV++MV+ P Y+P+     +     NR     FE GS 
Sbjct: 249 KRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSYNPNSRDNLQTFRMRNRAMTDTFEPGST 308

Query: 333 FKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQ 392
            K F +A  +++G     D+  T                    +++  I   SSN+G ++
Sbjct: 309 IKPFVVAAALEAGTVKATDIIPTSPGWMRLGGRQVRDPNNYGDMSLARILAKSSNVGISK 368

Query: 393 IADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPL 450
           +A ++ +Q        +GL S     L    A       +W      T+SFG+GL+ T L
Sbjct: 369 LALSIPVQQLLGTYQSMGLGSFSGINLTGESAGLIQDRHRWSDFERATLSFGYGLTATTL 428

Query: 451 QTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRR 509
           Q A   A L N G L P + +     +       V+     + +  +L      GG+G  
Sbjct: 429 QLARMYATLGNGGTLYPVSILKL---KKPPEGERVISAKVARDVLQMLVTVTEKGGTGTL 485

Query: 510 AFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL 569
           A + G+ V GK+GT++K +   Y D      F  V P  +P+  ++  ++ PK       
Sbjct: 486 AHIDGYPVAGKSGTSRKAVAGGYGDD-YVALFAGVAPANNPKLAIVVVVNEPKGDL---Y 541

Query: 570 TAGINVAPMVGNIIRRSASMLGVKP 594
             G    P    ++  +  ML V+P
Sbjct: 542 YGGSVAGPAFAKVMSGALQMLNVEP 566


>gi|209364227|ref|YP_001425299.2| cell division protein [Coxiella burnetii Dugway 5J108-111]
 gi|212213351|ref|YP_002304287.1| cell division protein [Coxiella burnetii CbuG_Q212]
 gi|215918896|ref|NP_819168.2| penicillin-binding protein [Coxiella burnetii RSA 493]
 gi|206583781|gb|AAO89682.2| division specific D,D-transpeptidase [Coxiella burnetii RSA 493]
 gi|207082160|gb|ABS76850.2| division specific D,D-transpeptidase [Coxiella burnetii Dugway
           5J108-111]
 gi|212011761|gb|ACJ19142.1| division specific D,D-transpeptidase [Coxiella burnetii CbuG_Q212]
          Length = 552

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 145/551 (26%), Positives = 237/551 (43%), Gaps = 34/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R      +  V    L  R+I    +       +  A  + +      R  I DR G  L
Sbjct: 10  RFYALWFLLSVAVAGLLWRLIDLNVLDRSFLLRQSKARVLRVVNIPAYRGMITDRLGVPL 69

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQWLRRKLSPQ 185
           A   P  S+++ P    +    +++L  +L +L    I+++     + +F +L+R   P 
Sbjct: 70  AISTPVDSVWINPQLFQATPIQLKQLAHLL-HLPLSFIKKRAKKMGDRQFVYLKRGNPPF 128

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             K+I    + GV F+ E  R+YP    A+HVVG  +ID++G  G+E   +       G 
Sbjct: 129 VAKQIRGLNISGVFFQREYRRYYPEGEVAAHVVGLTNIDDQGQEGLELAYNRWLGGTPGK 188

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G                 + L++D RIQ + ++ L E    Y+A+S   V+L
Sbjct: 189 MEVLKDRLGHVIADVAVLQKPAQGHDLNLSIDHRIQYLAYKALEETVSTYHAQSGSVVVL 248

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGE+++MV+ P Y+P+         + NR    +FE GS+ K FTIA+ ++SG +  
Sbjct: 249 DVKTGEILAMVNQPSYNPNNRPTDHDGRYRNRAVTDMFEPGSVNKPFTIALALESGRYKP 308

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               +T                   ++T+ ++ + SSNI AA+I  ++  Q +   L+  
Sbjct: 309 DTQINTNPGWMKIGGYRIHDDLNYGVVTLTQLLQKSSNIAAAKILLSLTPQHYYTLLHAF 368

Query: 410 GLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G   +  +  P            W      T+++G+GL+ T LQ A   A L   G   P
Sbjct: 369 GFGERTTSGFPGESNGALIPYETWVPSVVATLAYGYGLAVTTLQLAQGYAVLAAGGIRKP 428

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            TF+  +          VL +N  KT+  +L   V  GG+G RA V G+ V GKTGTA  
Sbjct: 429 VTFVKVNES---PQGVRVLPENVAKTVIKMLETVVQKGGTGTRAQVYGYSVAGKTGTAYI 485

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
                Y       SF+ + P  +P+ +V   +  P+     Q   GI  AP+   I+  +
Sbjct: 486 AGPNGYFKHRYVASFVGIAPANNPRLVVAVVIRDPQ----GQHFGGIVAAPLFSKIMSGA 541

Query: 587 ASMLGVKPVFL 597
             +L V P   
Sbjct: 542 LRILDVPPDNS 552


>gi|509159|emb|CAA42186.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 155/559 (27%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|241760210|ref|ZP_04758306.1| peptidoglycan synthetase FtsI [Neisseria flavescens SK114]
 gi|241319321|gb|EER55786.1| peptidoglycan synthetase FtsI [Neisseria flavescens SK114]
          Length = 572

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 163/562 (29%), Positives = 266/562 (47%), Gaps = 38/562 (6%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSR 116
            + K    S  RIG+ +    + +  L +R +       E +        +       SR
Sbjct: 6   TKTKKPLTSNGRIGLVLGAVALAFTGLLVRGVYLQTSQHEFLKNQGDQRFVRTLPLPASR 65

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRKLSSETK 174
             I DRNG  LA   PT SLY  P  +      E +EKL     ++  E+++ KLS + K
Sbjct: 66  GMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQLEKLSA-FADVPVEVLKNKLSKKDK 124

Query: 175 -FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+E 
Sbjct: 125 GFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGLEL 184

Query: 234 FLD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVEN 275
             +       G   V   NKG              KN Q + L+LD RIQ + + EL + 
Sbjct: 185 SREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELNKA 244

Query: 276 KKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKV 335
              + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  K 
Sbjct: 245 VAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAMKP 304

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FTIA  +DSG     D F+T                    L +  I + SSN+G ++++ 
Sbjct: 305 FTIAKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSA 362

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTA 453
               +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A
Sbjct: 363 MFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLA 422

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFV 512
            A   L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V
Sbjct: 423 RAYTVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAV 479

Query: 513 PGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAG 572
            GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G
Sbjct: 480 DGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGG 536

Query: 573 INVAPMVGNIIRRSASMLGVKP 594
           +   P+   ++  S ++LGV P
Sbjct: 537 VVAGPVFKEVMSGSLNILGVSP 558


>gi|161831306|ref|YP_001596086.1| penicillin-binding protein [Coxiella burnetii RSA 331]
 gi|161763173|gb|ABX78815.1| penicillin-binding protein [Coxiella burnetii RSA 331]
          Length = 548

 Score =  378 bits (970), Expect = e-102,   Method: Composition-based stats.
 Identities = 145/551 (26%), Positives = 237/551 (43%), Gaps = 34/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R      +  V    L  R+I    +       +  A  + +      R  I DR G  L
Sbjct: 6   RFYALWFLLSVAVAGLLWRLIDLNVLDRSFLLRQSKARVLRVVNIPAYRGMITDRLGVPL 65

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQWLRRKLSPQ 185
           A   P  S+++ P    +    +++L  +L +L    I+++     + +F +L+R   P 
Sbjct: 66  AISTPVDSVWINPQLFQATPIQLKQLAHLL-HLPLSFIKKRAKKMGDRQFVYLKRGNPPF 124

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             K+I    + GV F+ E  R+YP    A+HVVG  +ID++G  G+E   +       G 
Sbjct: 125 VAKQIRGLNISGVFFQREYRRYYPEGEVAAHVVGLTNIDDQGQEGLELAYNRWLGGTPGK 184

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G                 + L++D RIQ + ++ L E    Y+A+S   V+L
Sbjct: 185 MEVLKDRLGHVIADVAVLQKPAQGHDLNLSIDHRIQYLAYKALEETVSTYHAQSGSVVVL 244

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGE+++MV+ P Y+P+         + NR    +FE GS+ K FTIA+ ++SG +  
Sbjct: 245 DVKTGEILAMVNQPSYNPNNRPTDHDGRYRNRAVTDMFEPGSVNKPFTIALALESGRYKP 304

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               +T                   ++T+ ++ + SSNI AA+I  ++  Q +   L+  
Sbjct: 305 DTQINTNPGWMKIGGYRIHDDLNYGVVTLTQLLQKSSNIAAAKILLSLTPQHYYTLLHAF 364

Query: 410 GLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G   +  +  P            W      T+++G+GL+ T LQ A   A L   G   P
Sbjct: 365 GFGERTTSGFPGESNGALIPYETWVPSVVATLAYGYGLAVTTLQLAQGYAVLAAGGIRKP 424

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            TF+  +          VL +N  KT+  +L   V  GG+G RA V G+ V GKTGTA  
Sbjct: 425 VTFVKVNES---PQGVRVLPENVAKTVIKMLETVVQKGGTGTRAQVYGYSVAGKTGTAYI 481

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
                Y       SF+ + P  +P+ +V   +  P+     Q   GI  AP+   I+  +
Sbjct: 482 AGPNGYFKHRYVASFVGIAPANNPRLVVAVVIRDPQ----GQHFGGIVAAPLFSKIMSGA 537

Query: 587 ASMLGVKPVFL 597
             +L V P   
Sbjct: 538 LRILDVPPDNS 548


>gi|304310313|ref|YP_003809911.1| Cell division protein FtsI/penicillin-binding protein 2 [gamma
           proteobacterium HdN1]
 gi|301796046|emb|CBL44250.1| Cell division protein FtsI/penicillin-binding protein 2 [gamma
           proteobacterium HdN1]
          Length = 570

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/558 (24%), Positives = 239/558 (42%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCL-----VIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  +  ++       V + I  +++     +  E     +        R  I DRNGE
Sbjct: 5   RWRFYVAALLLCTLSTSVFFRIAYLQLWNRDFLQDEGAKRVVRTATIPAYRGMIQDRNGE 64

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQWLRRKLS 183
            LA   P  +++  P ++    +   +L   L    S  + + L+   + +F +L+R ++
Sbjct: 65  PLAVSTPVTTIWANPKQLWDERDRWPELAKALGEKSSS-LSKHLTAMKDKQFMYLKRHMN 123

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQ 238
           P +   +L+  + GV    E  RFYPA    SH+VG+ +ID++G  GIE   +       
Sbjct: 124 PVKAAAVLNMDISGVYGLSEYRRFYPAGEVTSHIVGFNNIDDQGQEGIELAFEDTLRGEP 183

Query: 239 GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  RV    KG            K  + + L++DLR Q I ++EL+     Y A +   V
Sbjct: 184 GKKRVIKDLKGRIVKDIGLIENAKPGRDVMLSIDLRAQYIAYRELLAAVHAYQATAGVAV 243

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
            ++V TGE+++M + P ++P+      ++G+ NR    +FE GS  KVFT A G++SG +
Sbjct: 244 AVDVRTGEIVAMANQPSFNPNNRKPKDQDGFRNRAITDVFEPGSTMKVFTAAAGLESGRW 303

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
               L DT                   ++ +  +   SSN+GA ++A ++        L+
Sbjct: 304 KPSSLIDTTPGALRIGRKTIRDTHNYGLIDLTHMITKSSNVGATKVALSLKDGTLPTMLH 363

Query: 408 RLGLLSKLETELPEIQAP-------SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALI 460
           R+G   K    +    +            +W  + + T+S+G+G+S T  Q A A A L 
Sbjct: 364 RVGFGEKTGVGIQGEVSGVLPLRPSYGKERWGELETATMSYGYGVSVTAAQLARAYAILG 423

Query: 461 NEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGG 519
             G   P + +  S +        V  +   + +  ++   V   G+ +RA V G+ VGG
Sbjct: 424 AHGIKRPLSIVKTSGD---VKGERVFSEGVAENVIKMMETVVSKEGTAQRAAVDGYRVGG 480

Query: 520 KTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMV 579
           KTGT  K    +Y        F  V P  DP+  ++  +D PK K   +   G    P+ 
Sbjct: 481 KTGTVHKAAGGKYEARRYLGLFAGVAPAEDPRLALVIMIDDPKGK---EYYGGQVAGPVF 537

Query: 580 GNIIRRSASMLGVKPVFL 597
             I+     +  V P   
Sbjct: 538 SRIMAGMLRIKNVPPDLP 555


>gi|317129303|ref|YP_004095585.1| stage V sporulation protein D [Bacillus cellulosilyticus DSM 2522]
 gi|315474251|gb|ADU30854.1| stage V sporulation protein D [Bacillus cellulosilyticus DSM 2522]
          Length = 645

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/571 (26%), Positives = 258/571 (45%), Gaps = 43/571 (7%)

Query: 62  RRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSR 116
            +R      + R+ + + + LV++ ++ IR+     +    I+            +  +R
Sbjct: 1   MKRVSNVTVRKRLILALSIGLVVFTVMIIRLGYVQLVMGNEISDRAEDLWSRNIPFEANR 60

Query: 117 PDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQ 176
            +I+DR+G  LAT+I   S+ V P +V  P  +  +L  VL  +D +     ++  +   
Sbjct: 61  GEILDRHGIALATNISAPSVLVVPRQVSDPANVATQLSTVLS-MDQQKAYELVTQNSSIV 119

Query: 177 WL---RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            +    RK+S +  + +    L GV    +  R YP   + SHV+G+  IDN+G+TG+E 
Sbjct: 120 RINPEGRKMSNELAQEVRDLKLDGVYIAEDNKRHYPFGKYLSHVLGFAGIDNQGLTGLEA 179

Query: 234 FLDMQ-----GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENK 276
           + D Q     G    ++  KG +            + Q ++L +D  IQ I+ +EL   +
Sbjct: 180 YYDEQLSGEQGHVSFYSDAKGRRMPNLADEYTPPIDGQDLKLTIDSNIQTIIERELDIAE 239

Query: 277 KKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNR-ISYGIFEMGSIFKV 335
             YN +    + ++ +TGE++ M S PDYDP    +   E +      +  +E GS FK+
Sbjct: 240 ATYNPDGAIAIAMDPNTGEILGMSSRPDYDPERFREVPPEIYNQNKPVWSQYEPGSTFKI 299

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKV--GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
            T+A  ++ G+  + +            G+++       +   T  E+ + S N G   +
Sbjct: 300 ITLAAALEEGIVDLDEDEFFDPGYVEVAGQNIRCWKKGGHGSQTYLEVVQNSCNPGFVAL 359

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW--KRIHSLTISFGHGLSTTPLQ 451
            + +G +   ++++  G  S+   +L                +   T SFG G+S TP+Q
Sbjct: 360 GEELGKETLFKYIHSFGFGSETGIDLQGEGTGILFDIDAVGPLELATTSFGQGVSVTPIQ 419

Query: 452 TAVAAAALINEGRLIPPTFMIRSRE---------ESEKVSRIVLKKNTVKTMRSLLREGV 502
              A AA +N G+L  P       +          +  V   ++ + T   +R  L   V
Sbjct: 420 QVAAVAAAVNGGKLFQPYLAKEWLDHETGEVISRTTPTVKENIISEETSAEIRRALEHVV 479

Query: 503 TGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPK 562
             GSGR A+V G+ VGGKTGTAQK    RY +  +  SF+   P  DPQ +V   +D+PK
Sbjct: 480 AKGSGRGAYVDGYRVGGKTGTAQKAQGGRYLENNHIVSFIGFAPADDPQIVVYVAIDNPK 539

Query: 563 IKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
              +     G+  AP+VGNI+      LGV+
Sbjct: 540 EVMQ---FGGVVAAPIVGNIMEDGLRALGVE 567


>gi|121635453|ref|YP_975698.1| penicillin-binding protein 2 [Neisseria meningitidis FAM18]
 gi|31296585|gb|AAP46585.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345826|gb|AAM97207.1| PenA [Neisseria meningitidis]
 gi|32345828|gb|AAM97208.1| PenA [Neisseria meningitidis]
 gi|32345830|gb|AAM97209.1| PenA [Neisseria meningitidis]
 gi|32345832|gb|AAM97210.1| PenA [Neisseria meningitidis]
 gi|32345834|gb|AAM97211.1| PenA [Neisseria meningitidis]
 gi|120867159|emb|CAM10926.1| penicillin-binding protein 2 [Neisseria meningitidis FAM18]
          Length = 581

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ +V++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLVYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|261253813|ref|ZP_05946386.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           orientalis CIP 102891]
 gi|260937204|gb|EEX93193.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           orientalis CIP 102891]
          Length = 574

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/567 (25%), Positives = 245/567 (43%), Gaps = 36/567 (6%)

Query: 61  KRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMS 115
           K   +     + R  + +      +  L  RI     I P     +    S+       +
Sbjct: 11  KSDDQPATLIRWRFYLVLFFVFCAFAALCGRIAYIQIIEPDNLIKQGDMRSIRAKTLHSA 70

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRR-KL 169
           R  I DRNGE LA  +P  +++ +P  +     +        L  VL      M+ + K 
Sbjct: 71  RGIISDRNGEPLAVSVPVEAVWADPATIFKEGGLEDINRWYALADVLGLKRQGMVDKIKR 130

Query: 170 SSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGIT 229
           +   +F +L+R++SP     I    L GVG + E  R+YPA   ++H+VG   ID  G+ 
Sbjct: 131 NKSKRFIYLQRQVSPAMAHYIRELKLAGVGLKAESRRYYPAGEVSAHLVGVTGIDGHGLE 190

Query: 230 GIEKFLDMQ-----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVE 274
           G+E+  D       G   +     G           +  +P+ L +D RIQ I ++ + +
Sbjct: 191 GVERSYDKWLTGEAGKRIIRKDRYGRVVENISLEEREEGKPLELTIDQRIQAIAYRAIKQ 250

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
               + A S   VIL+V TG V++MV+ P Y+P+     +     NR+    FE GS  K
Sbjct: 251 AVADFRATSGSAVILDVKTGAVLAMVNAPSYNPNNRSDLQSAKMRNRVITDAFEPGSTVK 310

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
            F +   +++G+     + DT N I            +     +  I + SSNIG A++A
Sbjct: 311 PFVVLAALENGVADDSTIIDTGNGIMQIGGSRVRDTSKVGKADLTTILKKSSNIGVAKLA 370

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQT 452
             M ++        +G        L       +P+  +W +    T++FG+GL+ TPLQ 
Sbjct: 371 LDMPLEALLGMYSSVGFGEVSGLNLIGETQGIFPNRRRWSKFEIATLAFGYGLTITPLQL 430

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAF 511
           A A A L N G   P   +  +++    +++ V+  +T + +  +L      GG+  +A 
Sbjct: 431 AHAYATLGNLGEYQPIHIIENNQQN---LAKQVIDHDTARKVLDMLETVTQPGGTATKAA 487

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           VPG+ V  KTGT++K I   Y D   F     V P +DP+  ++  ++ P+    +    
Sbjct: 488 VPGYRVAAKTGTSRKAIAGGYGDE-YFAYTAGVAPASDPRVALVVVVNEPQ---GDNYYG 543

Query: 572 GINVAPMVGNIIRRSASMLGVKPVFLK 598
           G    P+   I++ +  +L V P   +
Sbjct: 544 GSVAGPVFSEILKGTLQILNVAPDENR 570


>gi|31296655|gb|AAP46620.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLMARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|15676326|ref|NP_273462.1| penicillin-binding protein 2 [Neisseria meningitidis MC58]
 gi|218768818|ref|YP_002343330.1| penicillin-binding protein 2 [Neisseria meningitidis Z2491]
 gi|254805555|ref|YP_003083776.1| Penicillin-binding protein 2 [Neisseria meningitidis alpha14]
 gi|60392883|sp|P0A0U8|PBP2_NEIMA RecName: Full=Penicillin-binding protein 2; Short=PBP-2
 gi|60392884|sp|P0A0U9|PBP2_NEIMB RecName: Full=Penicillin-binding protein 2; Short=PBP-2
 gi|45178|emb|CAA33347.1| unnamed protein product [Neisseria meningitidis]
 gi|7225636|gb|AAF40852.1| penicillin-binding protein 2 [Neisseria meningitidis MC58]
 gi|31296573|gb|AAP46579.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296575|gb|AAP46580.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296579|gb|AAP46582.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296593|gb|AAP46589.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296599|gb|AAP46592.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296601|gb|AAP46593.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296639|gb|AAP46612.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296645|gb|AAP46615.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296647|gb|AAP46616.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296651|gb|AAP46618.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296661|gb|AAP46623.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296665|gb|AAP46625.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296669|gb|AAP46627.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296671|gb|AAP46628.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296673|gb|AAP46629.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296675|gb|AAP46630.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296677|gb|AAP46631.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296681|gb|AAP46633.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345772|gb|AAM97180.1| PenA [Neisseria meningitidis]
 gi|32345774|gb|AAM97181.1| PenA [Neisseria meningitidis]
 gi|32345776|gb|AAM97182.1| PenA [Neisseria meningitidis]
 gi|32345780|gb|AAM97184.1| PenA [Neisseria meningitidis]
 gi|32345782|gb|AAM97185.1| PenA [Neisseria meningitidis]
 gi|32345784|gb|AAM97186.1| PenA [Neisseria meningitidis]
 gi|32345786|gb|AAM97187.1| PenA [Neisseria meningitidis]
 gi|32345788|gb|AAM97188.1| PenA [Neisseria meningitidis]
 gi|32345790|gb|AAM97189.1| PenA [Neisseria meningitidis]
 gi|32345792|gb|AAM97190.1| PenA [Neisseria meningitidis]
 gi|32345794|gb|AAM97191.1| PenA [Neisseria meningitidis]
 gi|32345796|gb|AAM97192.1| PenA [Neisseria meningitidis]
 gi|32345798|gb|AAM97193.1| PenA [Neisseria meningitidis]
 gi|32345800|gb|AAM97194.1| PenA [Neisseria meningitidis]
 gi|32345802|gb|AAM97195.1| PenA [Neisseria meningitidis]
 gi|32345804|gb|AAM97196.1| PenA [Neisseria meningitidis]
 gi|32345806|gb|AAM97197.1| PenA [Neisseria meningitidis]
 gi|32345808|gb|AAM97198.1| PenA [Neisseria meningitidis]
 gi|32345810|gb|AAM97199.1| PenA [Neisseria meningitidis]
 gi|32345812|gb|AAM97200.1| PenA [Neisseria meningitidis]
 gi|32345814|gb|AAM97201.1| PenA [Neisseria meningitidis]
 gi|32345816|gb|AAM97202.1| PenA [Neisseria meningitidis]
 gi|32345818|gb|AAM97203.1| PenA [Neisseria meningitidis]
 gi|32345820|gb|AAM97204.1| PenA [Neisseria meningitidis]
 gi|32345822|gb|AAM97205.1| PenA [Neisseria meningitidis]
 gi|32345824|gb|AAM97206.1| PenA [Neisseria meningitidis]
 gi|32345838|gb|AAM97213.1| PenA [Neisseria meningitidis]
 gi|32345842|gb|AAM97215.1| PenA [Neisseria meningitidis]
 gi|121052826|emb|CAM09174.1| penicillin-binding protein 2 [Neisseria meningitidis Z2491]
 gi|254669097|emb|CBA07668.1| Penicillin-binding protein 2 [Neisseria meningitidis alpha14]
 gi|261391927|emb|CAX49389.1| penicillin-binding protein 2 (PBP-2) [Neisseria meningitidis 8013]
 gi|308388615|gb|ADO30935.1| penicillin-binding protein 2 [Neisseria meningitidis alpha710]
 gi|316984920|gb|EFV63876.1| penicillin-binding protein 2 [Neisseria meningitidis H44/76]
 gi|325130839|gb|EGC53572.1| penicillin-binding protein 2 [Neisseria meningitidis OX99.30304]
 gi|325132959|gb|EGC55636.1| penicillin-binding protein 2 [Neisseria meningitidis M6190]
 gi|325134880|gb|EGC57513.1| penicillin-binding protein 2 [Neisseria meningitidis M13399]
 gi|325136980|gb|EGC59577.1| penicillin-binding protein 2 [Neisseria meningitidis M0579]
 gi|325138947|gb|EGC61497.1| penicillin-binding protein 2 [Neisseria meningitidis ES14902]
 gi|325140928|gb|EGC63435.1| penicillin-binding protein 2 [Neisseria meningitidis CU385]
 gi|325142968|gb|EGC65325.1| penicillin-binding protein 2 [Neisseria meningitidis 961-5945]
 gi|325144952|gb|EGC67235.1| penicillin-binding protein 2 [Neisseria meningitidis M01-240013]
 gi|325198904|gb|ADY94360.1| penicillin-binding protein 2 [Neisseria meningitidis G2136]
 gi|325199602|gb|ADY95057.1| penicillin-binding protein 2 [Neisseria meningitidis H44/76]
 gi|325202775|gb|ADY98229.1| penicillin-binding protein 2 [Neisseria meningitidis M01-240149]
 gi|325203520|gb|ADY98973.1| penicillin-binding protein 2 [Neisseria meningitidis M01-240355]
 gi|325205483|gb|ADZ00936.1| penicillin-binding protein 2 [Neisseria meningitidis M04-240196]
 gi|325208771|gb|ADZ04223.1| penicillin-binding protein 2 [Neisseria meningitidis NZ-05/33]
          Length = 581

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|325128830|gb|EGC51689.1| penicillin-binding protein 2 [Neisseria meningitidis N1568]
          Length = 581

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPIDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|114321348|ref|YP_743031.1| peptidoglycan synthetase FtsI [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227742|gb|ABI57541.1| peptidoglycan synthetase FtsI [Alkalilimnicola ehrlichii MLHE-1]
          Length = 578

 Score =  377 bits (969), Expect = e-102,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 241/550 (43%), Gaps = 32/550 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNI-----HPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R+G+  +V  ++   L  R ++   +       +  A  M        R  I DR+GE L
Sbjct: 17  RLGVVALVFFLLVGALMWRAVELQVLDRQFLQTQGEARQMRTRAMPAHRGVITDRHGEPL 76

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLSPQ 185
           A   P  S++ +P +++   E +  L   L  +    ++R+L +   ++F W+RR++SP+
Sbjct: 77  AISSPVDSVWADPGQLLDHPEAVTALAE-LVGMPRARLQRRLEARPGSEFAWVRRQVSPE 135

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
           Q + +    LPGV  + E  RFYP+   ++H++G+ +ID++G  G+E   D       G 
Sbjct: 136 QAEAVRRAALPGVALQQEYRRFYPSGEVSAHLLGFTNIDDQGQEGLELTYDAWLRGEPGR 195

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G            +  + + L++D R+Q + ++EL    ++++A     V+L
Sbjct: 196 KRVIQDRLGRVVEDVELLREPRAGRDLALSIDRRLQYLAYRELKAAVREHDARGGSLVLL 255

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V +GEV++MV+ P ++PH   +       NR     +E GS+ K FT+   +  G+   
Sbjct: 256 DVESGEVLAMVNQPGFNPHRRNEIGNGVQRNRAIIDAYEPGSLIKPFTVLAALREGVVRP 315

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
           +    T                    + +  + + SSN+GA ++A  M        L  +
Sbjct: 316 ETSLSTSPGTLRVGRHTIRDIRDYGEIDVTTLLQKSSNVGAVRLALEMEPDALWGLLLEM 375

Query: 410 GLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G  +                      +   T+SFG+GL+ TPLQ A A A L   G   P
Sbjct: 376 GFGASTFVGFQGEATGRVSSMPPRDEVQRATLSFGYGLTATPLQIARAYATLAAAGVQRP 435

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            + +     +  +    VL     + +  +L      GG+G RA VPG+ V GKTGT +K
Sbjct: 436 VSLL-HRNGQPPESEEQVLDPALSRQVLEMLETVTQPGGTGTRAAVPGYRVAGKTGTVRK 494

Query: 527 VIKKRYS-DTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
                Y  D      F  V P + P+  +   +D P+    ++   G   AP+ G ++  
Sbjct: 495 AGPTGYGEDDGYIAMFAGVAPVSRPRLAMAVLVDGPR---GDEYYGGQVAAPVFGQVMAG 551

Query: 586 SASMLGVKPV 595
           +  ++ + P 
Sbjct: 552 ALRLMNIAPD 561


>gi|31296623|gb|AAP46604.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|509118|emb|CAA42193.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|120555369|ref|YP_959720.1| peptidoglycan glycosyltransferase [Marinobacter aquaeolei VT8]
 gi|120325218|gb|ABM19533.1| peptidoglycan synthetase FtsI [Marinobacter aquaeolei VT8]
          Length = 580

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 149/550 (27%), Positives = 248/550 (45%), Gaps = 32/550 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R G  + V L++   +  R++         +  +    ++ ++     R  + DR+GE L
Sbjct: 23  RFGSVLGVFLLVVAGIGWRLVDLHVVDNDFLRKQGDVRTIRVESIDAHRGVVTDRHGEPL 82

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQWLRRKLSPQ 185
           A   P  +++  P +    D  +  L  +L  L    +R +L      +F +LRRK+ P 
Sbjct: 83  AVSTPVQTVWANPSETDPEDPQLAALARIL-GLSEGALRERLRQYAGREFIYLRRKVQPS 141

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
             +  L+ G+ G+  R E  R+YPA    +HVVG+ DID  G  GIE   +       G 
Sbjct: 142 MAREALALGVGGIYARQEYRRYYPAGEVTAHVVGFTDIDEHGQEGIELAYNKWLTGEPGQ 201

Query: 241 TRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV   N+G            +  + + L++DLR+Q + ++EL      + A     V+L
Sbjct: 202 KRVLKDNRGRVIKDLMLIRDARPGKDLELSIDLRLQYLAYRELKAVVGAHKARGGTLVML 261

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV++MV+   Y+P++  +   E   N+    +FE GS  K  TIA  ++SG +TV
Sbjct: 262 DVDTGEVLAMVNQGSYNPNDRSQLAAENLRNKAITDLFEPGSTMKPLTIAAALESGEYTV 321

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
               DT    +         H    +L + EI   SSN+G + IA  +G    +    RL
Sbjct: 322 NSTIDTSPGFRRFGRFTIRDHRNYGVLDLTEIIVKSSNVGVSNIATDLGGDTLRNLYARL 381

Query: 410 GLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL        P         P +W+ +   T+S+G+G+S   LQ A A   + N G   P
Sbjct: 382 GLGQATGIGFPGEAVGVLPAPPKWRPVEESTLSYGYGMSVNALQLAQAYMVIANGGIRYP 441

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKV 527
            +     R+E     + VL +   + +R +L++ V  G+G+RA    +  GGKTGT   V
Sbjct: 442 LSL---MRQEQRPQGQRVLSEQVTRAVRDMLKQAVARGTGKRAQPGLYAAGGKTGTVHLV 498

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
               Y D+     F  + P  DP+ + +  +D+P+     +   G   AP+   ++  + 
Sbjct: 499 GANGYEDSQYKAIFAGMAPIDDPRIVTVVAVDAPQA---GEYYGGEVAAPVFARVMGDAL 555

Query: 588 SMLGVKPVFL 597
            +L VKP   
Sbjct: 556 RLLNVKPELE 565


>gi|31296571|gb|AAP46578.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296587|gb|AAP46586.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345778|gb|AAM97183.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLITRGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|31296685|gb|AAP46635.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPIDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                +  L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVDPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|31296643|gb|AAP46614.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
           ++   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 VEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|240014788|ref|ZP_04721701.1| penicillin-binding protein 2 [Neisseria gonorrhoeae DGI18]
 gi|240113339|ref|ZP_04727829.1| penicillin-binding protein 2 [Neisseria gonorrhoeae MS11]
 gi|240116314|ref|ZP_04730376.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID18]
 gi|240118601|ref|ZP_04732663.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID1]
 gi|240121311|ref|ZP_04734273.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID24-1]
 gi|268599413|ref|ZP_06133580.1| penicillin binding protein 2 [Neisseria gonorrhoeae MS11]
 gi|268601981|ref|ZP_06136148.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID18]
 gi|268604313|ref|ZP_06138480.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID1]
 gi|44913|emb|CAA30357.1| unnamed protein product [Neisseria gonorrhoeae]
 gi|268583544|gb|EEZ48220.1| penicillin binding protein 2 [Neisseria gonorrhoeae MS11]
 gi|268586112|gb|EEZ50788.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID18]
 gi|268588444|gb|EEZ53120.1| penicillin binding protein 2 [Neisseria gonorrhoeae PID1]
          Length = 583

 Score =  377 bits (968), Expect = e-102,   Method: Composition-based stats.
 Identities = 151/559 (27%), Positives = 262/559 (46%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+        V  D H     L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKIGPSPVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFG 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 437 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 494 DVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 551 GPVFKQVMGGSLNILGVSP 569


>gi|254230424|ref|ZP_04923804.1| Cell division protein FtsI/penicillin-binding protein 2 [Vibrio sp.
           Ex25]
 gi|262395265|ref|YP_003287119.1| cell division protein FtsI (Peptidoglycan synthetase) [Vibrio sp.
           Ex25]
 gi|151937057|gb|EDN55935.1| Cell division protein FtsI/penicillin-binding protein 2 [Vibrio sp.
           Ex25]
 gi|262338859|gb|ACY52654.1| cell division protein FtsI (Peptidoglycan synthetase) [Vibrio sp.
           Ex25]
          Length = 597

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 143/558 (25%), Positives = 249/558 (44%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +      + +L  R+     I P     +    S+ +     +R  I DRNGE
Sbjct: 45  RWRFHLLLFFVFCAFALLVARVAYIQIIEPDNLIKQGDLRSVRVKSIPSARGIISDRNGE 104

Query: 126 ILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRRKL--SSETKFQWL 178
            LA  +P  +++ +P  +   + +        L  VL  +D + +  K+  + + +F +L
Sbjct: 105 PLAVSVPVEAVWADPATIFKENALSQTKSWYALADVL-GVDRQGLIDKIKHNEKRRFIYL 163

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ 238
           +R++SP     I    LPGVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 164 QRQVSPAMANYIRELKLPGVGLKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDEW 223

Query: 239 -----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G   +     G           +  + ++L +D R+Q I ++ + +    + A S
Sbjct: 224 LTGAAGKKTIRKDRYGRVVENIAWQDKQEGKSLQLTIDQRLQAIAYRAIKQAVADHRATS 283

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+V TG V++MV+ P Y+P+     +     NR+     E GS  K F I   ++
Sbjct: 284 GSVVMLDVKTGAVLAMVNAPSYNPNNRSDWQSYKMRNRVITDSMEPGSTIKPFVILAALE 343

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT N +            +    ++  I + SSNIG  ++A  M ++   
Sbjct: 344 NGVADKDTIVDTGNGVLRLGGSRVRDVSRVGKASLTTILKKSSNIGVTKLAMQMPVEALL 403

Query: 404 EFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +G        L       +P  ++W  I   TI+FG+GLS TP+Q A A A L N
Sbjct: 404 GLYSSVGFGELSGLNLVGEVTGIFPTRTRWSPIERATIAFGYGLSITPIQLAHAYATLGN 463

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +  +  +   +SR V+     + +  +L      GGS RRA VPG+ VG K
Sbjct: 464 LGKYEPIHIIESNDHD---MSRQVVSAKYARQVLDMLETVTQKGGSARRAAVPGYRVGAK 520

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           TGT++K     YSD         + P +DP+  ++  ++ P+  +      G   +P+  
Sbjct: 521 TGTSRKASAGGYSDE-YITYTAGLAPVSDPRIALVVIVNEPQGDD---YYGGSVASPVFS 576

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L V P   K
Sbjct: 577 EIMKGALQILNVAPDENK 594


>gi|332976265|gb|EGK13127.1| stage V sporulation protein D [Desmospora sp. 8437]
          Length = 638

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/539 (27%), Positives = 246/539 (45%), Gaps = 39/539 (7%)

Query: 89  AIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDE 148
            ++++Q   ++ +          +   R  I+DRNGE+LA ++ + S+   P ++  P  
Sbjct: 32  YVQLVQGKWLNEKAQDLWTRDIPFEGKRGRILDRNGEVLAYNVSSPSVLAIPAQIKDPSR 91

Query: 149 IIEKLQIVLPNLDSEMIRRKLSSETKFQWL---RRKLSPQQQKRILSFGLPGVGFRLEKS 205
              +L  +L     E I R+++       L    RK+S  + + I    LPG+    +  
Sbjct: 92  TARELARILV-APEEKIYRQITKRELIVRLNPYGRKISEDRARAIQDLRLPGITVAEDNK 150

Query: 206 RFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGEK--------- 251
           R YP  S A+HV+G+  IDN+G+ G+E   D +     G        KGE+         
Sbjct: 151 RHYPLGSLAAHVLGFAGIDNQGLAGLELIYDEKLRGTKGRVSFGANAKGERLPGSDDQYT 210

Query: 252 ---NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
              +   + L LD  +Q I+ +E+ +   +Y  ++V  + ++  TGE++ M S P ++P 
Sbjct: 211 PSEDGMDLVLTLDKNVQAIMEREMDQAMAQYEPDNVLAIAMDPKTGEILGMGSRPTFEPA 270

Query: 309 EAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV-I 366
                  E +  N   +  +E GS FK+ T+A  ++     +K+ F     IKV      
Sbjct: 271 NFRNADPEVYNRNLPIWRTYEPGSTFKIITLAAALEENKVNLKEGFHDPGYIKVAGARLR 330

Query: 367 HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS 426
              H  +   +  E+   S N G   +   +G +   +++++ G   K   +L       
Sbjct: 331 CWKHGGHGSQSFLEVVENSCNPGFVTLGQRLGKEKLFQYIHKFGFGEKTGIDLSGEAKGI 390

Query: 427 --YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES------ 478
              P +   +   T SFG G+S TP+Q   A AA +N GRL+ P      ++        
Sbjct: 391 LFKPKKVGPVELATTSFGQGVSVTPIQQVTAVAAAVNGGRLMEPRLQKGWKDPESGAVVK 450

Query: 479 ---EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVI-KKRYSD 534
               KV R V+ + T   +RS L   V  G+GRRAF+ G+ VGGKTGTAQKV    RY  
Sbjct: 451 KTEPKVKRRVISEETSAQVRSSLESVVAKGTGRRAFIDGYRVGGKTGTAQKVGPDGRYLR 510

Query: 535 TLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVK 593
             +  SF+ V P  DP+ +V   +D+PK  +      G+  AP+V NI+  S   + V+
Sbjct: 511 NNHIVSFIGVAPMDDPEIVVYVAVDNPKGIQ----FGGVVAAPIVRNILHDSLRYMKVE 565


>gi|59801878|ref|YP_208590.1| Pbp2 [Neisseria gonorrhoeae FA 1090]
 gi|240124144|ref|ZP_04737100.1| Pbp2 [Neisseria gonorrhoeae PID332]
 gi|260439869|ref|ZP_05793685.1| Pbp2 [Neisseria gonorrhoeae DGI2]
 gi|268682769|ref|ZP_06149631.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID332]
 gi|291043145|ref|ZP_06568868.1| penicillin-binding protein 2 [Neisseria gonorrhoeae DGI2]
 gi|509155|emb|CAA42191.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|59718773|gb|AAW90178.1| penicillin-binding protein 2 [Neisseria gonorrhoeae FA 1090]
 gi|268623053|gb|EEZ55453.1| penicillin-binding protein 2 [Neisseria gonorrhoeae PID332]
 gi|291012751|gb|EFE04734.1| penicillin-binding protein 2 [Neisseria gonorrhoeae DGI2]
          Length = 582

 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 150/559 (26%), Positives = 261/559 (46%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+        V  D H     L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKIGPSPVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFG 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 437 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 494 DVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 551 GPPFKKIMGGSLNILGISP 569


>gi|303258242|ref|ZP_07344249.1| penicillin-binding protein [Burkholderiales bacterium 1_1_47]
 gi|302858995|gb|EFL82079.1| penicillin-binding protein [Burkholderiales bacterium 1_1_47]
          Length = 635

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 136/576 (23%), Positives = 238/576 (41%), Gaps = 34/576 (5%)

Query: 45  LCQKGCHMEDGQDLFQKRRRKVIAHSK-NRIGMTIVVCLVIYIILAIRIIQYG------N 97
                   E+ +      +  +    K  R      + L+ +  L +RI           
Sbjct: 11  WDNVFMPTEEKRGDDDSVKDLLRLKIKPGRSKFVYFMLLLCFTALGVRIGWLQLGFNTEF 70

Query: 98  IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVL 157
           +  +         E    R  I DRNG +LAT +   +L++ P  V      ++++   L
Sbjct: 71  LQKQGAMRFQRTIEVPAMRGQIYDRNGTLLATSVTAKALWIIPQDVKITTSQLKEIAKTL 130

Query: 158 PNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHV 217
            ++    +R+K +S+  F +L+R++  +  +++L   +PG+    E  R YP    A+ +
Sbjct: 131 -DVPVSELRKKFNSKRTFVYLKRQVPIETAEKVLDMKIPGLHSTREFLRSYPDGEAAAQI 189

Query: 218 VGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGEK----------NLQPIRLALDL 262
           VG   +D  GI GIE   + +     G  RV     G            N + I L +D 
Sbjct: 190 VGLTGLDGNGIEGIELAAEKRLAGKPGSRRVMKDRLGRIVEDAWLKEPMNGENITLTIDS 249

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           R+QN+ ++ L    +   A+    VI +  TG+++++ + P +DP+   K  + G  NR 
Sbjct: 250 RLQNLAYEALGRQVENLKAKGGSIVIADPKTGDILALANYPSFDPNNRGKISRTGVRNRA 309

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIF 382
               +E GS  K F++A G++    T   L                    ++ LT+  I 
Sbjct: 310 IVDTYEPGSTMKPFSVAAGLEEKKVTPNTL-FQIGRSMSFGRHSIGDSHYSKELTVSGII 368

Query: 383 RYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTIS 440
           + SSNIG +++A  M  Q    +  +LG     +   P   A        W+ I   T+S
Sbjct: 369 QQSSNIGTSKVALLMTPQVMWSYYDKLGFGHSPQIGFPGAVAGRLRPAKNWRPIEQATMS 428

Query: 441 FGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE 500
           +GHG++ + LQ   A      +G +I  +      + + +  + V    T   MR +L +
Sbjct: 429 YGHGVTVSLLQQVRAYTVFARDGDMIELSIYK---DRAYREPQRVYSAKTAGQMRDMLAK 485

Query: 501 GVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
            V  GG+G RA V G+   GKTGTA KV   +Y        F    P  +PQ +V   +D
Sbjct: 486 VVEKGGTGFRARVEGYTAAGKTGTAYKVEGGQYVR-KYVAGFAGYAPAHNPQIVVGIMID 544

Query: 560 SPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            P      +       AP+   ++ ++  ++ V P 
Sbjct: 545 EP---MIGKHFGSTAAAPLFSEMVSKTLRLMAVNPD 577


>gi|331001078|ref|ZP_08324709.1| putative penicillin-binding protein 2 [Parasutterella
           excrementihominis YIT 11859]
 gi|329569383|gb|EGG51161.1| putative penicillin-binding protein 2 [Parasutterella
           excrementihominis YIT 11859]
          Length = 635

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 136/576 (23%), Positives = 238/576 (41%), Gaps = 34/576 (5%)

Query: 45  LCQKGCHMEDGQDLFQKRRRKVIAHSK-NRIGMTIVVCLVIYIILAIRIIQYG------N 97
                   E+ +      +  +    K  R      + L+ +  L +RI           
Sbjct: 11  WDNVFMPTEEKRGDDDSVKDLLRLKIKPGRSKFVYFMLLLCFTALGVRIGWLQLGFNTEF 70

Query: 98  IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVL 157
           +  +         E    R  I DRNG +LAT +   +L++ P  V      ++++   L
Sbjct: 71  LQKQGAMRFQRTIEVPAMRGQIYDRNGTLLATSVTAKALWIIPQDVKITTSQLKEIAKTL 130

Query: 158 PNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHV 217
            ++    +R+K +S+  F +L+R++  +  +++L   +PG+    E  R YP    A+ +
Sbjct: 131 -DVPVSELRKKFNSKRTFVYLKRQVPIETAEKVLDMKIPGLHSTREFLRSYPDGEAAAQI 189

Query: 218 VGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGEK----------NLQPIRLALDL 262
           VG   +D  GI GIE   + +     G  RV     G            N + I L +D 
Sbjct: 190 VGLTGLDGNGIEGIELAAEKRLAGKPGSRRVMKDRLGRIVEDAWLKEPMNGENITLTIDS 249

Query: 263 RIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRI 322
           R+QN+ ++ L    +   A+    VI +  TG+++++ + P +DP+   K  + G  NR 
Sbjct: 250 RLQNLAYEALGRQVENLKAKGGSIVIADPKTGDILALANYPSFDPNNRGKISRTGVRNRA 309

Query: 323 SYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIF 382
               +E GS  K F++A G++    T   L                    ++ LT+  I 
Sbjct: 310 IVDTYEPGSTMKPFSVAAGLEEKKVTPNTL-FQIGRSMSFGRHSIGDSHYSKELTVSGII 368

Query: 383 RYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTIS 440
           + SSNIG +++A  M  Q    +  +LG     +   P   A        W+ I   T+S
Sbjct: 369 QQSSNIGTSKVALLMTPQVMWSYYDKLGFGHSPQIGFPGAVAGRLRPAKNWRPIEQATMS 428

Query: 441 FGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLRE 500
           +GHG++ + LQ   A      +G +I  +      + + +  + V    T   MR +L +
Sbjct: 429 YGHGVTVSLLQQVRAYTVFARDGDMIELSIYK---DRAYREPQRVYSAKTAGQMRDMLAK 485

Query: 501 GVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMD 559
            V  GG+G RA V G+   GKTGTA KV   +Y        F    P  +PQ +V   +D
Sbjct: 486 VVEKGGTGFRARVEGYTAAGKTGTAYKVEGGQYVR-KYVAGFAGYAPAHNPQIVVGIMID 544

Query: 560 SPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
            P      +       AP+   ++ ++  ++ V P 
Sbjct: 545 EP---MIGKHFGSTAAAPLFSEMVSKTLRLMAVNPD 577


>gi|31296577|gb|AAP46581.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  376 bits (966), Expect = e-102,   Method: Composition-based stats.
 Identities = 152/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVIIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|31296657|gb|AAP46621.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   +    +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNGRLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|32345914|gb|AAM97251.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 152/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ +ID +G  G+E   +
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTNIDGKGQEGLELSRE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V   NKG              KN Q + L+LD RIQ + + EL +    
Sbjct: 198 DSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELNKAVAY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  K FTI
Sbjct: 258 HKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|219670079|ref|YP_002460514.1| stage V sporulation protein D [Desulfitobacterium hafniense DCB-2]
 gi|219540339|gb|ACL22078.1| stage V sporulation protein D [Desulfitobacterium hafniense DCB-2]
          Length = 682

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 140/567 (24%), Positives = 243/567 (42%), Gaps = 50/567 (8%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNG 124
            + RI           ++L +R+          +  +              R +I DRNG
Sbjct: 7   MRKRIAFLFFCVSAFLVVLIVRLAFVQLAQGAILSDKADESHYRGVPVAAKRGNIEDRNG 66

Query: 125 EILATDIPTFSLYVEPHKVIS---PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           E+LA  + T ++Y  P +V S    +EI   L  +L  +  E +  +++  +  ++++++
Sbjct: 67  EVLAMSVSTETVYAVPAQVRSSGRAEEIAHALSGLL-EMGPEQVMERITKRSALEYVKKR 125

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ--- 238
           ++ +   ++ +  LPG+G   +  R+YP ++ A+H++G+  IDN+G+ GIE   D +   
Sbjct: 126 VTAEVAAQVRALELPGIGITEDSVRYYPNSTLAAHIIGFAGIDNQGLEGIELTRDSELNG 185

Query: 239 --GLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVE-------NKK 277
             G         G             KN   +RL +D  IQ    +EL +       N  
Sbjct: 186 VPGAVLTEFAANGIPLPFANQMYVSPKNGNTVRLTIDKNIQAFAERELQKLMSGQGDNMN 245

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
               +S   ++++ +TG+V+++ S P YDP+      +    N      +E GS FK+ T
Sbjct: 246 GQVPKSGTILVMDPNTGQVLALASAPTYDPNYYNNYDQSTRRNIAIQNGYEPGSTFKIIT 305

Query: 338 IAMGIDSGLFTVKD-LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADA 396
           +A  ++    + ++  FD      +GK V       +   T  ++   S N G   +   
Sbjct: 306 LAAALEEKKISPQEGFFDPGGVTILGKTVHCWKRGGHGSQTFTQVVENSCNPGFVAMGQR 365

Query: 397 MGIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAV 454
           +G+    ++L+  G   K   E+            +   +   T+S G   + T +Q   
Sbjct: 366 LGMDKFYKYLHDFGFGQKTGIEMSGEAVGILAGKKRATALDLATMSIGQTNNVTAIQLLT 425

Query: 455 AAAALINEGRLIPPTFMIRSREESEKVS--------RIVLKKNTVKTMRSLLREGVTGGS 506
           A +A+ N G L+ P  +      S  V         R V+ + T KT R +L   VT G+
Sbjct: 426 AVSAVANGGNLMKPQLVKEIVGPSGNVVESFEPQDVRRVISEGTSKTARQMLESVVTNGT 485

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G RAF+PG+ V GKTGTAQKV    Y       SF+A  P  +PQ  +L  +D       
Sbjct: 486 GYRAFLPGYRVAGKTGTAQKVANGAYIQGEYIASFIAFAPADNPQLAILCVID------G 539

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVK 593
                G   AP V  +++ S   LGV+
Sbjct: 540 VPFYGGSVAAPPVRGVLQDSLKYLGVE 566


>gi|121998876|ref|YP_001003663.1| peptidoglycan glycosyltransferase [Halorhodospira halophila SL1]
 gi|121590281|gb|ABM62861.1| peptidoglycan synthetase FtsI [Halorhodospira halophila SL1]
          Length = 575

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 154/561 (27%), Positives = 243/561 (43%), Gaps = 34/561 (6%)

Query: 62  RRRKVIA-HSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMS 115
           RR+  +    + R+   + V  +    + +R +    I+ E       A  +        
Sbjct: 6   RRQPALNGPPRWRLYSVVAVMAIAAGAVILRALDLQVINSEFLRDEADARHLRTVSMPAH 65

Query: 116 RPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--T 173
           R  I DRNGE LA   P  S +  P +++     +  +  VL    +E +R  L +    
Sbjct: 66  RGVITDRNGEPLAISSPVKSAWANPGELLEDGAAVAAVAEVLERSPAE-LRDFLKAREGR 124

Query: 174 KFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEK 233
            F +LRR LSPQ   R+     PGV  + E  RFYPA   A+ +VG+ DID +G+ G+E+
Sbjct: 125 HFVYLRRHLSPQVATRMRELDAPGVQLQQEFRRFYPAGEVAAQLVGFTDIDGQGLAGVER 184

Query: 234 FLD-----MQGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKK 277
             +       G  RV     G            +  + + L+LD RIQ + ++EL    +
Sbjct: 185 AFEDPLSGRSGAKRVIRDPFGRTIEDVELLREPRPGEDVHLSLDRRIQYVAYRELKRAVR 244

Query: 278 KYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFT 337
            ++AE    V+L+ ++GEV++MVS P ++PH     + E   NR      E GS+ K FT
Sbjct: 245 GHDAEGGAAVVLDATSGEVLAMVSQPSFNPHRRAGVEPEQRRNRAVSWAQEPGSVIKPFT 304

Query: 338 IAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           IA  + SG       FDT                    L I  + + SSN+G  ++A   
Sbjct: 305 IAAALSSGAVRSGQAFDTAPGTMRVGRHTVRDFLDYGELDIAGVLQKSSNVGTVKMALET 364

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
             +     L  +G   +  + L +  A           +   T+S+G+G++ TPLQ A A
Sbjct: 365 EPRALWNTLEDIGFGERTRSGLRDEVAGQFLPAPPRGDVQRATLSYGYGVTATPLQLARA 424

Query: 456 AAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPG 514
            AAL  +G + P   +     E     R VL       +R +L   V  GG+G RA + G
Sbjct: 425 YAALARDGVIRP---ISIQAVEEPPEGRQVLDPELAAEIRGMLEAVVEPGGTGTRAAISG 481

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           + V GKTGT  K     Y++     SF+   P +DP+ ++   +D P+         G  
Sbjct: 482 YRVAGKTGTVLKSGPSGYAEEDYLASFIGFAPASDPRLVMAVTIDQPRGDL---YYGGQV 538

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP+   ++  +  ML V P 
Sbjct: 539 AAPVFSRVMGNALRMLNVPPD 559


>gi|117928212|ref|YP_872763.1| peptidoglycan glycosyltransferase [Acidothermus cellulolyticus 11B]
 gi|117648675|gb|ABK52777.1| peptidoglycan synthetase FtsI [Acidothermus cellulolyticus 11B]
          Length = 638

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 139/561 (24%), Positives = 228/561 (40%), Gaps = 43/561 (7%)

Query: 72  NRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNGEI 126
            R+   ++  + + I+  +R+++   I  E       A  +        R +I+DRNG +
Sbjct: 64  RRLHAVLLATVFVVIVFGLRLVEIQGIQGEVYSRQAQAQYLRSTTLPAPRGEIVDRNGAV 123

Query: 127 LATDIPTFSLYVEPHKVI-----SPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRK 181
           LAT +    + V+P         +P  +  +L  +L  + +  +  +L+   +F +L R 
Sbjct: 124 LATSVDARDVVVDPSIAKQSTSPTPQVMAARLAPLL-GVPASTLLSRLTGPGRFAYLARG 182

Query: 182 LSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD----- 236
           ++P    ++L+  LPGV       R YP  S  + V+G+V ID  G+ G+E   D     
Sbjct: 183 VTPAVAAKVLALDLPGVADEPVLKRSYPNGSLGASVIGFVGIDGNGLGGLEYAYDATLAG 242

Query: 237 MQGLTRVFTTNKG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
             G   V T + G                + ++L LD  I+    Q L +      A+  
Sbjct: 243 HAGHRTVETGSDGTVLPDGATTVTPPVPGEGLQLTLDRDIEWEAQQALAQQVTATGAKGG 302

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             +++   TGE+++M S+P +DP            N     +FE GS  KV T+A  +DS
Sbjct: 303 TVIVMRPRTGEILAMASVPTFDPAHPQDAPPSVLGNPAVSDVFEPGSTAKVITMAAALDS 362

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRI-LTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           G+ T   + D    +    +  HD  P     LT+  +   SSNIGA   ++ +G Q   
Sbjct: 363 GILTPTSVIDVPPTLDRAGYTFHDAEPHGEEKLTLTGVLAQSSNIGAILASERVGTQRLY 422

Query: 404 EFLYRLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
           ++L   GL        P   A     P  W      TI FG G++   +Q A   A + N
Sbjct: 423 QYLRAFGLGEPSGLGFPGESAGVIGTPQSWSASQRYTIPFGQGIAVNAMQVADVYATIAN 482

Query: 462 EGRLIPPTFMIRSREES-------EKVSRIVLKKNTVKTMRSLLREGVTG-GSGRRAFVP 513
            G  + PT +                    V+     + +  +L    T  G+   A +P
Sbjct: 483 GGVRVTPTLIKGIIGRDGTLHPAAPPKQTRVISAAAARQLEEMLEAVTTDQGTAPAARIP 542

Query: 514 GFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGI 573
           G+ V GKTGTAQ+V            SF+   P  DPQ +VL  +D P     N    G 
Sbjct: 543 GYRVAGKTGTAQRVDPSCACYRGYTASFVGFAPADDPQLLVLVVLDDP----VNGHFGGA 598

Query: 574 NVAPMVGNIIRRSASMLGVKP 594
             AP+   ++  +     + P
Sbjct: 599 VAAPVFRQVMSFALQTEKIPP 619


>gi|114763023|ref|ZP_01442453.1| penicillin-binding protein [Pelagibaca bermudensis HTCC2601]
 gi|114544347|gb|EAU47355.1| penicillin-binding protein [Roseovarius sp. HTCC2601]
          Length = 596

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 173/569 (30%), Positives = 287/569 (50%), Gaps = 20/569 (3%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
                    E+ +   ++ R K    ++ R+ +  V+ LV + ++  R+       P   
Sbjct: 19  GENPDAIERENLRIRHEQMRDKARVRAEGRLLVMSVMFLVAFAVVGARMGMLAASEPAEP 78

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE 163
               +      SR DI DR+G ILAT++ T SLY  P ++I P    ++L+ + P+L+ E
Sbjct: 79  RAHASGASIIASRADITDRHGRILATNMETHSLYAHPQQMIEPLRAAKELKAIFPDLEEE 138

Query: 164 MIRRKLS-SETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
            + +  +  + KF W+++K+SP+Q + +   G PG+ F   + R YP  + ASHV+G   
Sbjct: 139 RLVKDFTDPKRKFLWVKKKISPEQMQAVHDIGEPGLLFGPREMRLYPNGALASHVMGGAS 198

Query: 223 IDNRGITGIEKFLDMQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
               G+   E  +   G+ + F        +   P+ L++DL +Q    + L    +  N
Sbjct: 199 FGREGVASAE-VIGTAGIEKFFDAELRDPARGGAPLELSIDLSVQAASERVLDAGMRLLN 257

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGK------KEGWFNRISYGIFEMGSIFK 334
           A+   +V+++V TGEVIS+ S+PD+DP++  +            FNR   G++E+GS FK
Sbjct: 258 AKGAASVLMDVHTGEVISIASLPDFDPNDRPRPPTSGSPSDSPLFNRAVQGVYELGSTFK 317

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ-NRILTIPEIFRYSSNIGAAQI 393
           +F  A  +D GL     + DTR P KVG H I ++       + + EI   SSN G  ++
Sbjct: 318 IFAAAQAMDLGLVRPDTIIDTRPPFKVGGHRIGEFEGHNYGEIPVEEIIIKSSNRGTGKM 377

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQ 451
           A A+GI   ++FL +LG       E+ E        P++W  + S+TIS+GHGLS++PL 
Sbjct: 378 ALAIGIDRQQDFLKKLGFFEPTPLEIVEAAGGKPLLPARWTDLSSVTISYGHGLSSSPLH 437

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
            A A +A+ N G L+ PT + +   +  +    V+        R +LR+ V+ G+     
Sbjct: 438 LAAAYSAIANGGTLVKPTLLKQ---QGAQFGDRVMSPQVAAASRDMLRKVVSTGTASFGE 494

Query: 512 VPGFEVGGKTGTAQKVI--KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERN 567
           VPG+ VGGKTGTA K       Y       +F A+FP  DP+Y+++  +D P      + 
Sbjct: 495 VPGYHVGGKTGTADKPREQGGGYYKDKVIATFAAMFPAHDPKYVLIVTLDEPVETSGSKP 554

Query: 568 QLTAGINVAPMVGNIIRRSASMLGVKPVF 596
           + TAG    P+   +I R A +LG++P +
Sbjct: 555 RRTAGWTAVPVAAEMIGRIAPLLGLRPDY 583


>gi|240081127|ref|ZP_04725670.1| Pbp2 [Neisseria gonorrhoeae FA19]
 gi|268597238|ref|ZP_06131405.1| penicillin-binding protein 2 [Neisseria gonorrhoeae FA19]
 gi|268551026|gb|EEZ46045.1| penicillin-binding protein 2 [Neisseria gonorrhoeae FA19]
          Length = 581

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|90418200|ref|ZP_01226112.1| penicillin-binding protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90337872|gb|EAS51523.1| penicillin-binding protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 579

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 266/553 (48%), Positives = 376/553 (67%), Gaps = 4/553 (0%)

Query: 49  GCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMN 108
           G  + D     + RR +    +++R  + + + + IY ++  R++ +G    E  A    
Sbjct: 17  GTMLPDCDHFGRPRRHRGGPKNRSRFVIAMGLFVGIYGVIGGRLVMWGVAPTESAAAYGA 76

Query: 109 IDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRK 168
            D+    RPD++DRNGE+LATDI T SL+ EP ++I PDE  E L  V+P+LD + + R+
Sbjct: 77  ADKIMSDRPDLLDRNGEVLATDIKTASLFAEPRRIIDPDEASELLLGVMPDLDPKWLYRR 136

Query: 169 LSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI 228
           L+S   F WLRR+L+P QQ+ +L  G+PG+GFR EK RFYP  + A  +VG+ ++DN+G 
Sbjct: 137 LASNAGFVWLRRELTPGQQQAVLDLGIPGIGFRTEKRRFYPGGTTAGFIVGHTNVDNQGT 196

Query: 229 TGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
            G+EK++D QG   +         +L+P++L+LDLR+Q+IV  EL     +Y A + G V
Sbjct: 197 AGMEKYIDDQGYRALQDAGLAVGTDLEPVKLSLDLRVQHIVRDELAAAMARYKAIAAGGV 256

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +L+V TGEV++M S+PDYDP++  +   +   NR+S G++EMGS FK FT AM +DSG  
Sbjct: 257 VLDVHTGEVVAMTSLPDYDPNQPSQALDKDRMNRMSAGLYEMGSTFKAFTTAMALDSGKV 316

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
            + D FD   PI++G   I D+H + R+L++PE+F YSSNIG+A+ A+A+GI+GH+EFL 
Sbjct: 317 KITDSFDATRPIRMGGFTISDFHGKRRVLSVPEVFIYSSNIGSAKEAEAVGIEGHQEFLT 376

Query: 408 RLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           R+GLLS++ TELPE+  P+ P  WK+I+S+TISFGHG+STTPL TAVAAAAL+N G+LIP
Sbjct: 377 RVGLLSRMTTELPEVATPTQPKVWKQINSVTISFGHGVSTTPLNTAVAAAALMNGGKLIP 436

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV--TGGSGRRAFVPGFEVGGKTGTAQ 525
           PTF+ RSR E+E V+  VL + T   MR L R  V    GSG +A V G+ VGGKTGTA 
Sbjct: 437 PTFLPRSRAEAEAVATRVLSEKTSDEMRYLFRLNVADQRGSGNKADVTGYRVGGKTGTAN 496

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQL-TAGINVAPMVGNIIR 584
           KV+  RYSDT  FN+FL+ FP  +P+YIVL  +D PK ++     TAG+N AP VGNIIR
Sbjct: 497 KVVNGRYSDTKKFNAFLSAFPIDNPRYIVLVVIDEPKPEDGQYYATAGMNAAPTVGNIIR 556

Query: 585 RSASMLGVKPVFL 597
           RSA++LGV+P F 
Sbjct: 557 RSATLLGVRPEFG 569


>gi|39936598|ref|NP_948874.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           CGA009]
 gi|192292420|ref|YP_001993025.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           TIE-1]
 gi|39650454|emb|CAE28977.1| putative penicillin-binding protein [Rhodopseudomonas palustris
           CGA009]
 gi|192286169|gb|ACF02550.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           TIE-1]
          Length = 584

 Score =  376 bits (965), Expect = e-102,   Method: Composition-based stats.
 Identities = 212/534 (39%), Positives = 337/534 (63%), Gaps = 6/534 (1%)

Query: 69  HSKNRIGMTIVVCLVIYIILAIRIIQYGNI-HPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
            ++ R+G+ ++    +Y I+A ++              + + D    +RPDI+DRNG++L
Sbjct: 34  KARARVGLAMIAFAAVYGIIAFKLSMIAVFGDGHGARRTGSQDAVATARPDIVDRNGQVL 93

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           ATD+ T SL+ EP ++I  DE +E L   LP+L+++ +R +L+S+  F WL+R+++P+QQ
Sbjct: 94  ATDVKTPSLFGEPRRLIDQDEAVELLTATLPDLETQEVRERLASKKGFVWLKREITPRQQ 153

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTN 247
             I   G+PG+GF  E  R YP A+  SH++G V+IDN+GI GIEK+LD  GL  +    
Sbjct: 154 AEIKKLGIPGIGFLRENKRVYPNAAEVSHLIGLVNIDNQGIAGIEKWLDNNGLADLHRAG 213

Query: 248 KGE-KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYD 306
               +  +PI LALD+R+ + +  EL++ K+KY+A++   ++ NV TGE+++MVS+PD+D
Sbjct: 214 FASDRMQRPIELALDVRVTHALRDELIKAKEKYSAKAASGLVSNVKTGEIVAMVSLPDFD 273

Query: 307 PHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVI 366
           P+   +       NR++ G++EMGS FK  T+AM +D+G  T+  ++D R P+  GK  I
Sbjct: 274 PNNPREANDPDRINRLTTGVYEMGSTFKTLTLAMALDAGKATLHSMYDARGPLHYGKFKI 333

Query: 367 HDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPS 426
           HD H   R +++ E+F YSSN+GAA++A +MG++ HK FL ++G L +L TELPE  +P 
Sbjct: 334 HDSHNMGRAISLAEVFTYSSNVGAARVALSMGVEAHKAFLKKVGQLDRLRTELPESASPI 393

Query: 427 YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVL 486
            P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ R+ E+++K+ + V+
Sbjct: 394 VPKRWSELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFLKRTEEDAKKLGKRVI 453

Query: 487 KKNTVKTMRSLLREGVTGGSGRRAF--VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAV 544
           K  T   +R L+R     G+ + A     G+ +GGKTGT++KV+  RY+     NSF A+
Sbjct: 454 KTETSDKIRYLMRLNAEVGTAKTADQIAKGYYIGGKTGTSEKVVNGRYAKKQVLNSFTAI 513

Query: 545 FPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
            P  +PQY VL  +D PK         T+G N  P  G +I R A +LG++P F
Sbjct: 514 LPADNPQYQVLVMLDEPKALPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|91977866|ref|YP_570525.1| peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB5]
 gi|91684322|gb|ABE40624.1| Peptidoglycan glycosyltransferase [Rhodopseudomonas palustris
           BisB5]
          Length = 584

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 218/535 (40%), Positives = 338/535 (63%), Gaps = 6/535 (1%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGNI-HPEPIAPSMNIDEYGMSRPDIIDRNGEI 126
           A ++ R+G+ ++    +Y ++A ++              + + D    +RPDI+DRNG I
Sbjct: 33  AKARARVGLAMLAFAAVYGVIAFKLSMIALFGDSHGTRRTASQDAIATARPDIVDRNGTI 92

Query: 127 LATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           LATD+ + SL+ EP ++I  DE +E L   LP+L+++ +R +L+S+  F WL+R+++P+Q
Sbjct: 93  LATDVKSPSLFGEPRRIIDQDEAVELLTATLPDLETQEVRERLASKKGFVWLKREITPRQ 152

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTT 246
           Q  I   G+PG+GF  E  R YP  +  SH++G V+IDN+GI GIEK+LD  GL  +   
Sbjct: 153 QADIKKLGIPGIGFLRENKRVYPTGTEVSHLIGLVNIDNQGIAGIEKWLDNNGLADLHRA 212

Query: 247 NKGEKNLQ-PIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDY 305
                 LQ P+ LA+D+R+++ +  EL++ K KY+A++   ++ NV+TGE+++MVS+PD+
Sbjct: 213 GFASDRLQRPVELAVDIRVEHALRDELLKAKNKYSAKAASGLVSNVNTGEIVAMVSLPDF 272

Query: 306 DPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHV 365
           DP+   +       NR++ G++EMGS FK  T+AM +DSG  T+  L+D R  ++ GK  
Sbjct: 273 DPNNPREANDPDRINRLTTGVYEMGSTFKTLTLAMALDSGKATLNTLYDARGALRYGKFA 332

Query: 366 IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAP 425
           IHD HP  R +T+ E+F +SSN+GAA+IA A G++ HK FL ++G L +L TELPE  +P
Sbjct: 333 IHDTHPLGRPITLAEVFTFSSNVGAARIAIAQGVEAHKAFLKKVGQLDRLRTELPESASP 392

Query: 426 SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIV 485
             P +W  ++++TISFGHG++  PLQ  +   A++N G LIPPTF+ RS E++ K+++ V
Sbjct: 393 IVPKRWGELNTITISFGHGVAVAPLQAVMGINAMVNGGYLIPPTFLKRSEEDALKMAKRV 452

Query: 486 LKKNTVKTMRSLLREGVTGGSGRRAF--VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
           +KK T   +R L+R     G+ R A     G+ +GGKTGT++KVI  RY+     NSF A
Sbjct: 453 VKKETSDKIRYLMRLNAEIGTARTADQIAKGYYIGGKTGTSEKVINGRYAKKQVLNSFTA 512

Query: 544 VFPTTDPQYIVLSFMDSPKIKERNQL--TAGINVAPMVGNIIRRSASMLGVKPVF 596
           V P  +PQ+ VL  +D PK         T+G N  P  G +I R A +LG++P F
Sbjct: 513 VLPADNPQFQVLVMLDEPKALPETHGFITSGWNAVPTGGKVIERIAPLLGIEPRF 567


>gi|288576013|ref|ZP_05978001.2| peptidoglycan glycolsyltranferase FtsI [Neisseria mucosa ATCC
           25996]
 gi|288566550|gb|EFC88110.1| peptidoglycan glycolsyltransferase FtsI [Neisseria mucosa ATCC
           25996]
          Length = 597

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 162/559 (28%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPDI 119
           K    S  RI + +    + +  L  R I       E +        +       SR  I
Sbjct: 34  KKPVTSDGRIRIVLGCMALAFTALLGRGIYLQTTQHEFLKNQGDQRFVRTLTLPASRGMI 93

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRKLSSETK-FQ 176
            DRNG  LA   PT SLY  P  +      E + KL  ++ +L  E ++ KL+ + K F 
Sbjct: 94  TDRNGATLALSAPTESLYAMPSGMEEMPTAEQLTKLAAIV-DLPVETLQDKLAKKDKDFI 152

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+E    
Sbjct: 153 YLKRQLSQEKAEEIKALGIKGLAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGLELSRE 212

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V   NKG              KN Q + L+LD RIQ + + EL +    
Sbjct: 213 DSLHGADGAKVVLRDNKGNIVDSLDSPRNSDPKNGQDMVLSLDQRIQTLAYDELNKAVAY 272

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++V+ P YDP++      E   NR    + E GS  K FTI
Sbjct: 273 HKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGSADSEQRRNRAVTDMIEPGSAMKPFTI 332

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG   V D F+T                    L +  I + SSN+G ++++    
Sbjct: 333 AKALDSGKVGVADRFNTMPYKI--GPATVRDTHVYPTLDVRGIMQKSSNVGTSKLSAKFT 390

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 391 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQPIEQATMSFGYGLQLSLLQLARAY 450

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T + +R L+      GG+G    V GF
Sbjct: 451 TMLTHDGELLP---VSFEKQAVAPKGKRVIKASTAREVRDLMVSVTEPGGTGTAGAVDGF 507

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 508 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVA 564

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 565 GPVFKQVMGGSLNILGVSP 583


>gi|240128814|ref|ZP_04741475.1| Pbp2 [Neisseria gonorrhoeae SK-93-1035]
 gi|268687196|ref|ZP_06154058.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-93-1035]
 gi|293398481|ref|ZP_06642659.1| cell division protein FtsI (penicillin binding protein 3)
           [Neisseria gonorrhoeae F62]
 gi|129665|sp|P08149|PBP2_NEIGO RecName: Full=Penicillin-binding protein 2; Short=PBP-2
 gi|150279|gb|AAA25463.1| penicillin binding protein 2 [Neisseria gonorrhoeae]
 gi|268627480|gb|EEZ59880.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-93-1035]
 gi|291610952|gb|EFF40049.1| cell division protein FtsI (penicillin binding protein 3)
           [Neisseria gonorrhoeae F62]
          Length = 581

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|163732139|ref|ZP_02139585.1| penicillin-binding protein, putative [Roseobacter litoralis Och
           149]
 gi|161394437|gb|EDQ18760.1| penicillin-binding protein, putative [Roseobacter litoralis Och
           149]
          Length = 593

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 168/564 (29%), Positives = 288/564 (51%), Gaps = 17/564 (3%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
                    E+ +   ++ R +    ++ R+ +  +  +V + ++ +R+       P   
Sbjct: 19  GENPDAIERENIRIRHEQMRDQARQRAEGRLLVLGLFFVVAFGVVGLRMGMLATSEPTEP 78

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE 163
                  +   +R DI+DR+G +LAT+  T +LY +P ++I P+   ++L  V P+LD+ 
Sbjct: 79  RVDAPGAQIHAARADIVDRHGNLLATNFETHALYAQPPQMIDPEHAAQELAKVFPDLDAA 138

Query: 164 MIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
            +    + + KF W++RK+SP+Q + +   G PG+ F     R YP    A+HV+G    
Sbjct: 139 DLLEDFTGKRKFLWVKRKISPEQMQAVHEIGDPGLLFATRDMRLYPNGQLAAHVLGGASF 198

Query: 224 DNRGITGIEKFLDMQGLTRV--FTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
              G+   E  + + G+ +             QP++L+LDL +Q    + L    K  NA
Sbjct: 199 GKEGVKAAE-VIGVAGVEKYFDEYLRDPATVSQPLQLSLDLTVQAAAERVLYGGMKLMNA 257

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFK------GKKEGWFNRISYGIFEMGSIFKV 335
           +   +++++V TGEVIS+VS+P +DP+   +            FNR   G++E+GS FK+
Sbjct: 258 KGATSILMDVHTGEVISVVSLPTFDPNNRPRPATSGDASDSPLFNRSVQGVYELGSTFKI 317

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIAD 395
           FT+A  +D GL     + DT+ P++ GKH I D+      +++ ++   SSNIG A+IA 
Sbjct: 318 FTVAQAMDLGLVNPDSIIDTKGPLRWGKHRIRDFRNYGDEMSVTKVIVKSSNIGTARIAQ 377

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTA 453
            +G+   K FL  LG+L     E+ E        P  W  + ++TIS+GHGLST+P+  A
Sbjct: 378 DIGVARQKAFLGELGMLETTGFEIVEAATGRPLLPPNWSELSTMTISYGHGLSTSPMHLA 437

Query: 454 VAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVP 513
              AA+ N G  + PT +      + +    V  +++    R +LR+ VT G+     V 
Sbjct: 438 AGYAAIANGGYRVQPTILKA---TNPEKGPRVFSESSSAASRKMLRQVVTEGTASFGNVE 494

Query: 514 GFEVGGKTGTAQKVI-KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSP--KIKERNQLT 570
           G+ VGGKTGTA K   +  Y +     +F ++FP  DP+Y+++  +D P     +  + T
Sbjct: 495 GYAVGGKTGTADKPGSRGGYYEDKVIATFASIFPIDDPKYVLIVTLDEPVETTSDEPRRT 554

Query: 571 AGINVAPMVGNIIRRSASMLGVKP 594
           AG    P+   +IRR A +LG++P
Sbjct: 555 AGWTAVPVAAEMIRRVAPLLGLRP 578


>gi|88811844|ref|ZP_01127097.1| Peptidoglycan glycosyltransferase [Nitrococcus mobilis Nb-231]
 gi|88790728|gb|EAR21842.1| Peptidoglycan glycosyltransferase [Nitrococcus mobilis Nb-231]
          Length = 575

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/558 (26%), Positives = 253/558 (45%), Gaps = 34/558 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIH-----PEPIAPSMNIDEYGMSRPDI 119
           K    S+ R    +   +     L  R +    ++      +  A  +   E    R  I
Sbjct: 9   KPQPLSRWRPVALMCCFIGFAGALLWRAVDLQVLNRDFLLNQGAARFLRDVEIPAHRGVI 68

Query: 120 IDRNGEILATDIPTFSLYVEPHKVI-SPDEIIEKLQIVLPNLDSEMIRRKLS--SETKFQ 176
            DRNGE LA   P  S++ +P  ++ +  + I +L  +L  LD+E +R  L    + +F 
Sbjct: 69  RDRNGEPLAISTPVDSVWADPSDLLLASRDKIARLAQLL-QLDAERLRADLRARQDREFV 127

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +LRR+++P   + ++   LPGV  + E  RFYPA   A  +VG+ ++D+ G  G+E   +
Sbjct: 128 YLRRRITPTLGQEVVDLRLPGVALQREYRRFYPAGEVAGQLVGFTNVDDVGQEGVELAFN 187

Query: 237 MQ-----GLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYN 280
                  G  RV     G            K    + L++D R+Q I ++ L    +K+ 
Sbjct: 188 NWLRGEPGAKRVIKDRLGRVIEDIERLREPKPGHALVLSVDRRLQYIAYRALKAAVRKHG 247

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A S   V+L+  TGEV++MV+ P ++P++  +     + NR     FE GS  K FTIA 
Sbjct: 248 ARSGSLVLLDARTGEVLAMVNQPAFNPNDRAELIPSHYRNRAVTDAFEPGSSLKPFTIAA 307

Query: 341 GIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQ 400
            +DSG F    L DT   +               ++ +  +   SSN+GAA+IA  +   
Sbjct: 308 ALDSGRFAPHSLVDTTPGVLRVASDTVHDVRNYGVIDVMTVIEKSSNVGAAKIALDLKPG 367

Query: 401 GHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAA 458
                L R+G      +  P               I   T++FG+G+S T LQ A A  A
Sbjct: 368 TVWRMLGRVGFGRSTGSGFPGEAGGYLSGRPPRYPIDRATLAFGYGVSATALQLAQAYTA 427

Query: 459 LINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEV 517
           + N+GRL+P + +      +    + V+   + + +RS++ + V+  G+  +A +PG+ +
Sbjct: 428 IANDGRLLPVSLLRV---NNAPAGQSVISARSARAVRSMMEQVVSSEGTAPKAAIPGYRI 484

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
            GKTGT +K     YSD      F+ + P + P+++    ++ P  K       G+  AP
Sbjct: 485 AGKTGTVKKSASGGYSDRRYAALFVGIAPASAPRFVCAVIINEPTGKP---YYGGLVAAP 541

Query: 578 MVGNIIRRSASMLGVKPV 595
           +  ++I  +  +  V P 
Sbjct: 542 IFRHVIEGALRLRNVPPD 559


>gi|323137899|ref|ZP_08072974.1| Peptidoglycan glycosyltransferase [Methylocystis sp. ATCC 49242]
 gi|322396902|gb|EFX99428.1| Peptidoglycan glycosyltransferase [Methylocystis sp. ATCC 49242]
          Length = 600

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 210/536 (39%), Positives = 319/536 (59%), Gaps = 4/536 (0%)

Query: 66  VIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGE 125
            ++ S  R+ +     L +Y ++  +++  G             +    SRPDI+DRNGE
Sbjct: 38  SLSSSAPRMKLAAFGFLALYGVIGAKLVYLGFRPEPATTRRAAAEAVAASRPDILDRNGE 97

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           +LA+D+   S++ EP ++I  DE  E L  VLP++DS+ +R +L S+  F W++R+++P 
Sbjct: 98  VLASDVKVMSVFAEPRRLIDKDEATELLTAVLPDVDSKELRERLGSKKGFVWVKREVTPH 157

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFT 245
           Q+  +   GLPGVG   E  R YP     +HV+G+ +IDN+GI G+EK++D QGL  +  
Sbjct: 158 QRDEVFHLGLPGVGLIAENKRVYPNGPIGAHVLGFANIDNQGIAGVEKYIDGQGLADLHN 217

Query: 246 TNKG--EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIP 303
              G    +L+PI L+LD+R  + +  EL +    + A++    IL+V+TGEV++M S+P
Sbjct: 218 MGFGATPDDLKPISLSLDIRATHALRDELEKGVIHFKAKAGAAAILDVNTGEVVAMASLP 277

Query: 304 DYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
           DYDP++          NR+S G++EMGS FK  TIAM +DSG   +    D R  +  G+
Sbjct: 278 DYDPNKPTDALDPLHINRMSVGVYEMGSTFKALTIAMALDSGKVNLNSRLDARGALSFGR 337

Query: 364 HVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQ 423
             IHDYH QNR LT+PE+F YSSN+G A++A   G++ HK FL ++G L+++ TELPE  
Sbjct: 338 FKIHDYHAQNRALTVPEVFTYSSNVGTARMAMGQGVEKHKAFLRKMGQLTRMRTELPESA 397

Query: 424 APSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSR 483
            P  P  W  ++++TI+FGHGL+  PLQ  +A  AL+N G L+ PTF+ R+ EE+ K + 
Sbjct: 398 EPIVPKNWGELNTMTIAFGHGLAVAPLQAMMAVGALMNGGYLMTPTFLKRTPEEAMKTAV 457

Query: 484 IVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLA 543
            V+K  T + MR L+R     G+ ++  + G+ VGGKTGTA+KVI   YS    F +F+A
Sbjct: 458 QVVKPETSEAMRYLMRLNAEIGTAKKVNIDGYFVGGKTGTAEKVIGGHYSKNRLFTTFMA 517

Query: 544 VFPTTDPQYIVLSFMDSPKIKERNQLT--AGINVAPMVGNIIRRSASMLGVKPVFL 597
           V P+  P+Y+ L+ MD P+          A  N   + G II R   +LG+ P F 
Sbjct: 518 VAPSDKPKYLFLTIMDEPQGLPETGGYATAAYNSGHVTGEIIERVGPILGLAPRFE 573


>gi|254509148|ref|ZP_05121248.1| peptidoglycan glycolsyltranferase FtsI [Vibrio parahaemolyticus 16]
 gi|219547945|gb|EED24970.1| peptidoglycan glycolsyltranferase FtsI [Vibrio parahaemolyticus 16]
          Length = 575

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 144/557 (25%), Positives = 242/557 (43%), Gaps = 36/557 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +    + +  L  RI     I P     +    S+       +R  I DRN E
Sbjct: 22  RWRFNLVLCCVFIAFSALVGRIAYIQIIEPDNLIKQGDLRSVRAKTLHSARGIISDRNDE 81

Query: 126 ILATDIPTFSLYVEPHKVISPDEI-----IEKLQIVLPNLDSEMIRRK-LSSETKFQWLR 179
            LA  +P  +++ +P  +     +        L  VL     E+I +   + + +F +L+
Sbjct: 82  PLAVSVPVEAVWADPVTIFKEGGLSDIDRWHALADVLGIKRGELIEKINRNKKRRFIYLQ 141

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ- 238
           R++SP     I    L GVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 142 RQVSPAMAHYIRELRLAGVGLKAESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDKWL 201

Query: 239 ----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
               G   +     G           +  +P++L +D RIQ I ++ + +    Y A S 
Sbjct: 202 TGEAGKRIIRKDRYGRVVENISLEEREEGKPLKLTIDQRIQAIAYRAIKQAVADYRATSG 261

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             VIL+V TG V++MV+ P Y+P+     +     NR+    FE GS  K F +   +++
Sbjct: 262 SAVILDVKTGAVLAMVNAPSYNPNNRSDLQSAKMRNRVITDAFEPGSTVKPFVVLAALEN 321

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G+     + DT N I            +     +  I + SSNIG A++A  M ++    
Sbjct: 322 GVADDDTVIDTGNGIMQIGGSRVRDTSKVGKADLTTILKKSSNIGVAKLALDMPLEALLG 381

Query: 405 FLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +G        L       +P+  +W +    T+SFG+GL+ TPLQ A A A L N 
Sbjct: 382 MYSSVGFGEVSGLNLVGETQGIFPNRRRWSKFEIATLSFGYGLTITPLQLAHAYATLGNF 441

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G+  P   +       +  SR V+  +    + ++L      GG+  +A VPG+ V  KT
Sbjct: 442 GKYQPIHIIE---NNDQDFSRQVIDSDNAHKVLAMLETVTQPGGTATKAAVPGYRVAAKT 498

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GT++K I   Y D   F     V P +DP+  ++  ++ P+    +    G    P+   
Sbjct: 499 GTSRKAIAGGYGDE-YFAYTAGVAPASDPRVALVVVVNEPQ---GDNYYGGSVAGPVFSE 554

Query: 582 IIRRSASMLGVKPVFLK 598
           I++ +  +L V P   +
Sbjct: 555 ILKGTLQILNVAPDENR 571


>gi|31296663|gb|AAP46624.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+S G+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSCGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|31296653|gb|AAP46619.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  376 bits (964), Expect = e-102,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFGPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|31296659|gb|AAP46622.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345840|gb|AAM97214.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A   
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARTY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|292490618|ref|YP_003526057.1| peptidoglycan glycosyltransferase [Nitrosococcus halophilus Nc4]
 gi|291579213|gb|ADE13670.1| Peptidoglycan glycosyltransferase [Nitrosococcus halophilus Nc4]
          Length = 567

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 161/559 (28%), Positives = 270/559 (48%), Gaps = 38/559 (6%)

Query: 68  AHSKN-----RIGMTIVVCLVIYIILAIRIIQYGNIH-----PEPIAPSMNIDEYGMSRP 117
           +  +N     R+G+  +V  V  + LA R+++    +      E  A  + + E    R 
Sbjct: 2   SRGRNKGYPARLGVVGLVFAVAAVGLAWRLVELQVFNRDFLRGEGEARHLRVVEVPAHRG 61

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKF 175
            I DR+GE LA   P  S++  P  +    E    L   +  + +  + R++      +F
Sbjct: 62  MITDRHGEPLAVSTPVASVWFNPQLLREARERWPALAKAV-GVSTAYLSRRIKEGGEREF 120

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +L+R + P   +++ +  +PGV  + E  R+YPA S A+HVVG+ +ID+RG  G+E   
Sbjct: 121 VYLKRWVEPNVARQVQALDIPGVNLQSEYRRYYPAGSVAAHVVGFTNIDDRGQEGLELAF 180

Query: 236 DM-----QGLTRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKY 279
           D       G  RV   ++G            +  Q +RL++DLR+Q + ++EL    + +
Sbjct: 181 DKTLQGVPGKKRVIRDSRGRVVEDVENLRVPRPGQDLRLSIDLRLQYLAYRELKAAVRTH 240

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIA 339
           NA +   VIL+V TGEV++MV+ P Y+P++  + K   + NR    +FE GS  K FTI 
Sbjct: 241 NARAGSLVILDVDTGEVLAMVNRPSYNPNDRSQLKSHLYRNRAVTDLFEPGSTIKPFTIG 300

Query: 340 MGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
           + ++SG +      DT          +         + +  + + SSN+GA++IA ++  
Sbjct: 301 VALESGKYHPHTPIDTTPGYFRVGRHVIRDIRNYGRVDVSTVIKKSSNVGASKIALSLDS 360

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAA 457
           Q   +   + GL +   +  P       P  +   +I   T++FG+GLS T LQ A A A
Sbjct: 361 QRLWQGFAQAGLGASTASGFPGEAEGHLPDPFSFRQIEQATLAFGYGLSVTTLQLARAYA 420

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFE 516
           AL   G L P +F+ R +       R V  ++TV  + S+L E V  GG+G RA VP + 
Sbjct: 421 ALGAGGELKPVSFLHREQAAGG---RQVWSESTVSALLSMLEEVVSEGGTGERAHVPSYR 477

Query: 517 VGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVA 576
           V GKTGT +K I+  Y+D    + F  + P + P+   +  +D P+ K       G   A
Sbjct: 478 VAGKTGTVKKAIRGGYADERYVSLFAGLIPASRPRLAAVVLIDEPQGKI---YYGGQVAA 534

Query: 577 PMVGNIIRRSASMLGVKPV 595
           P+   ++  +  +L + P 
Sbjct: 535 PVFSRVMVGAMRLLNIAPD 553


>gi|254673387|emb|CBA08683.1| peptidoglycan synthetase precursor [Neisseria meningitidis
           alpha275]
 gi|319411058|emb|CBY91458.1| penicillin-binding protein 2 (PBP-2) [Neisseria meningitidis WUE
           2594]
          Length = 560

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/556 (26%), Positives = 259/556 (46%), Gaps = 38/556 (6%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDR 122
             S  RI   ++   V++  L  R +         +  +     +       +R  + DR
Sbjct: 1   MTSNGRISFVLMAIAVLFAGLITRGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTVSDR 60

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQWLR 179
           NG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F W++
Sbjct: 61  NGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFIWIK 119

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD--- 236
           R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+   
Sbjct: 120 RQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSL 179

Query: 237 --MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNA 281
               G   V    +G              KN + I L+LD RIQ + ++EL +  + + A
Sbjct: 180 HGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEYHQA 239

Query: 282 ESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMG 341
           ++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F IA  
Sbjct: 240 KAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKA 299

Query: 342 IDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQG 401
           +D+G   + +  +T+                   L +  I + SSN+G ++++   G + 
Sbjct: 300 LDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEE 357

Query: 402 HKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAAL 459
             +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A  AL
Sbjct: 358 MYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTAL 417

Query: 460 INEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVG 518
            ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF+VG
Sbjct: 418 THDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGFDVG 474

Query: 519 GKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPM 578
            KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+   P 
Sbjct: 475 AKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVAGPP 531

Query: 579 VGNIIRRSASMLGVKP 594
              I+  S ++LG+ P
Sbjct: 532 FKKIMGGSLNILGISP 547


>gi|509190|emb|CAA42188.1| penicillin-binding protein 2 [Neisseria meningitidis]
 gi|31296569|gb|AAP46577.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345768|gb|AAM97178.1| PenA [Neisseria meningitidis]
 gi|32345770|gb|AAM97179.1| PenA [Neisseria meningitidis]
 gi|37651048|emb|CAD70591.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 152/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|31296635|gb|AAP46610.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 583

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 154/559 (27%), Positives = 264/559 (47%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+        V  D H     L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKIGPSPVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFG 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 437 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 494 DVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 551 GPPFKKIMGGSLNILGVSP 569


>gi|254465124|ref|ZP_05078535.1| peptidoglycan glycosyltransferase [Rhodobacterales bacterium Y4I]
 gi|206686032|gb|EDZ46514.1| peptidoglycan glycosyltransferase [Rhodobacterales bacterium Y4I]
          Length = 594

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 174/567 (30%), Positives = 291/567 (51%), Gaps = 18/567 (3%)

Query: 43  HNLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEP 102
                     E+     Q+ + +    ++ R+ +  +  +  +  +  R+       P  
Sbjct: 18  TGANPDAIERENLSLRHQEMQVQARQRAEGRLLVLGLFFVCAFGAIIARMAMTAVSEPAE 77

Query: 103 IAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDS 162
              S+      M R DI+DR G +LAT+  T SLY +P ++I P    EKL  + P+LD 
Sbjct: 78  PVASVPGSAIAMQRADIVDREGRLLATNFETHSLYAQPPQMIDPIGAAEKLVEIFPDLDR 137

Query: 163 EMIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVD 222
           E + +  + + KF W+++K+SP+Q + +   G PG+ F   + R YP  S A+HV+G   
Sbjct: 138 ERLIKDFTGKRKFLWVKKKISPEQLQAVHDIGDPGLMFGPREMRLYPNGSLAAHVLGGAG 197

Query: 223 IDNRGITGIEKFLDMQGLTRVFTT--NKGEKNLQPIRLALDLRIQNIVHQELVENKKKYN 280
               G+   E  + + G+ R F           +P++L+LDL +Q    Q L    K  N
Sbjct: 198 FGKEGVNAAE-VIGVAGVERQFDDYLRDPANAGKPLQLSLDLTVQAAAEQVLYGGMKLMN 256

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGK-------KEGWFNRISYGIFEMGSIF 333
           A+   +++++  TGEVIS+VS PD+DP++  +             FNR   G++E+GS F
Sbjct: 257 AKGATSILMDAHTGEVISVVSFPDFDPNDRPRPPTSGFDPSDSPLFNRAVQGVYELGSTF 316

Query: 334 KVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQI 393
           K+FT A  +D GL     + DTR P++ G+  I D+      +++ +I   SSNIG A++
Sbjct: 317 KIFTAAQAMDLGLVGADTVIDTRGPLRWGRFAIRDFRNYGNEMSVTKIIVKSSNIGTARL 376

Query: 394 ADAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQ 451
           A  +G++  K FL  +G+L     E+ E        P+ W  + ++TIS+GHG+STTP+ 
Sbjct: 377 AQQIGVERQKSFLQTMGMLDPTPFEISEAAGGKPLLPANWSELSAMTISYGHGISTTPMH 436

Query: 452 TAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAF 511
            A   AA+ N GR + PT + R      ++ + V+ + +    R +LR+ V+ G+   A 
Sbjct: 437 LAAGYAAVANGGRYVAPTILKR---NGPQLGQRVMSEASAAAARKMLRKVVSEGTASFAE 493

Query: 512 VPGFEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ-- 568
           V G++VGGKTGTA K      Y +     +F ++FP  DP+Y+++  +D P I    +  
Sbjct: 494 VEGYQVGGKTGTADKPKPRGGYYEDKVIATFASIFPAHDPKYVLIVTLDEPSIIAHGEER 553

Query: 569 LTAGINVAPMVGNIIRRSASMLGVKPV 595
            TAG   AP+   +I R A ++G++P 
Sbjct: 554 RTAGWTAAPVAAEMIGRIAPLVGLRPQ 580


>gi|167572936|ref|ZP_02365810.1| penicillin-binding protein [Burkholderia oklahomensis C6786]
          Length = 595

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 134/551 (24%), Positives = 242/551 (43%), Gaps = 35/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFIVILVFIAFGTLIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEK-LQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A  + T+ ++  P +V   DE+    L  +L ++    +RR+L+S+  F  L+R++ P+ 
Sbjct: 90  AVSLTTYEIWANPKQV---DEVAYAPLAKLL-DMPLAEVRRRLTSDRSFVLLKRQVDPET 145

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
             RI    + G+    +  RFYP    A+HVVG+ +++++G  G+E   + +     G  
Sbjct: 146 AARIEKLDVDGITQVADSKRFYPEGESAAHVVGFTNVEDQGQEGVELAANGRLSGTAGQR 205

Query: 242 RVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +V     G            ++   I L +D RIQ + + +L       NA++   V+L+
Sbjct: 206 QVIRDRLGRIISDTSPLVPAQHGATIELTIDRRIQQLAYAQLKSAIVANNAQAGSVVVLD 265

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
              GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    +
Sbjct: 266 AQNGEILALANYPTFDPNDRTRLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDAGKVRPQ 325

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            + DT          +      +  +T+ +  + SSNI  A++A  +  +         G
Sbjct: 326 TIIDTSPGSYRIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYG 385

Query: 411 LLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +    +   P + +       +W+ I   T+++G+GLS + LQ A    A   +G L P 
Sbjct: 386 IGRAPDLTFPGVASGRLRPYKRWRPIEQATMAYGYGLSASLLQIAQVYTAYAGDGTLHPV 445

Query: 469 TFMIRSREESEK---VSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTA 524
           + +    +           V    T   +RS+L   V  GG+GR A V G+ +GGKTGTA
Sbjct: 446 SLLRTHTDPPSVDAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRIGGKTGTA 505

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K +   Y+       F  + P ++P+ IV   +D P  +       G    P+  +++ 
Sbjct: 506 RKQVGASYAKGKYRALFSGMAPMSNPRLIVAVMIDEPGARS---YYGGTVAGPVFSSVMS 562

Query: 585 RSASMLGVKPV 595
            S  +LGV P 
Sbjct: 563 GSLQLLGVPPD 573


>gi|49474462|ref|YP_032504.1| penicillin-binding protein [Bartonella quintana str. Toulouse]
 gi|49239966|emb|CAF26371.1| Penicillin-binding protein [Bartonella quintana str. Toulouse]
          Length = 580

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 257/555 (46%), Positives = 366/555 (65%), Gaps = 4/555 (0%)

Query: 47  QKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS 106
           QK   + +  D      R+  + ++ R+  +++  L++Y ++   +I YG    +     
Sbjct: 9   QKKKRLNNQLDFHNFSIRRSYS-ARPRLLFSLLCFLILYGVIGACLISYGLEGGQIEEAK 67

Query: 107 MNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIR 166
                   +RPDIIDRNG +LATDI T+SL+ EP +VI  DE IE L  VL +L+     
Sbjct: 68  GPGVLQLTARPDIIDRNGRLLATDIKTYSLFAEPRRVIDVDETIELLSTVLSDLNWHETY 127

Query: 167 RKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR 226
           ++L  ++ F W++R L+P Q+ +I++ G+PG+GFR E  RFYP  S ASH++G V++DN+
Sbjct: 128 KRLKRKSGFSWIQRGLTPTQKAQIMALGIPGIGFRPEIRRFYPGGSVASHILGMVNVDNQ 187

Query: 227 GITGIEKFLDMQGLTRVFTTNKG-EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
           GI G+EK++D  GL+ + +     E+ L+PI+L++D+RIQ IVH EL++  K+Y A + G
Sbjct: 188 GIAGMEKYIDDAGLSALRSAGLATEEALKPIQLSIDVRIQAIVHDELIKAMKRYKAIAAG 247

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            VILN+ T EV++MVS+PD+DP       K    NRI+ G FEMGSI K FT AM +DS 
Sbjct: 248 AVILNIHTNEVLAMVSVPDFDPGNPVDALKSDRLNRITAGAFEMGSIMKSFTTAMALDSD 307

Query: 346 LFTVKD-LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           +F +   +  ++       ++IHD+H +NR LT+ E+F YSSNIG+A+ A A+GI+ H+ 
Sbjct: 308 MFHLNSLIDASKPIQASSGYIIHDFHGKNRPLTLWEVFIYSSNIGSAKEALAIGIEKHRA 367

Query: 405 FLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
           FL +LGLL +L TELPE+  P  P  WK IHS+TISFGHG++TTPLQTAV AAAL+N G 
Sbjct: 368 FLKKLGLLDRLTTELPEVTHPIVPRHWKDIHSMTISFGHGMATTPLQTAVGAAALMNGGW 427

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTA 524
           LI PTF+ R++E++ K ++ VL+  T + MR L +     GSGR A V G+ VGGKTGTA
Sbjct: 428 LIAPTFLKRTKEQALKQAKQVLQAKTSQNMRYLYKLNSDIGSGRNAKVEGYRVGGKTGTA 487

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER-NQLTAGINVAPMVGNII 583
           +KV   +YS T NFNSFLA FP  DP Y+VL+ +D PK ++     TAG+N  PM+ NI+
Sbjct: 488 EKVENGKYSKTKNFNSFLAAFPIEDPAYVVLTIIDEPKPEDGKYAATAGLNAGPMLSNIV 547

Query: 584 RRSASMLGVKPVFLK 598
           RRSAS LG+KP F K
Sbjct: 548 RRSASFLGIKPDFKK 562


>gi|32345902|gb|AAM97245.1| PenA [Neisseria meningitidis]
 gi|32345904|gb|AAM97246.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 159/559 (28%), Positives = 267/559 (47%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRKLSSETK-FQ 176
            DRNG +LA   PT SL+  P ++      E +EKL  +  ++  E+++ KLS + K F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPTVEQLEKLSAI-ADVPVEVLKNKLSKKDKGFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G  G+E   +
Sbjct: 138 YLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKGQEGLELSRE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V   NKG              KN Q + L+LD RIQ + + EL +    
Sbjct: 198 DSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAYDELNKAVAY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  K FTI
Sbjct: 258 HKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|297539598|ref|YP_003675367.1| peptidoglycan glycosyltransferase [Methylotenera sp. 301]
 gi|297258945|gb|ADI30790.1| Peptidoglycan glycosyltransferase [Methylotenera sp. 301]
          Length = 586

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/552 (26%), Positives = 245/552 (44%), Gaps = 36/552 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + ++  L+ ++ L  R +         +  +  A           R  I DR+GE+L
Sbjct: 23  RRRVLLIAVLLGFVALLGRGVYLQSIHKKFLQDKGDARYSRNLVLTSQRGKITDRHGELL 82

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A   P  S++  P  V+      +++  +L     E+ ++  + E +F +L+R++SP+  
Sbjct: 83  AISTPVESVWASPPDVVIDAAQTKQIAALLNLKPDEVKKKLANDEREFVYLKRRISPELA 142

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNR-----GITGIEKFLDM----- 237
            +++  G+PG+  + E  R+YPA    +H+VG+   D++     G+ G E  ++      
Sbjct: 143 AKVMKLGIPGIELQREYKRYYPAGDVTAHMVGFTGPDDKGTGDRGLEGYELAMNGPLSGV 202

Query: 238 QGLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
            G  RV     G            ++ + + LALDLRIQ I H+ELV+  ++  A +   
Sbjct: 203 DGSRRVIKDRSGHIIEDLQAVKVPQDGRDVSLALDLRIQYIAHRELVKAVEENKAAAGAA 262

Query: 287 VILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGL 346
           ++L+  TGEV++M ++P Y+P+     K +   NR     FE GS  K  T A  ++SG 
Sbjct: 263 IVLDAKTGEVLAMTNVPTYNPNNPVNIKGKT-RNRAIVDTFEPGSTLKPVTAAAALESGQ 321

Query: 347 FTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFL 406
           +T      T                   ILT+ ++ + SSN+GA++IA  +  Q      
Sbjct: 322 YTPDTKIQTSPGSLTIGPATIHDSHPQGILTVAQVIQKSSNVGASKIALTLDKQFMWNVY 381

Query: 407 YRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGR 464
             LGL        P            W+ I   T+SFGHG+S T LQ A       NEG 
Sbjct: 382 NELGLGHVEGVGFPGEATGRLRPYKTWRPIEMATMSFGHGISLTLLQLARLYTVFANEGE 441

Query: 465 LIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGT 523
           L P + +         + + V    T  +++ +L   V  GG+  +A V G+ VGGKTGT
Sbjct: 442 LRPVSLLKI---NEVPIGQQVFSAATANSVKDMLELVVQPGGTAVKAQVLGYRVGGKTGT 498

Query: 524 AQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           A K     Y +     SF+ + P ++P++I+   +D P          G   AP+   I+
Sbjct: 499 AHKPGIHGYEENKYVASFVGMAPASNPRFIIAVMIDEPNN---GAYYGGTVAAPVFSTIM 555

Query: 584 RRSASMLGVKPV 595
             +  +  V   
Sbjct: 556 ADTLRLFAVPQD 567


>gi|49475861|ref|YP_033902.1| penicillin-binding protein [Bartonella henselae str. Houston-1]
 gi|49238669|emb|CAF27915.1| Penicillin-binding protein [Bartonella henselae str. Houston-1]
          Length = 580

 Score =  375 bits (963), Expect = e-101,   Method: Composition-based stats.
 Identities = 242/528 (45%), Positives = 352/528 (66%), Gaps = 3/528 (0%)

Query: 74  IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
           +  +    L++Y ++   +I YG    +             +RPDI+DRNG +LATDI T
Sbjct: 35  LFFSSFCFLILYGVMGACLISYGFEGGQIEEAKGPRVLQLTARPDILDRNGRLLATDIKT 94

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
           +SL+ EP ++I  DE IE L  VLP+L+ +   ++L  ++ F W++R L+P Q+ +I++ 
Sbjct: 95  YSLFAEPRRIIDVDETIELLSTVLPDLNWQETYKRLKKKSSFSWIQRGLTPLQKAQIMAL 154

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKGEKNL 253
           G+PG+GFR E  RFYP+    SH++G V++DN+GI G+EK++D  GL+ +       ++ 
Sbjct: 155 GIPGIGFRTEIRRFYPSGPVLSHILGMVNVDNQGIAGMEKYIDDAGLSDLRAAGLATEDS 214

Query: 254 -QPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFK 312
            +P++L++D+R+Q IVH EL++  K+Y A + G VILN+ T EV+++ S+PD+DP     
Sbjct: 215 LKPVQLSIDVRVQTIVHDELMKAMKRYKAIAAGAVILNIHTSEVLALASLPDFDPGNPVD 274

Query: 313 GKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG-KHVIHDYHP 371
             K    NR++ G FEMGSI K FT AM +DS +F +  + D   P++      IHD+H 
Sbjct: 275 ALKSDRLNRMTAGTFEMGSIIKSFTTAMALDSDIFHLNSIIDASKPLQASRGFTIHDFHG 334

Query: 372 QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQW 431
           +NR LT+ E+F YSSNIG+A+ A A+GI GH+ FL RLGLL ++ TELPE+  P  P+ W
Sbjct: 335 KNRPLTLWEVFIYSSNIGSAKEAMAIGIDGHRAFLKRLGLLDRMTTELPEVAHPLVPNHW 394

Query: 432 KRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTV 491
           K IHS+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ R+R+++ + ++ VL+  T 
Sbjct: 395 KDIHSMTISFGHGMATTPLQTAVAAAALMNGGWLIAPTFLKRTRDQALQHAKQVLQAKTS 454

Query: 492 KTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQ 551
           + MR L +     GSGR A V G+ VGGKTGTA+KV   +YS T NFNSFLA FP  DP 
Sbjct: 455 QNMRYLYKLNSDIGSGRNAKVEGYRVGGKTGTAEKVENGKYSKTKNFNSFLAAFPIEDPD 514

Query: 552 YIVLSFMDSPKIKER-NQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
           Y+VL+ +D P+ ++     TA +N  P++ NIIRRSA+ LG+KP F K
Sbjct: 515 YVVLTIIDEPQPEDGKYSATAAMNAGPILANIIRRSANFLGIKPDFQK 562


>gi|149190161|ref|ZP_01868437.1| penicillin-binding protein 3 [Vibrio shilonii AK1]
 gi|148836050|gb|EDL53011.1| penicillin-binding protein 3 [Vibrio shilonii AK1]
          Length = 578

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 250/559 (44%), Gaps = 41/559 (7%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +   L+I+  L  RI     I P     +    S+ +     +R  I DRNGE L
Sbjct: 28  RFRLILGCVLLIFTALVARIGYIQVIEPDNLIKQGDLRSVRVKALPSARGIISDRNGEPL 87

Query: 128 ATDIPTFSLYVEPHKVISPDEIIE-----KLQIVLPNLDSEMIRRKLSSE--TKFQWLRR 180
           A  +P  +++ +P  +   + + +      L  VL  LD + +  K+      +F +L+R
Sbjct: 88  AVSVPVQAVWADPATIFKDNGLAKLDRWHALADVL-GLDRQALINKIEKNKTRRFIYLQR 146

Query: 181 KLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-- 238
           ++SP   K I    L GVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D    
Sbjct: 147 QVSPAMAKYIKELKLSGVGLKAESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDKWLT 206

Query: 239 ---GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
              G   +     G           +  +P+ L +D R+Q I ++ + +    Y A S  
Sbjct: 207 GEAGKRIIRKDRYGRVVENISLEEREEGKPLELTIDQRLQAIAYRAVKQAVADYRATSGS 266

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            VI++V TG V++MV+ P Y+P+     +     NR+     E GS  K F +   +++G
Sbjct: 267 AVIIDVKTGGVLAMVNAPSYNPNNRSSRQSFTMRNRVITDAMEPGSTVKPFVVLAALEAG 326

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           +     + DT N I            +     + +I + SSNIG A++A  M +Q     
Sbjct: 327 VADENTVIDTGNGIMQIGGSRVRDTSKVGKANLAKILQKSSNIGVAKLALEMPLQELLGM 386

Query: 406 LYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
              +G        L       +P+  +W +    T++FG+G+S TPLQ A A A L N G
Sbjct: 387 YSSIGFGQLSGLNLVGETTGIFPNRRRWSQFEIATLAFGYGISITPLQLAHAYATLGNGG 446

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTG 522
              P   +  ++++   +S+ V+  +    +  +L      GG+  RA VPG+ V  KTG
Sbjct: 447 LYQPVHIIENNQQD---LSKQVIDHHYAVEVLHMLEAVTQPGGTATRAAVPGYRVAAKTG 503

Query: 523 TAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNI 582
           T++K     YSD         V P +DP+  ++  ++ P+    +Q   G    P+   I
Sbjct: 504 TSRKAAAGGYSDE-YVAITSGVAPVSDPRIALVVVINEPQ---GDQYYGGAVAGPVFSEI 559

Query: 583 IRRSASMLGVKPV---FLK 598
           ++ S  +L V P    F K
Sbjct: 560 MKGSLQILNVAPDENQFQK 578


>gi|161520923|ref|YP_001584350.1| peptidoglycan glycosyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189352894|ref|YP_001948521.1| cell division protein [Burkholderia multivorans ATCC 17616]
 gi|160344973|gb|ABX18058.1| Peptidoglycan glycosyltransferase [Burkholderia multivorans ATCC
           17616]
 gi|189336916|dbj|BAG45985.1| cell division protein [Burkholderia multivorans ATCC 17616]
          Length = 618

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 129/550 (23%), Positives = 237/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +++  + +  L +R              +         E    R  I+DRNG +L
Sbjct: 30  RSKLVVILVFIAFAALIVRAFWVQVANQDFYVGQGQKRYQRTIELDAMRGRIVDRNGAML 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   D    ++  +L ++    ++R+L ++  F  L+R++  +  
Sbjct: 90  AVSLATYEIWANPKQVSDTDY--PQIAKLL-DMPLAEVKRRLGNDKTFVLLKRQVDAETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTR 242
            R+    + G+    +  RFYP    A+HVVG+ +++++G  G+E   +       G   
Sbjct: 147 SRLDKLAIDGITQIADSKRFYPEGESAAHVVGFTNVEDQGQEGVELAANALLSGTSGQRE 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ +   +L     + NA +   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTRPLVPAQHGATIELTIDRRIQQLAFSQLKAAVLENNAVAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID    T   
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDQRKVTPNT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + +T          +      +  LT+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IINTSPGTYKIGPAVIHDTSNHGSLTVAQALQKSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLS + LQ A    A   +G L P +
Sbjct: 387 GRAPELTFPGVASGRLRSYQRWRPIEQATMAYGYGLSMSLLQIAQMYTAYAGDGTLHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +    ++          V    T   +RS+L   V  GG+GRRA V G+ +GGKTGTA+
Sbjct: 447 LLKNGTDQQTIDAHRGHRVTSPQTAAAIRSMLEMAVGEGGTGRRARVDGYRIGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y+       F  + P ++P+ IV   +D P+ K       G    P+  ++   
Sbjct: 507 KQVGSSYAKGKYRALFAGMAPMSNPRLIVAVMIDEPRGK---GYYGGTVAGPVFASVTSG 563

Query: 586 SASMLGVKPV 595
           +  +LGV P 
Sbjct: 564 ALQLLGVPPD 573


>gi|71909116|ref|YP_286703.1| peptidoglycan synthetase FtsI [Dechloromonas aromatica RCB]
 gi|71848737|gb|AAZ48233.1| peptidoglycan synthetase FtsI [Dechloromonas aromatica RCB]
          Length = 582

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 137/548 (25%), Positives = 242/548 (44%), Gaps = 30/548 (5%)

Query: 71  KNR---IGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           ++R   + +      ++     +++I    +  +  +      E   SR  I+DRNG++L
Sbjct: 27  RSRTVGLLLMAAFLTLVARGFYLQVIHNDFLQEKGDSRYRRDIEISASRGKIVDRNGDML 86

Query: 128 ATDIPTFSLYVEPHKVISPD-EIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A   P  S++  P    + +     +L  +L +++   +  KL+S+  F +++R++SP+ 
Sbjct: 87  AVSTPMKSIWAIPGDARTMNVSQKRQLAEML-DMNVRELDGKLASDKTFTYVKRQVSPET 145

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLT 241
             RI +   PGV    E  RFYP     +H+VG+  +D++G+ G+E           G  
Sbjct: 146 ADRIAAIKFPGVHQEKEYRRFYPTGDMTAHIVGFTGVDDKGLEGVELAFQNSLFGHPGSR 205

Query: 242 RVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
            V    +G            ++ + +RLALD +IQ + + +L    +  NA++ G ++++
Sbjct: 206 TVIRDRRGSIVEDVGATKPPQDGKDVRLALDSKIQYLAYSQLKNAVETNNAKAGGAIVID 265

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TGEV+++ + P Y+P+   +       NR     FE GS+ K FT A+ ++ G     
Sbjct: 266 ARTGEVLALANWPTYNPNNRERLSGAQLRNRAITDTFEPGSVMKPFTAALALEKGKVRFD 325

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            + +T                 +  L++ EI + SSN+G A+IA     Q   E    LG
Sbjct: 326 TVINTAPGRLTIGSATISDAHPHGALSVAEIIQKSSNVGTAKIALGFSPQEMWELFDSLG 385

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
                    P            W+ I   T+S+GHG+S + +Q A A      +G L+P 
Sbjct: 386 FGQAPNLGFPGEVNGRLRPWKNWRPIEQATMSYGHGISVSLIQLARAYTVFARDGELMPL 445

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKV 527
           +      +++      +    T++ +R +L   V   G+  +A VPG+ VGGKTGTA KV
Sbjct: 446 SLTK--IDDAPPHGARIFSPQTMRELRVMLEMAVQPEGTAPKARVPGYRVGGKTGTAYKV 503

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
               Y+      SF+ + P  +P+ +V   +D P          G    P    I   + 
Sbjct: 504 EGGVYAR-KYVASFVGIAPIGEPRLVVAVMIDEP---SGGAHYGGDVAGPAFSQIAGGAL 559

Query: 588 SMLGVKPV 595
             LGV P 
Sbjct: 560 RTLGVPPD 567


>gi|118581695|ref|YP_902945.1| peptidoglycan glycosyltransferase [Pelobacter propionicus DSM 2379]
 gi|118504405|gb|ABL00888.1| peptidoglycan synthetase FtsI [Pelobacter propionicus DSM 2379]
          Length = 657

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/563 (27%), Positives = 240/563 (42%), Gaps = 40/563 (7%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNG 124
           ++ RI +      ++++ ++ +  +   +  E                   R  I+DRNG
Sbjct: 9   ARTRIVIIGFFFGLLFMAVSAKAFKLQILQHEEMVKRAERQHQRSVPLTPGRGAIMDRNG 68

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSP 184
             LA  +  +S Y E   +   +     L   L  +  + I RK+ +   F WL R++ P
Sbjct: 69  NNLAVSVEMYSCYGEARHIQDVEATATALAPFL-EVPRQEIVRKIRNSRNFVWLERRIPP 127

Query: 185 QQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQG 239
           ++  RI +  L G+GF  E  RFYP +  A+HV+G+  ID  G+ G+E   D       G
Sbjct: 128 ERATRIRNLKLRGIGFAPETKRFYPNSEVAAHVIGFTGIDPNGLDGVEFKYDSVILGNTG 187

Query: 240 LTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           L        G                + + L LD  IQ I  +EL +      A+    +
Sbjct: 188 LLVTERDALGRDIAPRAELVKSSSPGKNVVLTLDKNIQYITEKELAQAVTSSGAKGGMAL 247

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +L   +G V++M + P ++P+  F+       NR     FE GS FKVF IA  ++  L 
Sbjct: 248 VLEPDSGRVLAMANYPTFNPNSYFRYSHAELRNRAVADSFEPGSTFKVFLIAAALNERLV 307

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
              D F   N                  L++ +I +YSSNIGAA+I   +G      +L+
Sbjct: 308 RPTDAFHCENGSYTIATHTVHDTHSYGRLSVSDILKYSSNIGAAKIGFKLGSDRLSRYLH 367

Query: 408 RLGLLSKLETELPEIQAPSY--PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
             G   +   +LP     +     +W  I   TISFG G+S + +Q A A +A+ N G L
Sbjct: 368 NFGFGERSGIDLPGESPGNMRSRQRWYGIDLATISFGQGISASSIQLATAISAVANGGNL 427

Query: 466 IPPTFMIRSREES--------EKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFE 516
           + P  + R  ++S         +V R V+  +T   +  ++      GG+G  A V GF 
Sbjct: 428 MKPYVVERILDDSGNELQRFTPQVVRRVISADTAAKVTRMMETVTAEGGTGTNAAVEGFR 487

Query: 517 VGGKTGTAQKVIK--KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           V GKTGTAQK     +RYS +    SF+   P   P+  +L  +D P+         G+ 
Sbjct: 488 VAGKTGTAQKADPVTRRYSASKRTASFIGFIPADRPRLTILVVIDEPRTSS----YGGVV 543

Query: 575 VAPMVGNIIRRSASMLGVKPVFL 597
            AP    I   S + L V P   
Sbjct: 544 AAPAFRGIALNSLAYLKVLPKNG 566


>gi|31296683|gb|AAP46634.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAPLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
           ++   +F + LG+  ++ +  P   A    +   W+ I   T+S G+GL  + LQ A A 
Sbjct: 376 VEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSCGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 493 DVGAKTGTARKFVNGRYADNKHIATFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|33593959|ref|NP_881603.1| peptidoglycan synthetase precursor [Bordetella pertussis Tohama I]
 gi|33564033|emb|CAE43299.1| peptidoglycan synthetase precursor [Bordetella pertussis Tohama I]
 gi|332383377|gb|AEE68224.1| peptidoglycan synthetase precursor [Bordetella pertussis CS]
          Length = 576

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/549 (25%), Positives = 258/549 (46%), Gaps = 34/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +++    +++LA R +         +  +             +R  I+DRNG +L
Sbjct: 20  RARLVLILLFGGFVVLAGRALFLQGLSTEFLQQQGERRYERTLTLAATRGKILDRNGVVL 79

Query: 128 ATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKL-SSETKFQWLRRKLSPQ 185
           A+ +P  +++  P      P E +  L  +L       +RR+L   +  F +L+R++   
Sbjct: 80  ASSVPARAIWAIPEDAKPIPPEQVAALAQLL-QTPVAELRRRLADEDRNFVYLKRQVPMD 138

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
              +I    LPG+  + E  R+YP     +H+VG+ +++++G  G+E   + Q     G 
Sbjct: 139 VADKIKQMALPGIHQQPESRRYYPEGEVTAHIVGFNNVEDQGQEGVELTFNQQLSGQPGS 198

Query: 241 TRVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G             + + +RL++D R+Q +V++EL + +  + A+S   V++
Sbjct: 199 RRVIKDRLGRVIEDVQAVTLPVDGRDLRLSIDTRLQYLVYKELQDARVAHQAKSATAVVI 258

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+++V++P +DP+     +     N+     FE GSI K FT A+ +D G  + 
Sbjct: 259 DVHTGEVLALVNLPSFDPNHRETFQVSTLRNQAITDTFEPGSIMKPFTAALALDLGRIST 318

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             +F+T N     +        +N  L +  +   SSNIG   I++ +  +   +    L
Sbjct: 319 ATMFETGNGRFQYQGSTISDVSRNGTLDLAGVLLKSSNIGMTMISEKLQSREMWDLFTGL 378

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P            W+ I   TI++G+GLS + LQ A A      +G ++ 
Sbjct: 379 GLGQAPQLGFPGAAPGRLRPWDRWRLIEKATIAYGYGLSVSLLQVARAYTVFARDGDMVS 438

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQK 526
            T + R   ES   S  V    T  T+R++L       G+ +RA V G+ V GK+GTA+K
Sbjct: 439 LTLVKR---ESAPTSVRVYNPKTAATVRAMLEAAAGPDGT-KRAQVQGYRVAGKSGTARK 494

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
           ++  +YS   + +SF+   P ++P+ +V   +D P++        G   AP+   I+  S
Sbjct: 495 IVDGKYSAQRHRSSFVGFAPVSNPKIVVAVSIDEPQV---GGYYGGAIAAPVFSRIVGGS 551

Query: 587 ASMLGVKPV 595
             ++GV+P 
Sbjct: 552 LRLMGVQPD 560


>gi|167565841|ref|ZP_02358757.1| penicillin-binding protein [Burkholderia oklahomensis EO147]
          Length = 595

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 134/551 (24%), Positives = 242/551 (43%), Gaps = 35/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFIVILVFIAFGTLIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEK-LQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A  + T+ ++  P +V   DE+    L  +L ++    +RR+L+S+  F  L+R++ P+ 
Sbjct: 90  AVSLTTYEIWANPKQV---DEVAYAPLAKLL-DMPLAEVRRRLTSDRSFVLLKRQVDPET 145

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
             RI    + G+    +  RFYP    A+HVVG+ +++++G  G+E   + +     G  
Sbjct: 146 AARIEKLDVDGITQVADSKRFYPEGESAAHVVGFTNVEDQGQEGVELAANGRLSGTAGQR 205

Query: 242 RVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +V     G            ++   I L +D RIQ + + +L       NA++   V+L+
Sbjct: 206 QVIRDRLGRIISDTSPLVPAQHGATIELTIDRRIQQLAYAQLKSAIVANNAQAGSVVVLD 265

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
              GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    +
Sbjct: 266 AQNGEILALANYPTFDPNDRTRLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDAGKVRPQ 325

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            + DT          +      +  +T+ +  + SSNI  A++A  +  +         G
Sbjct: 326 TIIDTSPGSYRIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYG 385

Query: 411 LLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +    +   P + +       +W+ I   T+++G+GLS + LQ A    A   +G L P 
Sbjct: 386 IGRAPDLTFPGVASGRLRPYKRWRPIEQATMAYGYGLSASLLQIAQVYTAYAGDGTLHPV 445

Query: 469 TFMIRSREESEK---VSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTA 524
           + +    +           V    T   +RS+L   V  GG+GR A V G+ +GGKTGTA
Sbjct: 446 SLLRAHTDPPSVDAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRIGGKTGTA 505

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K +   Y+       F  + P ++P+ IV   +D P  +       G    P+  +++ 
Sbjct: 506 RKQVGASYAKGKYRALFSGMAPMSNPRLIVAVMIDEPGARS---YYGGTVAGPVFSSVMS 562

Query: 585 RSASMLGVKPV 595
            S  +LGV P 
Sbjct: 563 GSLQLLGVPPD 573


>gi|37651040|emb|CAD70587.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+       E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGWADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|332982165|ref|YP_004463606.1| stage V sporulation protein D [Mahella australiensis 50-1 BON]
 gi|332699843|gb|AEE96784.1| stage V sporulation protein D [Mahella australiensis 50-1 BON]
          Length = 701

 Score =  375 bits (962), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/543 (26%), Positives = 245/543 (45%), Gaps = 46/543 (8%)

Query: 89  AIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDE 148
            ++I Q   +  +              R  I DRNG ILA      ++ V P  ++ P+ 
Sbjct: 32  WLQIKQGPILQQKAYDQWAREISVSPKRGIIYDRNGRILAQSASAETIIVRPLDIVDPEG 91

Query: 149 IIEKLQIVLPNLDSEMIRRKLSSETKFQ-WLRRKLSPQQQKRILSFGLPGVGFRLEKSRF 207
             +KL  ++ ++D + I + ++ +TK + WL+R++S ++   +   GL G+ F  E  R+
Sbjct: 92  TADKLAPII-DMDRDEILKIITDKTKSEKWLKRQVSKEEANAVRQLGLKGIKFTEEAKRY 150

Query: 208 YPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTRVFTTNKG------------E 250
           YP  + ASH++G+V  D +G+ G+E   D      +G     T  K              
Sbjct: 151 YPNENLASHILGFVGRDGQGLDGVELQYDKYLKGKEGKIVTQTDGKARELPMSPEQYIKP 210

Query: 251 KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEA 310
           ++   + L +D  IQ+   + + +      A+    V+++  TGE++++ + PD++P+  
Sbjct: 211 QDGDNVYLTIDAVIQHFAEKAVEQALSDNKAKKAIGVVMDPKTGEILALTNKPDFNPNGF 270

Query: 311 F-------KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGK 363
                   K  +E   N     I+E GS FK+ T A G+DSG     D F       V  
Sbjct: 271 PSPELKTAKDIEEATRNAAVKDIYEPGSTFKIITSAAGLDSGAVKPDDTFYDPGYKIVAG 330

Query: 364 HVIHDYHPQ--NRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPE 421
             I  +     +   T  E  + S N    ++ + MG+    +++ R G   K   +LP 
Sbjct: 331 QKIKCWRSYNPHGHETFVEGVQNSCNPVFMEVGERMGVNTFYDYINRFGFGQKTGLDLPG 390

Query: 422 IQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREES- 478
                   Q     +   TISFG G+S TP+Q   A +A +N G+LI P  M + ++   
Sbjct: 391 EGRGLLQKQDNVGPVELATISFGQGISVTPVQLVTAISAAVNGGQLITPHVMKQVKDNDG 450

Query: 479 -------EKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKR 531
                   ++ R V+ + T +T+R +L   V+ G+G+ A++ G+ +GGKTGTA+      
Sbjct: 451 NIVIDNKPQIVRRVISEQTSETLRPILESVVSEGTGKAAYIEGYRIGGKTGTAET----- 505

Query: 532 YSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLG 591
           Y      +SF+A  P  DP+ +VL  +  P              AP V +II  +    G
Sbjct: 506 YQAGKYISSFVAFAPADDPKIVVLVVVQEPNA---GTYFGSTVAAPAVKSIISDTFDYWG 562

Query: 592 VKP 594
           +KP
Sbjct: 563 IKP 565


>gi|32345908|gb|AAM97248.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/559 (27%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|509065|emb|CAA42192.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 152/559 (27%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|260430919|ref|ZP_05784890.1| penicillin-binding protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414747|gb|EEX08006.1| penicillin-binding protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 595

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/568 (29%), Positives = 286/568 (50%), Gaps = 17/568 (2%)

Query: 44  NLCQKGCHMEDGQDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPI 103
               K    E+ +   ++ + +  A ++ R+ +  V   + + ++  R+        +  
Sbjct: 19  GENPKVIERENIRRRHEEMKDRARARAEGRLLVLGVFFFLAFGVVGFRMGVLATSEAQEP 78

Query: 104 APSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSE 163
             S       M R +I+DR+G ILAT++ T+S+Y +P  +I P    EKL  + P+LD E
Sbjct: 79  VASAPGASIAMQRANIVDRHGRILATNLDTYSVYAQPPLMIDPHGAAEKLAAIFPDLDKE 138

Query: 164 MIRRKLSSETKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDI 223
            + +  + + KF W+++++SP+Q++ +   G PG+ F   + R YP    A+H++G    
Sbjct: 139 RLIKDFTGKRKFLWIKKRISPEQKQAVHDIGDPGILFGPREMRLYPNGRLAAHILGGSGF 198

Query: 224 DNRGITGIEKFLDMQGLTRVFTTNKGEKNL-QPIRLALDLRIQNIVHQELVENKKKYNAE 282
              G++  E         +     +   N  +P++L+LDL +Q  V Q L    K  NA+
Sbjct: 199 GREGVSAAEVIGVAGVEKQFDDYLRDPANGNKPLQLSLDLTVQAAVEQVLDGGMKIMNAK 258

Query: 283 SVGTVILNVSTGEVISMVSIPDYDPHEAFKGK-------KEGWFNRISYGIFEMGSIFKV 335
               V++N  TGEVI+  S+P +DP++  +             FNR   G++E+GS+FK+
Sbjct: 259 GASAVLMNAHTGEVIAAASLPSFDPNDRPRPPTSGFDPSDSPLFNRYVQGVYELGSVFKI 318

Query: 336 FTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYH-PQNRILTIPEIFRYSSNIGAAQIA 394
           FT A  +D GL     + DT  P+K+G+  I +++      +++ ++  +SSN G  ++A
Sbjct: 319 FTAAQAVDLGLVNADTIIDTSGPMKIGRFPIGEFNGKNYGEISVTDVIVHSSNRGTGRLA 378

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQT 452
             +G +  ++FL  LG+      E+ E +      P +W  + ++TIS+GHGLST+P+  
Sbjct: 379 LQIGAERQQQFLDALGMFDPTPFEIVEAKGGVPLKPKKWGELSTVTISYGHGLSTSPMHL 438

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFV 512
           A   AA+ N G  + PT + R      +    V+ +N  +    +LR  VT G+     V
Sbjct: 439 AAGYAAIANGGHYVSPTILRR---NGPQYGPRVMSENAAQQSLMMLRRVVTDGTASFGDV 495

Query: 513 PGFEVGGKTGTAQKVIK-KRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQ--L 569
           PG+ V GKTGTA K      Y D     +F +VFP  DP+Y+++  +D P I    +   
Sbjct: 496 PGYAVAGKTGTADKPKPRGGYYDDKVIATFASVFPAYDPKYVLVVALDEPSILAYGEKRR 555

Query: 570 TAGINVAPMVGNIIRRSASMLGVKPVFL 597
           TAG    P+   +I R A +LG++P   
Sbjct: 556 TAGWTAVPVAAELIGRIAPLLGLRPRLE 583


>gi|164686369|ref|ZP_02210399.1| hypothetical protein CLOBAR_02807 [Clostridium bartlettii DSM
           16795]
 gi|164601971|gb|EDQ95436.1| hypothetical protein CLOBAR_02807 [Clostridium bartlettii DSM
           16795]
          Length = 663

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/578 (23%), Positives = 242/578 (41%), Gaps = 58/578 (10%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNG 124
           S+ R+ + +V    ++++L +R      +       +              R  I DRN 
Sbjct: 10  SRKRLVLVLVSACALFLVLIVRTCYLQLVKGQWLTTKASEQQTREIPIESKRGTIYDRNM 69

Query: 125 EILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLS 183
           + LA  +  ++++ +P +V   ++  +K+  ++ + D + I + LS   +    ++R + 
Sbjct: 70  KSLAVSVTKYTIWCKPVEVKDKEKTAKKISEIVKDKDYDEILKLLSKTNQALVRIQRWVD 129

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
                +I +  L G+    +  R+YP  + AS+V+G+   D  G+TGIE   +       
Sbjct: 130 DDVADKIQNASLSGIWISEDPQRYYPHGNFASYVLGHTSSDGEGVTGIELKYNKDLQGKD 189

Query: 239 GLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGT 286
           G   V T   G +                I L +D  IQ+   +      +  NA+ V  
Sbjct: 190 GKLIVSTDASGREINQGVEQYYEATQGNGIVLTIDEVIQSYAEKAAQRAYELNNAKRVKI 249

Query: 287 VILNVSTGEVISMVSIPDYDPHEAF--------------------KGKKEGWFNRISYGI 326
           + ++  TG+V++M S PDYDP+                           E W N +    
Sbjct: 250 IAMDPKTGDVLAMASKPDYDPNNPTKAIYPYFEDLLKSYDDDKKINAYYEMWRNTLISDT 309

Query: 327 FEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTIPEIFRY 384
           +E GS FK+ T    ++  +    + F     + V    I  +     +   T  +  + 
Sbjct: 310 YEPGSTFKLITSTASVEENVIKPNEKFTCTGSVTVEGKRIKCWRSYRPHGSETFEQAVQN 369

Query: 385 SSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFG 442
           S N    ++   +G+    +++   GL SK   +L          +     +   TISFG
Sbjct: 370 SCNPVFVELGKRLGVSKLYDYIEGFGLTSKTNIDLVGEANSILYKEKDVGPVELATISFG 429

Query: 443 HGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKKNTVKTM 494
             +S TP+Q   A +A+ N+G+L+ P  +    +           K  R V+   T K M
Sbjct: 430 QSISVTPIQLIRAVSAIANDGKLMEPRLVKAYTDNEGNVVQEVKPKTVRQVVSTETSKKM 489

Query: 495 RSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIV 554
            S++   VT G G+ A++PG+ +GGKTGTAQKVI   Y+      SF++V P  DPQ +V
Sbjct: 490 LSVMESVVTDGGGKIAYLPGYRLGGKTGTAQKVIDGVYAQGKYICSFISVAPVDDPQIVV 549

Query: 555 LSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGV 592
           L+ +D P               P++  ++ +S   LGV
Sbjct: 550 LAIVDEPTDVV---AFGSTTAGPIIKEVMSQSLEYLGV 584


>gi|225077132|ref|ZP_03720331.1| hypothetical protein NEIFLAOT_02187 [Neisseria flavescens
           NRL30031/H210]
 gi|224951543|gb|EEG32752.1| hypothetical protein NEIFLAOT_02187 [Neisseria flavescens
           NRL30031/H210]
          Length = 582

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 165/568 (29%), Positives = 269/568 (47%), Gaps = 38/568 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNID 110
           Q L    + K    S  RIG+ +    + +  L +R +       E +        +   
Sbjct: 10  QMLSGTTKTKKPLTSNGRIGLVLGAVALAFTGLLVRGVYLQTSQHEFLKNQGDQRFVRTL 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRK 168
               SR  I DRNG  LA   PT SLY  P  +      E +EKL  +  ++  E+++ K
Sbjct: 70  PLLASRGMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQLEKLSAI-ADVPVEVLKNK 128

Query: 169 LSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           LS + K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G
Sbjct: 129 LSKKDKGFIYLKRQLSYEKAEEIKALGIKGIAFQKELKRHYPMGNLFAHVIGFTNIDGKG 188

Query: 228 ITGIEKFLD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVH 269
             G+E   +       G   V   NKG              KN Q + L+LD RIQ + +
Sbjct: 189 QEGLELSREDSLRGEDGAKVVLRDNKGNIVDSLDSPRNSVPKNGQDMILSLDQRIQTLAY 248

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
            EL +    + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E 
Sbjct: 249 DELNKAVAYHKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEP 308

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K FTIA  +DSG     D F+T                    L +  I + SSN+G
Sbjct: 309 GSAMKPFTIAKALDSGKVDPTDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLST 447
            ++++     +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  
Sbjct: 367 TSKLSAMFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGS 506
           + LQ A A   L ++G L+P   +   ++      + V+K +T K +R L+      GG+
Sbjct: 427 SLLQLARAYTVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GIAGAVDGFDVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA--- 540

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
           N    G+   P+   ++  S ++LGV P
Sbjct: 541 NGYYGGVVAGPVFKEVMSGSLNILGVSP 568


>gi|330815437|ref|YP_004359142.1| Penicillin-binding protein [Burkholderia gladioli BSR3]
 gi|327367830|gb|AEA59186.1| Penicillin-binding protein [Burkholderia gladioli BSR3]
          Length = 622

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 146/548 (26%), Positives = 249/548 (45%), Gaps = 31/548 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +  + ++ LA R              +  +      E   +R  I+DRNG +L
Sbjct: 30  RSKLVVFMLFMAFVALAARAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIV--LPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V   D   +KL  +  L  + S  +RRKLS +  F +++R++  +
Sbjct: 90  ATSLPVRAIWAIPESVPD-DLGADKLTQLGQLLGMSSTELRRKLSEDKSFVYVKRQVPIE 148

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGL 240
              ++ +  +PG+  R E  RFYP     +H++G+ ++++ G  G+E           G 
Sbjct: 149 VADKVAALDIPGIYARNEYKRFYPEGEITAHLIGFTNVEDEGQEGVELADQKMLAGIPGS 208

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G             N   + L++D +IQ I +  L     K++A++   +++
Sbjct: 209 RHVIKDRVGHIVEDVDEQMPPHNGTDVDLSIDSKIQYITYANLKAAVDKFHAKAGAAIVV 268

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+S+V+ P Y+P++      E   NR+   +FE GSI K FT+++ +D    + 
Sbjct: 269 DVRTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLTDVFEPGSIMKPFTVSLALDLHRVSP 328

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             L DT N   V             +LT+  + + SSNIGA +IA  M  +        +
Sbjct: 329 TTLVDTGNGHFVLDGAPISDDAGFGVLTVGGVIQKSSNIGATKIAMTMRPEEMWNMYTSI 388

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+RI   T+S+G+GLS +  Q A A  A+ ++G L+P
Sbjct: 389 GLGQAPKVGFPGAAAGRLRPWKSWRRIEQATMSYGYGLSVSLFQLAHAYTAIAHDGELMP 448

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            +    S  +  +    V    T + +R +L   VT  G+   A VPG+ VGGK+GTA K
Sbjct: 449 LSIFKASETQPPQ-GPQVFSPTTAREVREMLESVVTKNGTSPDAAVPGYRVGGKSGTAYK 507

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            + + Y       SF+ + P  +P+ +V   +D P          G    P+   I+  +
Sbjct: 508 QVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPTA---GSHFGGQVSGPVFSAIVGDT 564

Query: 587 ASMLGVKP 594
              L V P
Sbjct: 565 LRALNVPP 572


>gi|264680252|ref|YP_003280162.1| penicillin-binding protein, transpeptidase [Comamonas testosteroni
           CNB-2]
 gi|299533124|ref|ZP_07046509.1| penicillin-binding protein, transpeptidase [Comamonas testosteroni
           S44]
 gi|262210768|gb|ACY34866.1| penicillin-binding protein, transpeptidase [Comamonas testosteroni
           CNB-2]
 gi|298718901|gb|EFI59873.1| penicillin-binding protein, transpeptidase [Comamonas testosteroni
           S44]
          Length = 582

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/551 (24%), Positives = 244/551 (44%), Gaps = 34/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPDIIDRNGEIL 127
           R    +    + ++ L  R         +              E   +R  ++DRNG IL
Sbjct: 21  RSKFIVAALALGFVGLGARAAYVQVFGNDFFKRQGLVRFARTLELPANRGRLLDRNGLIL 80

Query: 128 ATDIPTFSLYVEPHKVISPD-EIIEKLQIV--LPNLDSEMIRRKLS-SETKFQWLRRKLS 183
           A+ +P  S++  P  V   D E+ +KL+ V  L ++    +  KL   +  F W++R+L 
Sbjct: 81  ASSVPAASIWAIPEDVDLKDPEVQQKLKEVARLMDMPLRSLMEKLDVEDKTFVWVKRQLD 140

Query: 184 PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ----- 238
               ++I++  + G+  R E  R YP    A+H+VG+ ++++ G  G+E   D +     
Sbjct: 141 WDVGQKIVALNIKGIYNRKEYKRQYPEGESAAHIVGFTNVEDHGQEGMELAFDKELAGKA 200

Query: 239 GLTRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTV 287
           G  RV     G            ++ Q I+L++D ++Q   +Q+L +  + + A++   V
Sbjct: 201 GSRRVIKDRLGRVVEGVGDEVPPQDGQDIQLSIDSKVQYYAYQKLKQQVETFKAKAGSVV 260

Query: 288 ILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
           +++  TGE++++ + P YDP        E   NR     FE GS  K  T+A  ++    
Sbjct: 261 VMDAHTGELLALANYPSYDPGHRKNLTGEQLRNRALTDTFEPGSTMKPITVAAALELKRV 320

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
               + DT                    LT+  + + SSN+GA ++A  +  Q   E+  
Sbjct: 321 KPSTIIDTAPGRYTVTGSTITDTHNYGALTVEGVIQKSSNVGATKVAQKLSPQEMWEYFS 380

Query: 408 RLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
            LG   K + + P   +    +   WK I   T+S+G+GLS +  Q A +     N+G +
Sbjct: 381 ALGFGQKPQIQFPGAVSGRLRAWKTWKPIEQATMSYGYGLSASLFQMARSYTVFSNDGNV 440

Query: 466 IPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTA 524
           IP T +         V   V+ K   + +  +LR     GG+G++A   G+ +GGK+GTA
Sbjct: 441 IPSTILK---TNEPPVGVRVISKENAEAVLHMLRLAAGPGGTGQKAQAEGYTIGGKSGTA 497

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K + K Y+       F  + P   P+ IV   +D P          G    P+  ++++
Sbjct: 498 RKQVGKSYAAGKYRAWFTGIAPIDKPRIIVAVMVDEPTA---GSYYGGTVAGPVFADVVQ 554

Query: 585 RSASMLGVKPV 595
           ++   +GV+P 
Sbjct: 555 QTLRFMGVQPD 565


>gi|33598267|ref|NP_885910.1| peptidoglycan synthetase precursor [Bordetella parapertussis 12822]
 gi|33566825|emb|CAE39040.1| peptidoglycan synthetase precursor [Bordetella parapertussis]
          Length = 576

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/549 (25%), Positives = 257/549 (46%), Gaps = 34/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +++    +++LA R +         +  +             +R  I+DRNG +L
Sbjct: 20  RARLVLILLFGGFVVLAGRALFLQGLSTEFLQQQGERRYERTLTLAATRGKILDRNGVVL 79

Query: 128 ATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKL-SSETKFQWLRRKLSPQ 185
           A+ +P  +++  P      P E +  L  +L       +RR+L   +  F +L+R++   
Sbjct: 80  ASSVPARAIWAIPEDAKPIPPEQVAALAQLL-QTPVAELRRRLADEDRNFVYLKRQVPMD 138

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
              +I    LPG+  + E  R+YP     +H+VG+ +++++G  G+E   + Q     G 
Sbjct: 139 VADKIKQMALPGIHQQPESRRYYPEGEVTAHIVGFNNVEDQGQEGVELTFNQQLSGQPGS 198

Query: 241 TRVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G             + + +RL++D R+Q +V++EL + +  + A+S   V++
Sbjct: 199 RRVIKDRLGRVIEDVQAVTLPVDGRDLRLSIDTRLQYLVYKELQDARVAHQAKSATAVVI 258

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+++V++P +DP+     +     N+     FE GSI K FT A+ +D G  + 
Sbjct: 259 DVHTGEVLALVNLPSFDPNHRETFQVSTLRNQAITDTFEPGSIMKPFTAALALDLGRIST 318

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             +F+T N     +        +N  L +  +   SSNIG   I++ +  +   +    L
Sbjct: 319 ATMFETGNGRFQYQGSTISDVSRNGTLDLAGVLLKSSNIGMTMISEKLQSREMWDLFTGL 378

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P            W+ I   T+++G+GLS + LQ A A      +G ++ 
Sbjct: 379 GLGQAPQLGFPGAAPGRLRPWNRWRLIEKATMAYGYGLSVSLLQVARAYTVFARDGDMVS 438

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQK 526
            T + R   ES   S  V    T  T+R++L       G  +RA V G+ V GK+GTA+K
Sbjct: 439 LTLVKR---ESAPTSVRVYNPKTAATVRAMLEAAAGPDG-AKRAQVQGYRVAGKSGTARK 494

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
           ++  +YS   + +SF+   P ++P+ +V   +D P++        G   AP+   I+  S
Sbjct: 495 IVDGKYSAQRHRSSFVGFAPVSNPKIVVAVSIDEPQV---GGYYGGAIAAPVFSRIVGGS 551

Query: 587 ASMLGVKPV 595
             ++GV+P 
Sbjct: 552 LRLMGVQPD 560


>gi|33603178|ref|NP_890738.1| peptidoglycan synthetase precursor [Bordetella bronchiseptica RB50]
 gi|33568809|emb|CAE34567.1| peptidoglycan synthetase precursor [Bordetella bronchiseptica RB50]
          Length = 566

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/549 (25%), Positives = 257/549 (46%), Gaps = 34/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +++    +++LA R +         +  +             +R  I+DRNG +L
Sbjct: 10  RARLVLILLFGGFVVLAGRALFLQGLSTEFLQQQGERRYERTLTLAATRGKILDRNGVVL 69

Query: 128 ATDIPTFSLYVEPHKVIS-PDEIIEKLQIVLPNLDSEMIRRKL-SSETKFQWLRRKLSPQ 185
           A+ +P  +++  P      P E +  L  +L       +RR+L   +  F +L+R++   
Sbjct: 70  ASSVPARAIWAIPEDAKPIPPEQVAALAQLL-QTPVAELRRRLADEDRNFVYLKRQVPMD 128

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GL 240
              +I    LPG+  + E  R+YP     +H+VG+ +++++G  G+E   + Q     G 
Sbjct: 129 VADKIKQMALPGIHQQPESRRYYPEGEVTAHIVGFNNVEDQGQEGVELTFNQQLSGQPGS 188

Query: 241 TRVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G             + + +RL++D R+Q +V++EL + +  + A+S   V++
Sbjct: 189 RRVIKDRLGRVIEDVQAVTLPVDGRDLRLSIDTRLQYLVYKELQDARVAHQAKSATAVVI 248

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+++V++P +DP+     +     N+     FE GSI K FT A+ +D G  + 
Sbjct: 249 DVHTGEVLALVNLPSFDPNHRETFQVSTLRNQAITDTFEPGSIMKPFTAALALDLGRIST 308

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             +F+T N     +        +N  L +  +   SSNIG   I++ +  +   +    L
Sbjct: 309 ATMFETGNGRFQYQGSTISDVSRNGTLDLAGVLLKSSNIGMTMISEKLQSREMWDLFTGL 368

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P            W+ I   T+++G+GLS + LQ A A      +G ++ 
Sbjct: 369 GLGQAPQLGFPGAAPGRLRPWDRWRLIEKATMAYGYGLSVSLLQVARAYTVFARDGDMVS 428

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQK 526
            T + R   ES   S  V    T  T+R++L       G  +RA V G+ V GK+GTA+K
Sbjct: 429 LTLVKR---ESAPTSVRVYNPKTAATVRAMLEAAAGPDG-AKRAQVQGYRVAGKSGTARK 484

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
           ++  +YS   + +SF+   P ++P+ +V   +D P++        G   AP+   I+  S
Sbjct: 485 IVDGKYSAQRHRSSFVGFAPVSNPKIVVAVSIDEPQV---GGYYGGAIAAPVFSRIVGGS 541

Query: 587 ASMLGVKPV 595
             ++GV+P 
Sbjct: 542 LRLMGVQPD 550


>gi|254494328|ref|ZP_05107499.1| penicillin binding protein 2 [Neisseria gonorrhoeae 1291]
 gi|38564791|gb|AAR23826.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|226513368|gb|EEH62713.1| penicillin binding protein 2 [Neisseria gonorrhoeae 1291]
          Length = 583

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 152/559 (27%), Positives = 261/559 (46%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+        V  D H     L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKIGPSPVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFG 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 437 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 494 DVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 551 GPPFKKIMGGSLNILGVSP 569


>gi|91786967|ref|YP_547919.1| peptidoglycan synthetase FtsI [Polaromonas sp. JS666]
 gi|91696192|gb|ABE43021.1| peptidoglycan synthetase FtsI [Polaromonas sp. JS666]
          Length = 577

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 138/548 (25%), Positives = 242/548 (44%), Gaps = 32/548 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNIDEYGMSRPDIIDRNGEIL 127
           R    +    + ++ LA R         E              E   +R  I+DRNG IL
Sbjct: 21  RSKFIVAAIALAFVGLAGRAAYIQVFGNEFFQRQGEVRFARTLELPANRGRILDRNGLIL 80

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL-SSETKFQWLRRKLSPQQ 186
           A+ +P  S++  P  V +    + +L  +L  +    +++KL + +  F WL+R++    
Sbjct: 81  ASSVPAPSIWAIPEDVEASKAQLAELAKLL-EMPQADLKKKLGNEDKTFVWLKRQVDEPI 139

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
            ++I + G+ G+  R E  R YP    A+HVVG+ ++++ G  GIE   + +     G  
Sbjct: 140 AQQIHAMGIKGIYARREYKRKYPEGEAAAHVVGFTNVEDNGQEGIELTFNKELAGKAGSR 199

Query: 242 RVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           RV     G               + I+L++D ++Q   +Q+L +      A++   V+L+
Sbjct: 200 RVIKDRLGRVVEGVGEQVPPIEGKDIQLSVDSKVQFFAYQKLRDAVTARKAKAGSVVVLD 259

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
             TGEV+++ + P Y P +      E   NR     FE GS  K  T+AM +++G    +
Sbjct: 260 AITGEVLALANYPSYVPDKRQNLTGEQLRNRALTDTFEPGSTMKPITVAMALEAGRVKPQ 319

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            L +T                    LT+  + + SSN+GA +IA  M      +    LG
Sbjct: 320 TLVETGPGRFSIGGFTISDTHNYGTLTVEGVIQKSSNVGALKIAQKMSPHEMWDTYTALG 379

Query: 411 LLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
              K + + P            W+ +   T+++G+GLS +  Q A +  +  ++G++IP 
Sbjct: 380 YGQKPQIQFPGAVTGRLRPWKSWRPVEQATMAYGYGLSASLFQMAHSYTSFAHDGQIIPV 439

Query: 469 TFMIRSREESEKVSRIVLKKNTVKTMRSLLR-EGVTGGSGRRAFVPGFEVGGKTGTAQKV 527
           T +  +      V   V        +R +L+     GG+G+ A   G+ VGGK+GTA K 
Sbjct: 440 TMLKSTE---PAVGVRVFSAENAHAVRRMLQMAAAPGGTGQLAQTVGYSVGGKSGTAHKQ 496

Query: 528 IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSA 587
           + K Y+       F  + P   P+ IV   +D P      Q   G+  AP+   +++++ 
Sbjct: 497 VGKGYASNKYRAWFTGMAPIEAPRIIVAVMIDEP---SDGQYFGGVAAAPVFSEVVQQTL 553

Query: 588 SMLGVKPV 595
            M+GV+P 
Sbjct: 554 RMMGVQPD 561


>gi|167035509|ref|YP_001670740.1| peptidoglycan glycosyltransferase [Pseudomonas putida GB-1]
 gi|166861997|gb|ABZ00405.1| Peptidoglycan glycosyltransferase [Pseudomonas putida GB-1]
          Length = 583

 Score =  374 bits (961), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/552 (25%), Positives = 264/552 (47%), Gaps = 33/552 (5%)

Query: 71  KNRIGMTIVVC---LVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           + R+ + ++      + + I+ ++++    +  +  A S+        R  I DRNGE L
Sbjct: 12  RFRVVIGLLAIMVGAICWRIIDLQVVDRDFLKGQGDARSLRHIPIPAHRGLITDRNGEPL 71

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS-ETKFQWLRRKLSPQQ 186
           A   P  +L+  P ++ +  E   +L   L     ++I R       +F +L R L+P+Q
Sbjct: 72  AVSTPVTTLWANPKEMQASKERWPQLAAALGQNPQQLIERLTQQANKEFIYLVRGLTPEQ 131

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
            + +L   +PGV    E  RFYPA    +H+VG+ D+D+ G  G+E   D       G  
Sbjct: 132 GQHVLDLKVPGVYGLEEFRRFYPAGDVTAHMVGFTDLDDHGREGVELAYDEWLAGVPGKR 191

Query: 242 RVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +V    +G            K  + + L++DLR+Q +  +EL     + +A++   VI++
Sbjct: 192 QVIKDRRGRLIKDIQVTKNAKAGKTLALSIDLRLQYLATRELRNAIAEQDAKAGSLVIMD 251

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
           V TGEV++MV+ P Y+P+           NR    +FE GS  K  +++  + SG +   
Sbjct: 252 VKTGEVLAMVNQPTYNPNNRRSMFPAAMRNRAIIDVFEPGSTVKPISMSAALQSGRWKPT 311

Query: 351 D-LFDTRNPIKVGKHVIHDYHPQNRIL-TIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
           D +      +++G++ I D       +  +  I   SSN+G ++IA  +G +     + +
Sbjct: 312 DKVEVYPGSLQIGRYTIKDVSRSEGPILDLTGILINSSNVGMSKIAFDIGGEAIYRVMSQ 371

Query: 409 LGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
           +GL        P  +  +     +W++  + T+S+G+GLS T LQ   A AAL N+G+++
Sbjct: 372 VGLGQYTGLGFPGERVGNLPNHREWRKAETATLSYGYGLSVTALQLVHAYAALANDGKMV 431

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQ 525
           P + +     +    +   + K T +T++ +L++ +    G  RA VP + V GK+GTA+
Sbjct: 432 PLSIIKV---DKAPEAVQAIPKETAETVQGMLQQVIEAPRGVFRAQVPFYHVAGKSGTAR 488

Query: 526 K--VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           K  V  K Y++    + F    P +DP+Y ++  +D P    +     G+  AP+   ++
Sbjct: 489 KATVGSKGYTENAYRSLFAGFGPMSDPRYAIVVVIDEP---GKGGYFGGLVSAPVFSKVM 545

Query: 584 RRSASMLGVKPV 595
             +  ++ V P 
Sbjct: 546 SGTLRLMNVPPD 557


>gi|167849697|ref|ZP_02475205.1| penicillin-binding protein [Burkholderia pseudomallei B7210]
 gi|167906653|ref|ZP_02493858.1| penicillin-binding protein [Burkholderia pseudomallei NCTC 13177]
          Length = 574

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 10  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 69

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 70  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 126

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 127 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 186

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 187 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 246

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 247 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 306

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 307 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 366

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 367 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 426

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 427 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 486

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 487 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 543

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 544 SLQLLGVPPD 553


>gi|221196581|ref|ZP_03569628.1| peptidoglycan synthetase FtsI (Peptidoglycanglycosyltransferase 3)
           (Penicillin-binding protein 3) (PBP-3) [Burkholderia
           multivorans CGD2M]
 gi|221203250|ref|ZP_03576269.1| peptidoglycan synthetase FtsI (Peptidoglycanglycosyltransferase 3)
           (Penicillin-binding protein 3) (PBP-3) [Burkholderia
           multivorans CGD2]
 gi|221177184|gb|EEE09612.1| peptidoglycan synthetase FtsI (Peptidoglycanglycosyltransferase 3)
           (Penicillin-binding protein 3) (PBP-3) [Burkholderia
           multivorans CGD2]
 gi|221183135|gb|EEE15535.1| peptidoglycan synthetase FtsI (Peptidoglycanglycosyltransferase 3)
           (Penicillin-binding protein 3) (PBP-3) [Burkholderia
           multivorans CGD2M]
          Length = 618

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 130/550 (23%), Positives = 237/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +++  V +  L +R              +         E    R  I+DRNG +L
Sbjct: 30  RSKLVVILVFVAFAALIVRAFWVQVANQDFYVGQGQKRYQRTIELDAMRGRIVDRNGAML 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   D    ++  +L ++    ++R+L ++  F  L+R++  +  
Sbjct: 90  AVSLATYEIWANPKQVSDTDY--PQIAKLL-DMPLAEVKRRLGNDRTFVLLKRQVDAETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGLTR 242
            R+    + G+    +  RFYP    A+HVVG+ +++++G  G+E   +       G   
Sbjct: 147 SRLDKLAIDGITRIADSKRFYPEGESAAHVVGFTNVEDQGQEGVELAANALLSGTSGQRE 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ +   +L     + NA +   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTRPLVPAQHGATIELTIDRRIQQLAFSQLKAAVLENNAVAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID    T   
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPLVVALSIDQRKVTPNT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + +T          +      +  LT+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IINTSPGTYKIGPAVIHDTSNHGSLTVAQALQKSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLS + LQ A    A   +G L P +
Sbjct: 387 GRAPELTFPGVASGRLRSYQRWRPIEQATMAYGYGLSMSLLQIAQMYTAYAGDGTLHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +    ++          V    T   +RS+L   V  GG+GRRA V G+ +GGKTGTA+
Sbjct: 447 LLKNGTDQQTIDAHRGHRVTSPQTAAAIRSMLEMAVGEGGTGRRARVDGYRIGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y+       F  + P ++P+ IV   +D P+ K       G    P+  ++   
Sbjct: 507 KQVGSSYAKGKYRALFAGMAPMSNPRLIVAVMIDEPRGK---GYYGGTVAGPVFASVTSG 563

Query: 586 SASMLGVKPV 595
           +  +LGV P 
Sbjct: 564 ALQLLGVPPD 573


>gi|240126240|ref|ZP_04739126.1| Pbp2 [Neisseria gonorrhoeae SK-92-679]
 gi|268684821|ref|ZP_06151683.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-92-679]
 gi|40388705|gb|AAR85530.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|268625105|gb|EEZ57505.1| penicillin-binding protein 2 [Neisseria gonorrhoeae SK-92-679]
          Length = 582

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/559 (26%), Positives = 261/559 (46%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+        V  D H     L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKIGPSPVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFG 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 437 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 494 DVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HGYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 551 GPPFKKIMGGSLNILGISP 569


>gi|89095265|ref|ZP_01168186.1| Peptidoglycan glycosyltransferase [Oceanospirillum sp. MED92]
 gi|89080472|gb|EAR59723.1| Peptidoglycan glycosyltransferase [Oceanospirillum sp. MED92]
          Length = 568

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/536 (25%), Positives = 252/536 (47%), Gaps = 33/536 (6%)

Query: 86  IILAIRIIQY-----GNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFSLYVEP 140
             +  R++         +  +  A ++   +    R  I DRNGE LA   P  +++ +P
Sbjct: 28  GGITARMLFLYIEEQEFLQTQGDARTLRTIQVPAHRGIITDRNGEPLAVSAPVATIWADP 87

Query: 141 HKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKFQWLRRKLSPQQQKRILSFGLPGV 198
                  + + KL  VL   + + +  KL  +   +F +L+R+++P+  +++ +  +PG+
Sbjct: 88  KLTDLQHDSLSKLA-VLLKTNKKQLTAKLAENRSRRFMYLQRQVTPELAEKVRALRVPGI 146

Query: 199 GFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNKGE--- 250
               E  R+YPAA   +H+VG+ ++D +G  G+E   +       G   V     G    
Sbjct: 147 HVDREYKRYYPAAEVTTHLVGFTNLDGKGQEGLELSYEDWLKSEAGKQLVMKDRLGRTIK 206

Query: 251 --------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSI 302
                   ++   I+L++DLR+Q + ++EL    + + A+    V+L+ +TGEV++MV+ 
Sbjct: 207 HIREVQPAQHGNDIQLSIDLRLQYLAYRELKAAVQSHKADGGSLVMLDAATGEVLAMVNQ 266

Query: 303 PDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVG 362
           P Y+P++  +       NR     FE GS  K  T+A  + SG +T + + DT       
Sbjct: 267 PSYNPNDPRQRISTALRNRALTDTFEPGSTVKPMTVAAALMSGKYTPETMVDTSPGYMRV 326

Query: 363 KHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEI 422
           K      H     + +  I   SSN+G  +++ ++     +   + LGL        P  
Sbjct: 327 KRKTIRDHRNYGEIDVSTIITKSSNVGVTKLSFSLPEGSVRNLYHNLGLGQATGIGFPGE 386

Query: 423 QAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEK 480
                 Y ++ +++   T+S+G+GLS TPLQ A +  AL N+G + P + +   ++E  K
Sbjct: 387 STGYLPYLNERQKVERATLSYGYGLSVTPLQLAQSYLALANDGVVNPVSLIK--QDEPGK 444

Query: 481 VSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFN 539
               V+       +R ++   ++  G+GRRA VPG+ V GKTGT  KV    Y D    +
Sbjct: 445 AV-RVMPAQVAVDVREMMETVISVKGTGRRAAVPGYRVAGKTGTVHKVGNAGYLDDQYIS 503

Query: 540 SFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPV 595
           +F  + P ++P+ + +  +D+PK     +   G   AP+    +  +  ++ + P 
Sbjct: 504 TFAGIAPVSNPRLVTVVMIDNPK---GQEYYGGEVAAPVFSRAVGGALRLMNIPPD 556


>gi|222053875|ref|YP_002536237.1| Peptidoglycan glycosyltransferase [Geobacter sp. FRC-32]
 gi|221563164|gb|ACM19136.1| Peptidoglycan glycosyltransferase [Geobacter sp. FRC-32]
          Length = 657

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 158/552 (28%), Positives = 243/552 (44%), Gaps = 40/552 (7%)

Query: 79  VVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNGEILATDIPT 133
            V + I++++A R      +  E            I      R  I D N   LA  I  
Sbjct: 18  AVFVSIFVLIAARAFYLQVVKKESLVKLAEKQHQRIVPLTPVRGAIFDSNNAPLALSIEM 77

Query: 134 FSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILSF 193
            S + EP  V +  +   KL  +L  + +E + +KL     F WL+R+++P Q   I + 
Sbjct: 78  DSCFAEPRNVENIPDAAAKLAPLLS-MPAEQVEKKLKGSRNFVWLQRRMAPDQAAAIKAL 136

Query: 194 GLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTNK 248
            L G+GF  E  RFYP +  A+HVVG+  +D  G+ GIE   D       G         
Sbjct: 137 ALEGIGFVKESKRFYPNSEIAAHVVGFTGMDPEGLEGIELKYDSTILGSTGYLVTERDAL 196

Query: 249 GEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           G +              Q + L LD  IQ I  +EL++  +   A++   +++  +TG +
Sbjct: 197 GREVYSKGTVVKNPAKGQNVTLTLDKNIQYIAEKELIKAVETNGAKAGIALVMEPATGRI 256

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTR 356
           ++M + P+++P+   K  ++   NR     FE GS FK+F  A  ++       D F+  
Sbjct: 257 LAMANYPNFNPNTFSKYAQQALRNRSIADSFEPGSTFKIFLAATALEQKAIRPGDGFNCE 316

Query: 357 NPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLE 416
           N              +   L+I +I +YSSNIGAA+I   +G       L   G   K  
Sbjct: 317 NGSYSIGGRTIHDTHKYGYLSIAQILKYSSNIGAAKIGARLGNDKLYAGLTGFGFGEKTG 376

Query: 417 TELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRS 474
            +LP   + +    SQW  +   TISFG G++ TPLQ A   +A+ N G L+ P  + + 
Sbjct: 377 VDLPGESSGTLRNKSQWFGVDLATISFGQGVTATPLQIATGVSAVANGGLLMKPYLVEKI 436

Query: 475 REES--------EKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +++         +V R V+ + T KT+  +L   V  GG+G  A V G+   GKTGTAQ
Sbjct: 437 SDDNGNVVRSFAPEVKRRVISEETAKTVARMLEGVVAEGGTGVNAAVDGYRSAGKTGTAQ 496

Query: 526 KVI--KKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           KV    + YS      S++   P   P+  +L  +D PK         GI  AP    I 
Sbjct: 497 KVDHLTRGYSADKRTASYVGFVPLEKPRLTILVVVDEPKTSS----YGGIVAAPAFSAIA 552

Query: 584 RRSASMLGVKPV 595
            +S   L V   
Sbjct: 553 EQSLCYLKVPTD 564


>gi|32345864|gb|AAM97226.1| PenA [Neisseria meningitidis]
 gi|32345866|gb|AAM97227.1| PenA [Neisseria meningitidis]
 gi|32345870|gb|AAM97229.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 259/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|261401197|ref|ZP_05987322.1| peptidoglycan synthetase FtsI [Neisseria lactamica ATCC 23970]
 gi|269208878|gb|EEZ75333.1| peptidoglycan synthetase FtsI [Neisseria lactamica ATCC 23970]
          Length = 581

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 152/568 (26%), Positives = 265/568 (46%), Gaps = 38/568 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNID 110
           + + +  + K    S  RIG  ++   V++  L +R +         +  +     +   
Sbjct: 10  RMISKGEQVKKPLTSDGRIGFVLLAMAVLFAGLIVRGLYLQTVTYNFLKNQGDNQIVRTQ 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRK 168
               +R  I DRNG +LA   PT SLY  P  +        +E+L   L ++  +++R K
Sbjct: 70  SLPAARGTISDRNGAVLALSAPTESLYAVPKDMEEMPTGAQLEQLSG-LVDVPVDVLRNK 128

Query: 169 LSSE-TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           L  +   F W++R+L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G
Sbjct: 129 LEQKGKSFIWIKRQLDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKG 188

Query: 228 ITGIEKFLD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVH 269
             G+E  L+       G   V    +G              +N + I L+LD RIQ + +
Sbjct: 189 QEGLELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAY 248

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
           +EL +  + + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E 
Sbjct: 249 EELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEP 308

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K F IA  +D+G   V +  +T+                   L +  I + SSN+G
Sbjct: 309 GSAIKPFVIAKALDAGKTDVNERLNTQPYKI--GPAPVRDTHVYPSLDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLST 447
            ++++     +   +  + LG+  ++ +  P   A        W+ I   T+SFG+GL  
Sbjct: 367 TSKLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGS 506
           + LQ A A  AL ++G L+P   +   ++      + + K++T + +R+L+      GG+
Sbjct: 427 SLLQLARAYTALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GTAGAVDGFDVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTA--- 540

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
           N    G+   P    I+  S ++LGV P
Sbjct: 541 NGYYGGVVAGPPFKKIMGGSLNILGVSP 568


>gi|194290819|ref|YP_002006726.1| division-specific transpeptidase, penicillin-binding protein 3
           [Cupriavidus taiwanensis LMG 19424]
 gi|193224654|emb|CAQ70665.1| division-specific transpeptidase, penicillin-binding protein 3
           [Cupriavidus taiwanensis LMG 19424]
          Length = 599

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 139/549 (25%), Positives = 243/549 (44%), Gaps = 34/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +    ++ LA+R              E         E   +R  I+DRNG +L
Sbjct: 37  RSKLVVFLMFAAFVALAVRAAWIQGPGNQFYEAEGKKRFQRTLELPATRGKILDRNGLVL 96

Query: 128 ATDIPTFSLYVEPHKVISPDEIIE--KLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V +  E  +  +L  +L  +  + + +KLS +  F +L+R++ P 
Sbjct: 97  ATSLPVKAIWAVPEDVPNQVEAAKIRQLARLL-GMSEKELGKKLSEDKGFVYLKRQVLPD 155

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
              +I +  + G+    E  RFYP     +H+VG+ ++++RG  G+E   +       G 
Sbjct: 156 VADKIAALKIEGIHQTREYKRFYPEGEAMAHIVGFTNVEDRGQEGVELARESGLAGRAGA 215

Query: 241 TRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            +V     G            ++ + I+L++D +IQ + + EL     K+ A++   V+L
Sbjct: 216 RQVIKDRLGRVVEDIGVLKTPRDGEDIQLSIDAKIQYLAYNELKAVVDKHKAKAASAVVL 275

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +  TGEV+++ + P Y+P++  +   E   NR+    FE GS+ K  T+A+ +     + 
Sbjct: 276 DAQTGEVLALANWPTYNPNDRTRLSGEQLRNRVLTDTFEPGSMMKPITVALALQLKRVSP 335

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             +  T          I D H     LT+  + + SSNIG  +IA  M  Q   +    +
Sbjct: 336 STVIATTGKYNFEGATITDTHNY-GALTVTGVIQKSSNIGTTKIAMMMKPQEMWDMYTSI 394

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+ I   T+S+G+GLS +  Q A A     ++G LIP
Sbjct: 395 GLGQAPKIGFPGAVAGRVRPYKSWRPIEQATMSYGYGLSVSLFQMAHAYTIFAHDGELIP 454

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQK 526
              +   R         +L     + +R+++      GG+   A V G+ VGGKTGTA K
Sbjct: 455 ---VTMFRTNGPATGERILSPQVARDVRAMMETVTAPGGTAPEAQVMGYRVGGKTGTAYK 511

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
              + Y+ +    SF+ + P ++P+ IV   +D P          G+   P    I   +
Sbjct: 512 HEGRGYNRSKYRASFIGLAPMSNPRIIVAVSVDEPTA---GSHYGGLVAGPAFAAITGGT 568

Query: 587 ASMLGVKPV 595
              L V+P 
Sbjct: 569 LRALNVQPD 577


>gi|31296583|gb|AAP46584.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296667|gb|AAP46626.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345760|gb|AAM97174.1| PenA [Neisseria meningitidis]
 gi|32345762|gb|AAM97175.1| PenA [Neisseria meningitidis]
 gi|32345764|gb|AAM97176.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/559 (27%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|31296641|gb|AAP46613.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/559 (27%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 NSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|113869232|ref|YP_727721.1| peptidoglycan glycosyltransferase [Ralstonia eutropha H16]
 gi|113528008|emb|CAJ94353.1| peptidoglycan glycosyltransferase [Ralstonia eutropha H16]
          Length = 601

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 139/549 (25%), Positives = 242/549 (44%), Gaps = 34/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +    +  LA+R              E         E   +R  I+DRNG +L
Sbjct: 39  RSKLVVFLMFAAFGALALRAAWIQGPGNQFYEAEGKKRFQRTLELPATRGKILDRNGLVL 98

Query: 128 ATDIPTFSLYVEPHKVISPDEIIE--KLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V +  E  +  +L  +L  +  + + +KLS +  F +L+R++ P 
Sbjct: 99  ATSLPVKAVWAVPEDVPNQVEAAKIRQLAKLL-GMSEKDLGKKLSEDKGFVYLKRQVLPD 157

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
              +I +  + G+    E  RFYP     +H+VG+ ++++RG  G+E   +       G 
Sbjct: 158 VADKIAALKIEGIHQTREYKRFYPEGEAMAHIVGFTNVEDRGQEGVELAREPGLAGRAGA 217

Query: 241 TRVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            +V     G            ++ + I+L++D +IQ + + EL    +K+ A++   V+L
Sbjct: 218 RQVIKDRLGRVVEDVGVLKTPRDGEDIQLSIDAKIQYLAYNELKAVVEKHKAKAASAVVL 277

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +  TGEV+++ + P Y+P++  +   E   NR+    FE GS+ K  T+ + +     T 
Sbjct: 278 DAQTGEVLALANWPTYNPNDRTRLSGEQLRNRVLTDTFEPGSMMKPITVGLALQLKRVTP 337

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             +  T          I D H     LT+  + + SSNIG  +IA  M  Q   +    +
Sbjct: 338 STVITTTGKYNFEGATISDTHNY-GALTVSGVIQKSSNIGTTKIAMMMKPQEMWDMYTSI 396

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+ I   T+S+G+GLS +  Q A A     ++G LIP
Sbjct: 397 GLGQAPKIGFPGAVAGRVRPFKSWRPIEQATMSYGYGLSVSLFQMAHAYTIFAHDGELIP 456

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQK 526
              +   R         +L     + +R+++      GG+   A V G+ VGGKTGTA K
Sbjct: 457 ---VSMFRTSGPATGERILSPQVARDVRAMMETVTAPGGTAPEAQVMGYRVGGKTGTAYK 513

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
              + Y+ +    SF+ + P ++P+ IV   +D P          G+   P    I   +
Sbjct: 514 HEGRGYNRSKYRASFIGLAPMSNPRIIVAVSVDEPTA---GSHYGGLVAGPAFAAITGGT 570

Query: 587 ASMLGVKPV 595
              L V+P 
Sbjct: 571 LRALNVQPD 579


>gi|237508084|ref|ZP_04520799.1| penicillin-binding protein [Burkholderia pseudomallei MSHR346]
 gi|235000289|gb|EEP49713.1| penicillin-binding protein [Burkholderia pseudomallei MSHR346]
          Length = 594

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ +I++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNIEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|254183569|ref|ZP_04890161.1| penicillin-binding protein [Burkholderia pseudomallei 1655]
 gi|184214102|gb|EDU11145.1| penicillin-binding protein [Burkholderia pseudomallei 1655]
          Length = 594

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|134283745|ref|ZP_01770443.1| penicillin-binding protein [Burkholderia pseudomallei 305]
 gi|167898292|ref|ZP_02485693.1| penicillin-binding protein [Burkholderia pseudomallei 7894]
 gi|134244927|gb|EBA45023.1| penicillin-binding protein [Burkholderia pseudomallei 305]
          Length = 594

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|126455948|ref|YP_001075659.1| penicillin-binding protein [Burkholderia pseudomallei 1106a]
 gi|167723716|ref|ZP_02406952.1| penicillin-binding protein [Burkholderia pseudomallei DM98]
 gi|167742672|ref|ZP_02415446.1| penicillin-binding protein [Burkholderia pseudomallei 14]
 gi|217419040|ref|ZP_03450547.1| penicillin-binding protein [Burkholderia pseudomallei 576]
 gi|242311286|ref|ZP_04810303.1| penicillin-binding protein [Burkholderia pseudomallei 1106b]
 gi|126229716|gb|ABN93129.1| penicillin-binding protein [Burkholderia pseudomallei 1106a]
 gi|217398344|gb|EEC38359.1| penicillin-binding protein [Burkholderia pseudomallei 576]
 gi|242134525|gb|EES20928.1| penicillin-binding protein [Burkholderia pseudomallei 1106b]
          Length = 594

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|126443755|ref|YP_001062707.1| putative penicillin-binding protein [Burkholderia pseudomallei 668]
 gi|126223246|gb|ABN86751.1| putative penicillin-binding protein [Burkholderia pseudomallei 668]
          Length = 594

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYRIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|32345906|gb|AAM97247.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 156/559 (27%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + + EL +    
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYDELNKAVAY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++V+ P YDP++  +   E   NR    + E GS  K FTI
Sbjct: 258 HKAKAGAVVVLDAQTGEILALVNSPAYDPNQPGQANSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TMLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|323497889|ref|ZP_08102898.1| peptidoglycan synthetase ftsI precursor [Vibrio sinaloensis DSM
           21326]
 gi|323316934|gb|EGA69936.1| peptidoglycan synthetase ftsI precursor [Vibrio sinaloensis DSM
           21326]
          Length = 575

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/557 (25%), Positives = 243/557 (43%), Gaps = 36/557 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +    + +  L  RI     I P     +    S+       +R  I DRNGE
Sbjct: 22  RWRFNLILSCVFLAFAALVTRIAYIQIIEPDNLIKQGDLRSVRAKTLHSARGIISDRNGE 81

Query: 126 ILATDIPTFSLYVEPHKV-----ISPDEIIEKLQIVLPNLDSEMIRRK-LSSETKFQWLR 179
            LA  +P  +++ +P  +     +   +    L  VL     EMI +   + + +F +L+
Sbjct: 82  PLAVSVPVEAVWADPATIFKKGGLDDIDRWHALADVLGLKRDEMIDKIERNKKRRFIYLQ 141

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ- 238
           R++SP     I    L GVG + E  R+YPA   ++H+VG   ID  G+ G+E+  D   
Sbjct: 142 RQVSPAMAHYIRELKLAGVGLKAESRRYYPAGEVSAHIVGVTGIDGHGLEGVERSYDKWL 201

Query: 239 ----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESV 284
               G   +     G           +  +P+ L +D R+Q I ++ + +    Y A S 
Sbjct: 202 TGEAGKRIIRKDRYGRVVENISLEEREEGKPLELTIDQRVQAIAYRAIKQAVADYRATSG 261

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
             V+L+V TG V++MV+ P Y+P+     +     NR+    FE GS  K F +   +++
Sbjct: 262 SAVVLDVKTGAVLAMVNAPSYNPNNRSDLQSAKMRNRVITDAFEPGSTVKPFVVMAALEN 321

Query: 345 GLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           G      + DT N I            +     +  I + SSNIG A +A  M ++    
Sbjct: 322 GAADDDTIIDTGNGIMRIGGSRVRDTSKVGKADLTTILKKSSNIGVATLALRMPVEALLG 381

Query: 405 FLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALINE 462
               +G        L       +P+  +W +    T++FG+GL+ TPLQ A A A L N 
Sbjct: 382 MYSSVGFGEVSGLNLIGETQGIFPNRRRWSKFEIATLAFGYGLTITPLQLAHAYATLGNY 441

Query: 463 GRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKT 521
           G+  P   +  + ++    S+ V+     + + ++L      GGS  +A VPG+ V  KT
Sbjct: 442 GKYQPVHIIENNEQD---FSKQVIDHEIARKVLAMLETVTQPGGSATKAGVPGYRVAAKT 498

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GTA+K I   Y D   F     V P ++P+  ++  ++ P+    +    G    P+   
Sbjct: 499 GTARKAIAGGYGDE-YFAYTAGVAPASEPRVALVVVVNEPQ---GDNYYGGSVAGPVFSE 554

Query: 582 IIRRSASMLGVKPVFLK 598
           I++ +  +L V P   +
Sbjct: 555 IMKGTLQILNVAPDENR 571


>gi|254191039|ref|ZP_04897544.1| penicillin-binding protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|157938712|gb|EDO94382.1| penicillin-binding protein [Burkholderia pseudomallei Pasteur
           52237]
          Length = 594

 Score =  374 bits (960), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRPGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|167922843|ref|ZP_02509934.1| penicillin-binding protein [Burkholderia pseudomallei BCC215]
          Length = 592

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|53722242|ref|YP_111227.1| penicillin-binding protein [Burkholderia pseudomallei K96243]
 gi|76817761|ref|YP_335372.1| penicillin-binding protein [Burkholderia pseudomallei 1710b]
 gi|167819852|ref|ZP_02451532.1| penicillin-binding protein [Burkholderia pseudomallei 91]
 gi|167828238|ref|ZP_02459709.1| penicillin-binding protein [Burkholderia pseudomallei 9]
 gi|167915012|ref|ZP_02502103.1| penicillin-binding protein [Burkholderia pseudomallei 112]
 gi|226198044|ref|ZP_03793616.1| penicillin-binding protein [Burkholderia pseudomallei Pakistan 9]
 gi|254263516|ref|ZP_04954381.1| penicillin-binding protein [Burkholderia pseudomallei 1710a]
 gi|254301697|ref|ZP_04969140.1| penicillin-binding protein [Burkholderia pseudomallei 406e]
 gi|52212656|emb|CAH38686.1| putative penicillin-binding protein [Burkholderia pseudomallei
           K96243]
 gi|76582234|gb|ABA51708.1| penicillin-binding protein [Burkholderia pseudomallei 1710b]
 gi|157811638|gb|EDO88808.1| penicillin-binding protein [Burkholderia pseudomallei 406e]
 gi|225929920|gb|EEH25935.1| penicillin-binding protein [Burkholderia pseudomallei Pakistan 9]
 gi|254214518|gb|EET03903.1| penicillin-binding protein [Burkholderia pseudomallei 1710a]
          Length = 594

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|31296637|gb|AAP46611.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 153/559 (27%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LG+ P
Sbjct: 550 GPPFKKIMGGSLNILGISP 568


>gi|32345880|gb|AAM97234.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A +  +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|190572796|ref|YP_001970641.1| putative penicillin-binding protein 3 [Stenotrophomonas maltophilia
           K279a]
 gi|190010718|emb|CAQ44327.1| putative penicillin-binding protein 3 precursor [Stenotrophomonas
           maltophilia K279a]
          Length = 614

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 154/556 (27%), Positives = 263/556 (47%), Gaps = 33/556 (5%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRP 117
           R +   + + R+    +   +  + L  R              +  A  +       SR 
Sbjct: 8   RPRNAFNLRQRLRWVALALGLCSVSLVGRAAYVQIINSDFYQRQGEARYLRELPIKTSRG 67

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKF 175
            I DRNGE LA   P  S++V P  ++   E I +L   +  +  + +  +L   S+ +F
Sbjct: 68  MITDRNGEPLAVSTPVASIWVNPQDLLRSPERIPELAQAV-GMSVDELSSRLSQKSDKEF 126

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +LRR+++P + +++++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   
Sbjct: 127 MYLRRRINPDEAEKVVALKIPGVAAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAF 186

Query: 236 DMQ-----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYN 280
           D       G  RV    KGE          +  + + L++D RIQ +  +EL        
Sbjct: 187 DEWLRGKAGAKRVIRNRKGETVESDLLRAAEPGKDLTLSIDRRIQYLAFKELRNALVANK 246

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A     VI++V+TGE+++MV++P Y+P+       +   NR    + E GS  K  TIA 
Sbjct: 247 AAGGSMVIMDVTTGEILAMVNLPTYNPNSLTGALPDARRNRAVTDLVEPGSTMKPLTIAT 306

Query: 341 GIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + +G  T   + D     + +G+  I D    N +L +  +   SSN+GAA++A  M  
Sbjct: 307 ALQAGAVTKDTIIDTNPGYMTLGRFTIRDVPRNNGVLNVTGVITRSSNVGAAKVAAKMPD 366

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           Q   + + R G  S   +  P         P++W      T+S+G+GL+ TPLQ A A +
Sbjct: 367 QVFYDGVRRFGYGSVPHSGFPGESGGVVLRPARWSGTTKTTMSYGYGLNVTPLQIATAYS 426

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           AL N GRLI PTF+   R E     + ++ +N  + + +++   VT G  ++A V G+ V
Sbjct: 427 ALANGGRLIAPTFVKGQRNE----GQQIIDENVARQVVAMMETVVTQGGAKQAAVLGYRV 482

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
            GKTGTA+K     Y        F  V P T+P++  +  ++ P+     +   G+  AP
Sbjct: 483 AGKTGTARKAGPGGYERGHYNALFAGVVPATNPRFATVIVINDPQA---GKFYGGLVSAP 539

Query: 578 MVGNIIRRSASMLGVK 593
           +  N++  +  ++ V 
Sbjct: 540 VYHNVMEGTLRLMDVP 555


>gi|262190390|ref|ZP_06048650.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae CT 5369-93]
 gi|262033730|gb|EEY52210.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae CT 5369-93]
          Length = 580

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/558 (25%), Positives = 248/558 (44%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +   L  +  L  R+     I P     E    S+       +R  I DRNGE
Sbjct: 27  RWRFYLLLFFVLTAFCALVARVAYIQIIEPDNLIKEGDLRSIRAKTLQSARGIISDRNGE 86

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEK-----LQIVLPNLDSEMIRRKL--SSETKFQWL 178
            LA  +P  +++ +P  +     ++EK     L  VL  LD + + +K+  +   +F +L
Sbjct: 87  ALAVSVPVEAVWADPVAIYKEGGLVEKDRWYALADVL-GLDRQEMMKKIEDNRSRRFIYL 145

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-- 236
           +R++SP   K I    L G+G + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 146 QRQVSPAMAKYIRELKLAGIGLKEESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSFDST 205

Query: 237 ---MQGLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G +       G           +  +PI+L +D R+Q I  + + +    Y A S
Sbjct: 206 LTGESGKSVTRKDKFGRVVENIALEEREEGKPIQLTIDQRLQAIAFRAVKQAMADYRATS 265

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+V TG V++MV+ P Y+P+     +     NR+    FE GS  K F +   + 
Sbjct: 266 ASAVMLDVKTGAVLAMVNAPSYNPNNRNDWQSFKMRNRVITDAFEPGSTVKPFVVLAALA 325

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT +              +     +  I + SSNIG A++A  M ++   
Sbjct: 326 NGIADKNTIIDTGDGTMQIGGSRVRDTSKVGKADLTLILKKSSNIGVAKLALEMPLEALL 385

Query: 404 EFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +GL      +L       +P+  +W +    T+SFG+GL+ TP+Q A A A L N
Sbjct: 386 GMYSSVGLGEMSGLDLVGETIGIFPNRRRWSQFEIATLSFGYGLAITPIQLAHAYATLGN 445

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +   +      +R V+    V  +  +L      GG+  RA VPG+ +  K
Sbjct: 446 HGKYQPIHIIKGDQHGD---TRQVVDPKYVNQVLEMLETVTQPGGTATRAAVPGYRIAAK 502

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           +GT++K I   YSD   F     V P +DP+  ++  ++ P+    +    G    P+  
Sbjct: 503 SGTSRKAIAGGYSDE-YFAYTAGVAPVSDPRISLVVMVNEPQ---GDSYYGGAVAGPVFS 558

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L + P   +
Sbjct: 559 EIMKGALQILNIAPDENR 576


>gi|31296625|gb|AAP46605.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/559 (26%), Positives = 256/559 (45%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++    
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPAPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFS 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +  + LG+  ++ +  P   A        W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 SEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|125973494|ref|YP_001037404.1| peptidoglycan glycosyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|256003310|ref|ZP_05428301.1| Peptidoglycan glycosyltransferase [Clostridium thermocellum DSM
           2360]
 gi|281417695|ref|ZP_06248715.1| Peptidoglycan glycosyltransferase [Clostridium thermocellum JW20]
 gi|125713719|gb|ABN52211.1| Peptidoglycan glycosyltransferase [Clostridium thermocellum ATCC
           27405]
 gi|255992600|gb|EEU02691.1| Peptidoglycan glycosyltransferase [Clostridium thermocellum DSM
           2360]
 gi|281409097|gb|EFB39355.1| Peptidoglycan glycosyltransferase [Clostridium thermocellum JW20]
 gi|316940269|gb|ADU74303.1| penicillin-binding protein transpeptidase [Clostridium thermocellum
           DSM 1313]
          Length = 723

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 129/587 (21%), Positives = 244/587 (41%), Gaps = 67/587 (11%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPE-----PIAPSMNIDEYGMSRPDIIDRNG 124
            K R+   +++   + I L  R+     +  E           +  E    R  I+DRNG
Sbjct: 8   MKKRLLAVLLIFTFLIIALLGRVGWLQIVRGEELQRKAYEQQNSDREIPPRRGSILDRNG 67

Query: 125 EILATDIPTFSLYVEPHKVISP----DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRR 180
           + LA       + V P ++       ++I +KL   L   +  ++++   + ++++ +++
Sbjct: 68  KQLAISATVDRIVVNPTEIDKSPEVREQIAKKLAEFLDLDEEAVLKKINKTNSRYEIIKK 127

Query: 181 KLS----PQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           ++      Q ++      + G+    +  R+YP  + A+HV+G+V  DN+G+ GIEK ++
Sbjct: 128 RVEKSIGDQIRQWKSEEKIKGLYIDEDTKRYYPKGNLAAHVIGFVGEDNQGLDGIEKTME 187

Query: 237 M-----QGLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKY 279
                  G        +G +            +   + L +D  IQ    + L +  +  
Sbjct: 188 KYLKGVPGKILSEVDAQGRQMPNYENKRIDPQDGLNVVLTIDENIQYFAEEALQKAIEDN 247

Query: 280 NAES-VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEG--------------------W 318
              +    ++++   GE++++VS PD++ ++                            W
Sbjct: 248 KVANGAFAIVMDPRNGEILALVSKPDFNLNDPRACPPSEDPATWTGTSQKDVETLYRTVW 307

Query: 319 FNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTI 378
            N+     +E GS FK  T A+G + G+ T +     R     G ++       +   + 
Sbjct: 308 RNKAVSDTYEPGSTFKAITTAIGFEEGVVTPETRTSDRTITVQGHNIKCWKENFHGEESF 367

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLT 438
            E    S N    ++A  +G+     +L   G   K   ELP     ++ ++   I    
Sbjct: 368 REAVYNSCNPAFVKVALDIGVDKFYNYLRAFGFYDKTGIELPGEAQGNFHAKPTDIDLAV 427

Query: 439 ISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKKNT 490
            SFG     TPL+   A  A+ N G+LI P  +    +           +V R V+ K T
Sbjct: 428 ASFGQRFKVTPLEMIAAYGAIANGGKLIKPHLVKEIVDSEGNVVEKFEPQVVRNVISKET 487

Query: 491 VKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDP 550
            +T+  +L   V+ G+GR A+V G+ V GKTGT++  ++  Y       SF A+ P  +P
Sbjct: 488 CQTLLDVLEGVVSEGTGRNAYVKGYRVAGKTGTSETDVEGVY-----VASFAAIAPADNP 542

Query: 551 QYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKPVFL 597
           +  VL  +D+P+ +       G   AP+ G I+  + S LGV+  + 
Sbjct: 543 RICVLVALDNPRGES---YYGGTIAAPVAGKIVEETLSYLGVERRYT 586


>gi|255068192|ref|ZP_05320047.1| peptidoglycan synthetase FtsI [Neisseria sicca ATCC 29256]
 gi|255047534|gb|EET42998.1| peptidoglycan synthetase FtsI [Neisseria sicca ATCC 29256]
          Length = 582

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 163/568 (28%), Positives = 265/568 (46%), Gaps = 38/568 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPS-----MNID 110
             L +  + K    S  RI + + +    ++ L  R I       E +        +   
Sbjct: 10  SMLPKTAKAKKPITSDGRISLVLWLIAAAFVGLLARGIYLQTTQHEFLKNQGDQRFVRTL 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRK 168
               SR  I DRNG  LA   PT SLY  P  +      E + KL  ++ +L  E ++ K
Sbjct: 70  TLPASRGMITDRNGATLALSAPTESLYAMPSGMEEMPTAEQMAKLAAIV-DLPVEALQEK 128

Query: 169 LSSETK-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           L+ + K F +L+R+LS ++ + I + G+ G+ F+ E  R YP  +  +HV+G+ +ID +G
Sbjct: 129 LAKKDKDFIYLKRQLSQEKAEEIKALGIKGLAFQKELKRHYPMGNLFAHVIGFTNIDGKG 188

Query: 228 ITGIEKF-----LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVH 269
             G+E           G   V   NKG              KN Q + L+LD RIQ + +
Sbjct: 189 QEGLELSREDSLHGADGAKVVLRDNKGNIVDSLDSPRNSDPKNGQDMVLSLDQRIQTLAY 248

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
            EL +    + A++   V+L+  TGE++++V+ P YDP++      E   NR    + E 
Sbjct: 249 DELNKAVAYHKAKAGTVVVLDAQTGEILALVNSPAYDPNQPGSADSEQRRNRAVTDMIEP 308

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K FTIA  +DSG   V D F+T                    L +  I + SSN+G
Sbjct: 309 GSAMKPFTIAKALDSGKVGVADRFNTMPYKI--GPATVRDTHVYPTLDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLST 447
            ++++     +   +F + LG+  ++ +  P   A    S   W+ I   T+SFG+GL  
Sbjct: 367 TSKLSAKFTPKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGS 506
           + LQ A A   L ++G L+P   +   ++      + V+K +T + +R L+      GG+
Sbjct: 427 SLLQLARAYTMLTHDGELLP---VSFEKQAVAPKGKRVIKASTAREVRDLMVSVTEPGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GTAGAVDGFDVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA--- 540

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
           N    G+   P+   ++  S ++LGV P
Sbjct: 541 NGYYGGVVAGPVFKQVMGGSLNILGVSP 568


>gi|308069886|ref|YP_003871491.1| stage V sporulation protein D (sporulation specific
           penicillin-binding protein) [Paenibacillus polymyxa
           E681]
 gi|305859165|gb|ADM70953.1| Stage V sporulation protein D (Sporulation specific
           penicillin-binding protein) [Paenibacillus polymyxa
           E681]
          Length = 622

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/554 (25%), Positives = 253/554 (45%), Gaps = 44/554 (7%)

Query: 81  CLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTFS 135
             V++  L+IR+          +  +          +   R +I+DR G  L  ++ + +
Sbjct: 3   LFVLFAALSIRLAYVQLGKGGELSAKAEDSWRRNIPFAAKRGEILDRQGTALTYNVSSPT 62

Query: 136 LYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR---RKLSPQQQKRILS 192
           +   P ++  P+E   +L  +L ++  + + + ++  T  Q L+   RK++ ++ ++I  
Sbjct: 63  VMAIPVQIKKPEETARRLAPLL-DMSEDKVLKLITKRTASQKLQPGGRKITMEKAQQIRD 121

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTN 247
             LPG+    +  R+YP    A+H++G+  IDN+G+TG+EK  + +     G     +  
Sbjct: 122 LKLPGIVVAEDNKRYYPYGDLAAHILGFTGIDNQGLTGVEKQQNSKLRGIDGSIAYLSDA 181

Query: 248 KG------------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGE 295
            G             K+   ++L +D  +Q+I+ +EL +   K+ A+S  ++ +N  TGE
Sbjct: 182 GGRLMPGSSEKYIEPKDGLNLQLTIDKSVQSIMERELDQAMVKFQAKSALSIAMNPKTGE 241

Query: 296 VISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTIAMGIDSGLFT-VKDLF 353
           ++ M   P Y+P    +   E +  N   +  +E GS FK+ T+A  ++        D F
Sbjct: 242 ILGMAGRPSYEPALYKQYAPEIYNRNLPIWMTYEPGSTFKIITLAAALEEKKVNLKNDRF 301

Query: 354 DTRNPIKVGKHV-IHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLL 412
                I+VG           +   T  ++   S N G   +   +G +   +++   G  
Sbjct: 302 FDPGYIEVGGARLRCWKKGGHGSQTFLQVVENSCNPGFVTLGQRLGKETLFKYIRNFGFG 361

Query: 413 SKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTF 470
           SK   ++            Q   +   T +FG G+S TP+Q   A +A IN G L  P  
Sbjct: 362 SKTGIDMIGEGNGILFKLPQVGPVELATTAFGQGVSVTPIQQVTAVSAAINGGNLYKPHI 421

Query: 471 MIRSREE---------SEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKT 521
                +            ++ R V+ + T + +R  L   V  G+GR AF+ G+ VGGKT
Sbjct: 422 TKGWVQPGTGKVLEKVEPELVRRVISEETSRQVREALESVVAKGTGRPAFIEGYRVGGKT 481

Query: 522 GTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGN 581
           GTAQKVI  RYS + +  SF+   P  DPQ +V + +D+PK  +      G+  AP+V N
Sbjct: 482 GTAQKVINGRYSSSEHIVSFIGFAPADDPQIVVYTAVDNPKGIQ----FGGVVAAPIVQN 537

Query: 582 IIRRSASMLGVKPV 595
           I++ +   L + P 
Sbjct: 538 ILKDALIALKIPPR 551


>gi|53716950|ref|YP_105722.1| penicillin-binding protein [Burkholderia mallei ATCC 23344]
 gi|121597133|ref|YP_989661.1| penicillin-binding protein [Burkholderia mallei SAVP1]
 gi|124381966|ref|YP_001024197.1| penicillin-binding protein [Burkholderia mallei NCTC 10229]
 gi|126446235|ref|YP_001078398.1| penicillin-binding protein [Burkholderia mallei NCTC 10247]
 gi|167002294|ref|ZP_02268084.1| penicillin-binding protein [Burkholderia mallei PRL-20]
 gi|238562800|ref|ZP_00439834.2| penicillin-binding protein [Burkholderia mallei GB8 horse 4]
 gi|254174399|ref|ZP_04881061.1| penicillin-binding protein [Burkholderia mallei ATCC 10399]
 gi|254200528|ref|ZP_04906893.1| penicillin-binding protein [Burkholderia mallei FMH]
 gi|254204552|ref|ZP_04910905.1| penicillin-binding protein [Burkholderia mallei JHU]
 gi|254356819|ref|ZP_04973094.1| penicillin-binding protein [Burkholderia mallei 2002721280]
 gi|52422920|gb|AAU46490.1| penicillin-binding protein [Burkholderia mallei ATCC 23344]
 gi|121224931|gb|ABM48462.1| penicillin-binding protein [Burkholderia mallei SAVP1]
 gi|124289986|gb|ABM99255.1| penicillin-binding protein [Burkholderia mallei NCTC 10229]
 gi|126239089|gb|ABO02201.1| penicillin-binding protein [Burkholderia mallei NCTC 10247]
 gi|147748140|gb|EDK55215.1| penicillin-binding protein [Burkholderia mallei FMH]
 gi|147754138|gb|EDK61202.1| penicillin-binding protein [Burkholderia mallei JHU]
 gi|148025846|gb|EDK83969.1| penicillin-binding protein [Burkholderia mallei 2002721280]
 gi|160695445|gb|EDP85415.1| penicillin-binding protein [Burkholderia mallei ATCC 10399]
 gi|238521895|gb|EEP85343.1| penicillin-binding protein [Burkholderia mallei GB8 horse 4]
 gi|243062031|gb|EES44217.1| penicillin-binding protein [Burkholderia mallei PRL-20]
          Length = 594

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 134/550 (24%), Positives = 240/550 (43%), Gaps = 33/550 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         + G  R  I+DRNG +L
Sbjct: 30  RSKFVVILVFLAFGALIARAFWVQVANQDFYVGQGQKRYQRTIKLGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQ 187
           A  + T+ ++  P +V   +     L  +L ++    +RR+L+ +  F  L+R++ P+  
Sbjct: 90  AVSLTTYEIWANPKQVD--EAAHAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPETA 146

Query: 188 KRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTR 242
            RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  +
Sbjct: 147 ARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQRQ 206

Query: 243 VFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           V     G            ++   I L +D RIQ + + +L       NA++   V+L+ 
Sbjct: 207 VIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLDA 266

Query: 292 STGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD 351
             GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    + 
Sbjct: 267 QNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQT 326

Query: 352 LFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGL 411
           + DT          +      +  +T+ +  + SSNI  A++A  +  +         G+
Sbjct: 327 IIDTSPGAYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYGI 386

Query: 412 LSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPT 469
               E   P + +       +W+ I   T+++G+GLST+ LQ A    A   +G + P +
Sbjct: 387 GRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSTSLLQIAQVYTAYAGDGTIHPVS 446

Query: 470 FMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQ 525
            +  S +           V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA+
Sbjct: 447 LLKASADPQSADAHRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTAR 506

Query: 526 KVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRR 585
           K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++  
Sbjct: 507 KQVGASYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMSG 563

Query: 586 SASMLGVKPV 595
           S  +LGV P 
Sbjct: 564 SLQLLGVPPD 573


>gi|31296567|gb|AAP46576.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296589|gb|AAP46587.1| penicillin binding protein 2 [Neisseria meningitidis]
          Length = 581

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 154/559 (27%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                 +G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHAEEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  K FTI
Sbjct: 258 HQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAMKPFTI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +DSG     D F+T                    L +  I + SSN+G ++++    
Sbjct: 318 AKALDSGKVDATDTFNTLPYKI--GPATVQDTHVYPTLDVRGIMQKSSNVGTSKLSAMFT 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    S   W++I   T+SFG+GL  + LQ A A 
Sbjct: 376 PKEMYDFYHDLGVGVRMHSGFPGETAGLLRSWRRWQKIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TVLTHDGELLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|226313429|ref|YP_002773323.1| stage V sporulation protein D [Brevibacillus brevis NBRC 100599]
 gi|226096377|dbj|BAH44819.1| stage V sporulation protein D [Brevibacillus brevis NBRC 100599]
          Length = 642

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/567 (26%), Positives = 248/567 (43%), Gaps = 41/567 (7%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSM-----NIDEYGMSRPD 118
           R   A  + RI + ++V +V+Y  L  R+     I    ++           ++  +R  
Sbjct: 2   RVSNATVRRRIFIILIVGVVLYSALVTRLGYVQLIEGPKLSQMSDELLKREIKFQPNRGR 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSS--ETKFQ 176
           I+DR+G  L T++   +L     ++  P E   +L ++L   + ++ R            
Sbjct: 62  ILDRSGNELVTNMTVPTLVSVGAQIKDPKETARQLAVILEQKEEDVFRAITKKAMSNNQI 121

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
              RKLS ++ ++I    LPG+    +  RFYP  + A+H++G+  IDN+G+TG+EK  D
Sbjct: 122 PGGRKLSVEKARKIQELNLPGIYLAGDTKRFYPNGTMAAHILGFTGIDNQGLTGLEKIYD 181

Query: 237 -----MQGLTRVFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKY 279
                 +G     +  KG              N   + L LD  IQ+ + +EL +    Y
Sbjct: 182 PFLMGTEGHISFPSDAKGRVLPGGTEDYVAPVNGMDMYLTLDSAIQSFIERELDQAVVAY 241

Query: 280 NAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGW-FNRISYGIFEMGSIFKVFTI 338
             + V  + +N  TGE++ M S P + P        E +  N   +  +E GS FK+ T+
Sbjct: 242 QPDDVLAIAMNPKTGEILGMGSRPTFQPDAYRDYPSEVYNRNLPIWKTYEPGSTFKIVTL 301

Query: 339 AMGIDSGLFTVKDLFDTRNPIKV-GKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAM 397
           A  ++ G+  + + F     I V GK +       +   T+ E+   S N G   +   +
Sbjct: 302 AAALNEGVINLNEGFYDPGFINVAGKRLRCWKRQGHGQETMLEVVENSCNPGFVTMGQRL 361

Query: 398 GIQGHKEFLYRLGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
             +   +++ + G   K   +L   +        +   +   T SFG G+S TP+Q   A
Sbjct: 362 QKERLFDYIKKFGFGQKTGIDLIGEENGLLFNLKKVGPVELGTTSFGQGVSVTPIQQMAA 421

Query: 456 AAALINEGRLIPPTFMIRSREES---------EKVSRIVLKKNTVKTMRSLLREGVTGGS 506
            +A IN G+L+ P      R+               R V+ + T   +R  L   V  G+
Sbjct: 422 VSAAINGGKLMKPFVAKEWRDSVTHDVVARTLPTEVRQVITEETSAKVRHALESVVAQGT 481

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G +AF+ G+ VGGKTGTAQKV   RY D     SF+   P  DPQ +V   +D+PK    
Sbjct: 482 GNKAFIEGYRVGGKTGTAQKVKNGRYVDGEYIVSFIGFAPADDPQLVVYFAVDNPKAL-- 539

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVK 593
                G+  AP V +I+  S   L V 
Sbjct: 540 --AFGGLIAAPSVKSIMESSLQHLNVP 564


>gi|53720641|ref|YP_109627.1| peptidoglycan synthetase FtsI [Burkholderia pseudomallei K96243]
 gi|126438888|ref|YP_001060541.1| penicillin-binding protein [Burkholderia pseudomallei 668]
 gi|167817536|ref|ZP_02449216.1| penicillin-binding protein [Burkholderia pseudomallei 91]
 gi|167896011|ref|ZP_02483413.1| penicillin-binding protein [Burkholderia pseudomallei 7894]
 gi|217425721|ref|ZP_03457211.1| penicillin-binding protein [Burkholderia pseudomallei 576]
 gi|254191018|ref|ZP_04897524.1| penicillin-binding protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254299372|ref|ZP_04966822.1| penicillin-binding protein [Burkholderia pseudomallei 406e]
 gi|52211055|emb|CAH37043.1| peptidoglycan synthetase FtsI [Burkholderia pseudomallei K96243]
 gi|126218381|gb|ABN81887.1| penicillin-binding protein [Burkholderia pseudomallei 668]
 gi|157809002|gb|EDO86172.1| penicillin-binding protein [Burkholderia pseudomallei 406e]
 gi|157938692|gb|EDO94362.1| penicillin-binding protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|217391309|gb|EEC31341.1| penicillin-binding protein [Burkholderia pseudomallei 576]
          Length = 614

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/548 (25%), Positives = 250/548 (45%), Gaps = 31/548 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +  + ++ LA+R              +  +      E   +R  I+DRNG +L
Sbjct: 27  RSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVL 86

Query: 128 ATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V      + ++ L  +L  + ++ ++ KLS +  F +++R++S  
Sbjct: 87  ATSLPVRAIWAIPADVPDDLGADKLDALGKLL-GMTTKELKAKLSEDKTFVYVKRQVSLD 145

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGL 240
             +++    +PGV  R E  RFYP     +H++G+ ++++ G  G+E           G 
Sbjct: 146 VAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGFTNVEDEGQEGVELADQKLLVGTPGS 205

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G             N   + L++D +IQ I +  L    +K++A++   +++
Sbjct: 206 RHVIKDRVGHIVEDVDAQVPPHNGADVGLSIDSKIQYITYTNLKAAVEKFHAKAGAAMVI 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+S+V+ P Y+P++      E   NR+   +FE GSI K FT+++ +D    T 
Sbjct: 266 DVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLTDVFEPGSIMKPFTVSLALDLHRVTP 325

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             L +T N   V              LT+  + + SSNIGA +IA  M  +        +
Sbjct: 326 NTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQKSSNIGATKIAMTMKPEEMWNMYTGI 385

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+RI   T+S+G+GLS +  Q A A  A+ ++G L+P
Sbjct: 386 GLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYGYGLSVSLFQLARAYTAIAHDGELMP 445

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            T    + +        V    T + +R++L   V+  G+   A VPG+ VGGK+GTA K
Sbjct: 446 VTIFKTN-DAQPPTGPRVFSPTTAREVRTMLESVVSPQGTSPNAAVPGYRVGGKSGTAYK 504

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            + + Y       SF+ + P  +P+ +V   +D P          G    P+   I+  +
Sbjct: 505 QVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPTT---GGHFGGQVSGPVFSAIVGDT 561

Query: 587 ASMLGVKP 594
              L V P
Sbjct: 562 LRALNVPP 569


>gi|309388987|gb|ADO76867.1| Peptidoglycan glycosyltransferase [Halanaerobium praevalens DSM
           2228]
          Length = 689

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/561 (25%), Positives = 253/561 (45%), Gaps = 42/561 (7%)

Query: 68  AHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPDIIDR 122
              KNR+     +  V++ ILA++++            + +   ++       R  I D 
Sbjct: 6   NSVKNRVMFYFAILFVLFTILALKLVWIQIINSAEYQHKALNQRVSKFIVNSERGIIYDN 65

Query: 123 NGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKL 182
            G  LA  +P  ++   P  +I  ++   +L  +L + D + I R+++SE    +L+RK+
Sbjct: 66  TGRKLAVSLPAKTVVALPDNIIKAEKTATELAALL-DQDYKTIYRRITSEAAAIFLQRKI 124

Query: 183 SPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----M 237
             +  ++I +  L G+ F  E  R+YP    ASH+VG+  IDN G+ GIE   +      
Sbjct: 125 DEKLYQKIKAKNLEGITFTEESKRYYPEGELASHIVGFTGIDNNGLNGIELSYNNHLNGR 184

Query: 238 QGLTRVFTTNKGE------------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVG 285
            G   V    +G             ++   + L +D  IQ +  +EL   + K+      
Sbjct: 185 AGKMIVERDAEGRTIPNGIREAVPGRDGYNVHLTIDSVIQYMAEKELENAESKFEFSGGS 244

Query: 286 TVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            ++++ STG+V+++ + P Y+P++  K  ++ W NR    +FE  S FK+ T A  ++ G
Sbjct: 245 VIVMDSSTGDVLALANTPSYNPNKFGKYSEKNWRNRAVNDVFEPASTFKIITAASALEEG 304

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHP-QNRILTIPEIFRYSSNIGAAQIADAMGIQGHKE 404
           + T  D+      I V    I+ +    +   T  E+ ++S N G  ++   M  +    
Sbjct: 305 VITENDILTDPGHIYVENQKINCWSSLGHGSQTFAEVVKHSCNPGFVEVGLKMDKKTFYS 364

Query: 405 FLYRLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINE 462
           ++   G   +    LP       P       +   T SFGHG+S TP+Q A A +A+ N 
Sbjct: 365 YIKAFGFGEQTGIRLPAEAKGIIPDYKDIGPVELATFSFGHGISVTPIQLASAVSAVANG 424

Query: 463 GRLIPPTFMIRSRE--------ESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPG 514
           G+L+ P  +                +V R V+ + T    + LL++ V  G+G +A + G
Sbjct: 425 GKLMRPRLVKEVDTGVGSKNIKNEPQVLRRVISQTTADKTKELLKQVVKNGTGTKAAIKG 484

Query: 515 FEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGIN 574
           +++GGKTGTA     K Y+D L  +SF+ + P  +   +VL+ +   + +          
Sbjct: 485 YQIGGKTGTA-----KHYNDDLYNSSFIGIVPAENRDLVVLTILYDIEGET---YYGSQT 536

Query: 575 VAPMVGNIIRRSASMLGVKPV 595
            AP+  N+     + L VKP 
Sbjct: 537 AAPVFKNLTENILNYLNVKPE 557


>gi|32345862|gb|AAM97225.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSLRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|509120|emb|CAA42189.1| penicillin-binding protein 2 [Neisseria meningitidis]
 gi|31296619|gb|AAP46602.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|31296621|gb|AAP46603.1| penicillin binding protein 2 [Neisseria meningitidis]
 gi|32345846|gb|AAM97217.1| PenA [Neisseria meningitidis]
 gi|32345848|gb|AAM97218.1| PenA [Neisseria meningitidis]
 gi|32345850|gb|AAM97219.1| PenA [Neisseria meningitidis]
 gi|32345852|gb|AAM97220.1| PenA [Neisseria meningitidis]
 gi|32345854|gb|AAM97221.1| PenA [Neisseria meningitidis]
 gi|32345856|gb|AAM97222.1| PenA [Neisseria meningitidis]
 gi|32345858|gb|AAM97223.1| PenA [Neisseria meningitidis]
 gi|32345860|gb|AAM97224.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  374 bits (959), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 261/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|32345868|gb|AAM97228.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 149/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T++                  L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQSYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|297581034|ref|ZP_06942959.1| penicillin-binding protein 3 [Vibrio cholerae RC385]
 gi|297534860|gb|EFH73696.1| penicillin-binding protein 3 [Vibrio cholerae RC385]
          Length = 580

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/558 (25%), Positives = 248/558 (44%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +   L  +  L  R+     I P     E    S+       +R  I DRNGE
Sbjct: 27  RWRFYLLLFFVLTAFCALVARVAYIQIIEPDNLIKEGDLRSIRAKTLQSARGIISDRNGE 86

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEK-----LQIVLPNLDSEMIRRKL--SSETKFQWL 178
            LA  +P  +++ +P  +     ++EK     L  VL  LD + + +K+  +   +F +L
Sbjct: 87  ALAVSVPVEAVWADPVAIYKEGGLVEKGRWYALADVL-GLDRQEMMKKIEDNRSRRFIYL 145

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-- 236
           +R++SP   K I    L G+G + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 146 QRQVSPAMAKYIRELKLAGIGLKEESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSFDST 205

Query: 237 ---MQGLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G +       G           +  +PI+L +D R+Q I  + + +    Y A S
Sbjct: 206 LTGESGKSVTRKDKFGRVVENIALEEREEGKPIQLTIDQRLQAIAFRAVKQAMADYRATS 265

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+V TG V++MV+ P Y+P+     +     NR+    FE GS  K F +   + 
Sbjct: 266 ASAVMLDVKTGAVLAMVNAPSYNPNNRNDWQSFKMRNRVITDAFEPGSTVKPFVVLAALA 325

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT +              +     +  I + SSNIG A++A  M ++   
Sbjct: 326 NGIADKNTIIDTGDGTMQIGGSRVRDTSKVGKADLTLILKKSSNIGVAKLALEMPLEALL 385

Query: 404 EFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +GL      +L       +P+  +W +    T+SFG+GL+ TP+Q A A A L N
Sbjct: 386 GMYSSVGLGEMSGLDLVGETIGIFPNRRRWSQFEIATLSFGYGLAITPIQLAHAYATLGN 445

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +   +      +R V+    V  +  +L      GG+  RA VPG+ +  K
Sbjct: 446 HGKYQPIHIIKGDQHG---ETRQVVDPKYVNQVLEMLETVTQPGGTATRAAVPGYRIAAK 502

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           +GT++K I   YSD   F     V P +DP+  ++  ++ P+    +    G    P+  
Sbjct: 503 SGTSRKAIAGGYSDE-YFAYTAGVAPVSDPRISLVVMVNEPQ---GDSYYGGAVAGPVFS 558

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L + P   +
Sbjct: 559 EIMKGALQILNIAPDENR 576


>gi|167577819|ref|ZP_02370693.1| penicillin-binding protein [Burkholderia thailandensis TXDOH]
          Length = 576

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 135/551 (24%), Positives = 242/551 (43%), Gaps = 35/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 10  RSKFIVILVFIAFGTLIARAFWVQIANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 69

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEK-LQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A  + T+ ++  P +V   DE+    L  +L ++    +RR+L+ +  F  L+R++ P+ 
Sbjct: 70  AVSLTTYEIWANPKQV---DEVAYAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPET 125

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
             RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  
Sbjct: 126 AARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQR 185

Query: 242 RVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +V     G            ++   I L +D RIQ + + +L       NA++   V+L+
Sbjct: 186 QVIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLD 245

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
              GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    +
Sbjct: 246 AQNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQ 305

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            + DT          +      +  +T+ +  + SSNI  A++A  +  +         G
Sbjct: 306 TIIDTSPGSYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYG 365

Query: 411 LLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +    E   P + +       +W+ I   T+++G+GLS + LQ A    A   +G + P 
Sbjct: 366 IGRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSASLLQIAQVYTAYAGDGTIHPV 425

Query: 469 TFMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTA 524
           + +  + +      +    V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA
Sbjct: 426 SLLKSNDDPHSADARRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTA 485

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++ 
Sbjct: 486 RKQVGAAYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMS 542

Query: 585 RSASMLGVKPV 595
            S  +LGV P 
Sbjct: 543 GSLQLLGVPPD 553


>gi|163868719|ref|YP_001609931.1| cell division protein/penicillin-binding protein [Bartonella
           tribocorum CIP 105476]
 gi|161018378|emb|CAK01936.1| Cell division protein/penicillin-binding protein [Bartonella
           tribocorum CIP 105476]
          Length = 580

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 253/532 (47%), Positives = 357/532 (67%), Gaps = 3/532 (0%)

Query: 70  SKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILAT 129
           S+ R+  ++   L++Y I+   +I YG    +            M+RPDI+DRNG +LAT
Sbjct: 31  SRPRLLFSLFCFLILYGIMGACLISYGVEGGQIEEARGPGVLPLMARPDIVDRNGRLLAT 90

Query: 130 DIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
           DI T+SL+ EP ++I  DE IE L  VLP+L+ +   ++L  +T F W++R L+P Q+ +
Sbjct: 91  DIKTYSLFAEPRRIIDVDETIELLSTVLPDLNWQETYKRLKRKTGFSWIQRGLTPMQKTQ 150

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG 249
           I++ G+PG+GFR E  RFYP     SH++G V++DN+GI G+EK++D  GL+ +      
Sbjct: 151 IMALGIPGIGFRTEIRRFYPDGPITSHILGMVNVDNQGIAGMEKYIDDTGLSALRAAGLA 210

Query: 250 -EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPH 308
            E++L+ + L++D+R+Q IVH EL++  K+Y A + G VILN+ TGEV+++ S+PD+DP 
Sbjct: 211 MEESLKQVHLSIDVRVQAIVHDELIQAMKRYKAIAAGAVILNIHTGEVLALASLPDFDPG 270

Query: 309 EAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD-TRNPIKVGKHVIH 367
              +  K    NR++ G FEMGSI K FT AM +DS +F +  + D ++       + IH
Sbjct: 271 NPIEALKSDRLNRMTAGTFEMGSIIKSFTTAMALDSNIFHLNSIIDASKPIKASSGYTIH 330

Query: 368 DYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSY 427
           D+H +NR LT+ E+F YSSNIG+A+ A A+GI  H++FL +LGLL +L TELPEI  P  
Sbjct: 331 DFHGKNRPLTLWEVFIYSSNIGSAKEALAIGIDKHRDFLQKLGLLDRLTTELPEIAHPIV 390

Query: 428 PSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLK 487
           P  WK IHS+TISFGHG++TTPLQTAV AAAL+N G LI PTF+ R++E++   ++ VL+
Sbjct: 391 PHHWKDIHSMTISFGHGMATTPLQTAVGAAALMNGGWLIAPTFLKRTKEQTLHHAKQVLQ 450

Query: 488 KNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPT 547
             T + MR L +     GSGR A V G+ VGGKTGTA+KV   +YS T NFNSFLA FP 
Sbjct: 451 AKTSQNMRYLYQLNSDIGSGRNAKVEGYRVGGKTGTAEKVENGKYSKTKNFNSFLAAFPI 510

Query: 548 TDPQYIVLSFMDSPKIKER-NQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            DP Y+VL+ +D PK +E  N  TAG+N  PM+ NI+RRSAS LGVKP F K
Sbjct: 511 DDPAYVVLTIIDEPKPEEGKNSATAGMNAGPMLANIVRRSASFLGVKPDFKK 562


>gi|83716466|ref|YP_439393.1| penicillin-binding protein [Burkholderia thailandensis E264]
 gi|167615945|ref|ZP_02384580.1| penicillin-binding protein [Burkholderia thailandensis Bt4]
 gi|257142516|ref|ZP_05590778.1| penicillin-binding protein [Burkholderia thailandensis E264]
 gi|83650291|gb|ABC34355.1| penicillin-binding protein [Burkholderia thailandensis E264]
          Length = 596

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 136/551 (24%), Positives = 242/551 (43%), Gaps = 35/551 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R    +++  + +  L  R              +         E G  R  I+DRNG +L
Sbjct: 30  RSKFIVILVFIAFGTLIARAFWVQIANQDFYVGQGQKRYQRTIELGAMRGSIVDRNGALL 89

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEK-LQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQ 186
           A  + T+ ++  P +V   DE+    L  +L ++    +RR+L+ +  F  L+R++ P+ 
Sbjct: 90  AVSLTTYEIWANPKQV---DEVAYAPLAKLL-DMPLAEVRRRLTGDRSFVLLKRQVDPET 145

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
             RI    + GV    +  RFYP    A+HVVG+ ++++RG  G+E   + +     G  
Sbjct: 146 AARIEKLDIDGVTQIADSKRFYPEGESAAHVVGFTNVEDRGQEGVELAANGRLSGTAGQR 205

Query: 242 RVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +V     G            ++   I L +D RIQ + + +L       NA++   V+L+
Sbjct: 206 QVIRDRLGRIVSDTGPLVPAQHGATIELTIDRRIQQLAYAQLKSTIIANNAQAGSVVVLD 265

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
              GE++++ + P +DP++  +   +   NR     FE GS  K   +A+ ID+G    +
Sbjct: 266 AQNGEILALANYPTFDPNDRARLTGQQLRNRAVIDTFEPGSTIKPVVVALSIDAGKVRPQ 325

Query: 351 DLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLG 410
            + DT          +      +  +T+ +  + SSNI  A++A  +  +         G
Sbjct: 326 TIIDTSPGSYKIGPNVIHDTSNHGAITVAQALQMSSNIALAKLALNLPAETIWNKYQEYG 385

Query: 411 LLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPP 468
           +    E   P + +       +W+ I   T+++G+GLS + LQ A    A   +G + P 
Sbjct: 386 IGRAPELTFPGVASGRLRPYKRWRPIEQATMAYGYGLSASLLQIAQVYTAYAGDGTIHPV 445

Query: 469 TFMIRSREE---SEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTA 524
           + +  S +      +    V    T   +RS+L   V  GG+GR A V G+ VGGKTGTA
Sbjct: 446 SLLKSSDDPHSADARRGHRVTTPATAAAIRSMLEMAVGQGGTGRAARVDGYRVGGKTGTA 505

Query: 525 QKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIR 584
           +K +   Y        F  + P ++P+ I+   +D P  +       G    P+  +++ 
Sbjct: 506 RKQVGAAYVKGKYRALFAGMAPMSNPRLIIAVMIDEPAARS---YYGGTVAGPVFSSVMS 562

Query: 585 RSASMLGVKPV 595
            S  +LGV P 
Sbjct: 563 GSLQLLGVPPD 573


>gi|15642404|ref|NP_232037.1| penicillin-binding protein 3 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121587640|ref|ZP_01677404.1| penicillin-binding protein 3 [Vibrio cholerae 2740-80]
 gi|121728356|ref|ZP_01681385.1| penicillin-binding protein 3 [Vibrio cholerae V52]
 gi|147674985|ref|YP_001217909.1| penicillin-binding protein 3 [Vibrio cholerae O395]
 gi|153214100|ref|ZP_01949234.1| penicillin-binding protein 3 [Vibrio cholerae 1587]
 gi|153818419|ref|ZP_01971086.1| penicillin-binding protein 3 [Vibrio cholerae NCTC 8457]
 gi|153822247|ref|ZP_01974914.1| penicillin-binding protein 3 [Vibrio cholerae B33]
 gi|153826871|ref|ZP_01979538.1| penicillin-binding protein 3 [Vibrio cholerae MZO-2]
 gi|153830354|ref|ZP_01983021.1| penicillin-binding protein 3 [Vibrio cholerae 623-39]
 gi|227082530|ref|YP_002811081.1| penicillin-binding protein 3 [Vibrio cholerae M66-2]
 gi|229507531|ref|ZP_04397036.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae BX 330286]
 gi|229512273|ref|ZP_04401752.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae B33]
 gi|229519409|ref|ZP_04408852.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae RC9]
 gi|229521238|ref|ZP_04410658.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae TM 11079-80]
 gi|229524393|ref|ZP_04413798.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae bv. albensis VL426]
 gi|229528606|ref|ZP_04417996.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae 12129(1)]
 gi|229607037|ref|YP_002877685.1| cell division protein FtsI (Peptidoglycan synthetase) [Vibrio
           cholerae MJ-1236]
 gi|254226625|ref|ZP_04920205.1| penicillin-binding protein 3 [Vibrio cholerae V51]
 gi|254291795|ref|ZP_04962580.1| penicillin-binding protein 3 [Vibrio cholerae AM-19226]
 gi|254849529|ref|ZP_05238879.1| penicillin-binding protein 3 [Vibrio cholerae MO10]
 gi|255746920|ref|ZP_05420865.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholera CIRS 101]
 gi|262161537|ref|ZP_06030647.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae INDRE 91/1]
 gi|262168388|ref|ZP_06036085.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae RC27]
 gi|298500233|ref|ZP_07010038.1| penicillin-binding protein 3 [Vibrio cholerae MAK 757]
 gi|9656980|gb|AAF95550.1| penicillin-binding protein 3 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121548150|gb|EAX58223.1| penicillin-binding protein 3 [Vibrio cholerae 2740-80]
 gi|121629347|gb|EAX61778.1| penicillin-binding protein 3 [Vibrio cholerae V52]
 gi|124115526|gb|EAY34346.1| penicillin-binding protein 3 [Vibrio cholerae 1587]
 gi|125620844|gb|EAZ49198.1| penicillin-binding protein 3 [Vibrio cholerae V51]
 gi|126511052|gb|EAZ73646.1| penicillin-binding protein 3 [Vibrio cholerae NCTC 8457]
 gi|126520257|gb|EAZ77480.1| penicillin-binding protein 3 [Vibrio cholerae B33]
 gi|146316868|gb|ABQ21407.1| penicillin-binding protein 3 [Vibrio cholerae O395]
 gi|148874161|gb|EDL72296.1| penicillin-binding protein 3 [Vibrio cholerae 623-39]
 gi|149739287|gb|EDM53543.1| penicillin-binding protein 3 [Vibrio cholerae MZO-2]
 gi|150422307|gb|EDN14269.1| penicillin-binding protein 3 [Vibrio cholerae AM-19226]
 gi|227010418|gb|ACP06630.1| penicillin-binding protein 3 [Vibrio cholerae M66-2]
 gi|227014301|gb|ACP10511.1| penicillin-binding protein 3 [Vibrio cholerae O395]
 gi|229332380|gb|EEN97866.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae 12129(1)]
 gi|229337974|gb|EEO02991.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae bv. albensis VL426]
 gi|229341770|gb|EEO06772.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae TM 11079-80]
 gi|229344098|gb|EEO09073.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae RC9]
 gi|229352238|gb|EEO17179.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae B33]
 gi|229355036|gb|EEO19957.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae BX 330286]
 gi|229369692|gb|ACQ60115.1| cell division protein FtsI (Peptidoglycan synthetase) [Vibrio
           cholerae MJ-1236]
 gi|254845234|gb|EET23648.1| penicillin-binding protein 3 [Vibrio cholerae MO10]
 gi|255735322|gb|EET90722.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholera CIRS 101]
 gi|262023280|gb|EEY41984.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae RC27]
 gi|262028848|gb|EEY47502.1| cell division protein FtsI [Peptidoglycan synthetase] [Vibrio
           cholerae INDRE 91/1]
 gi|297540926|gb|EFH76980.1| penicillin-binding protein 3 [Vibrio cholerae MAK 757]
 gi|327484903|gb|AEA79310.1| Cell division protein FtsI (Peptidoglycan synthetase) [Vibrio
           cholerae LMA3894-4]
          Length = 580

 Score =  373 bits (958), Expect = e-101,   Method: Composition-based stats.
 Identities = 145/558 (25%), Positives = 248/558 (44%), Gaps = 38/558 (6%)

Query: 71  KNRIGMTIVVCLVIYIILAIRIIQYGNIHP-----EPIAPSMNIDEYGMSRPDIIDRNGE 125
           + R  + +   L  +  L  R+     I P     E    S+       +R  I DRNGE
Sbjct: 27  RWRFYLLLFFVLTAFCALVARVAYIQIIEPDNLIKEGDLRSIRAKTLQSARGIISDRNGE 86

Query: 126 ILATDIPTFSLYVEPHKVISPDEIIEK-----LQIVLPNLDSEMIRRKL--SSETKFQWL 178
            LA  +P  +++ +P  +     ++EK     L  VL  LD + + +K+  +   +F +L
Sbjct: 87  ALAVSVPVEAVWADPVAIYKEGGLVEKDRWYALADVL-GLDRQEMMKKIEDNRSRRFIYL 145

Query: 179 RRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-- 236
           +R++SP   K I    L G+G + E  R+YPA   ++H+VG   ID  G+ G+E+  D  
Sbjct: 146 QRQVSPAMAKYIRELKLAGIGLKEESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSFDST 205

Query: 237 ---MQGLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAES 283
                G +       G           +  +PI+L +D R+Q I  + + +    Y A S
Sbjct: 206 LTGESGKSVTRKDKFGRVVENIALEEREEGKPIQLTIDQRLQAIAFRAVKQAMADYRATS 265

Query: 284 VGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGID 343
              V+L+V TG V++MV+ P Y+P+     +     NR+    FE GS  K F +   + 
Sbjct: 266 ASAVMLDVKTGAVLAMVNAPSYNPNNRNDWQSFKMRNRVITDAFEPGSTVKPFVVLAALA 325

Query: 344 SGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHK 403
           +G+     + DT +              +     +  I + SSNIG A++A  M ++   
Sbjct: 326 NGIADKNTIIDTGDGTMQIGGSRVRDTSKVGKADLTLILKKSSNIGVAKLALEMPLEALL 385

Query: 404 EFLYRLGLLSKLETELPEIQAPSYPS--QWKRIHSLTISFGHGLSTTPLQTAVAAAALIN 461
                +GL      +L       +P+  +W +    T+SFG+GL+ TP+Q A A A L N
Sbjct: 386 GMYSSVGLGEMSGLDLVGETIGIFPNRRRWSQFEIATLSFGYGLAITPIQLAHAYATLGN 445

Query: 462 EGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGK 520
            G+  P   +   +      +R V+    V  +  +L      GG+  RA VPG+ +  K
Sbjct: 446 HGKYQPIHIIKGDQHG---ETRQVVDPKYVNQVLEMLETVTQPGGTATRAAVPGYRIAAK 502

Query: 521 TGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVG 580
           +GT++K I   YSD   F     V P +DP+  ++  ++ P+    +    G    P+  
Sbjct: 503 SGTSRKAIAGGYSDE-YFAYTAGVAPVSDPRISLVVMVNEPQ---GDSYYGGAVAGPVFS 558

Query: 581 NIIRRSASMLGVKPVFLK 598
            I++ +  +L + P   +
Sbjct: 559 EIMKGALQILNIAPDENR 576


>gi|254524907|ref|ZP_05136962.1| penicillin-binding protein 3 [Stenotrophomonas sp. SKA14]
 gi|219722498|gb|EED41023.1| penicillin-binding protein 3 [Stenotrophomonas sp. SKA14]
          Length = 614

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 155/556 (27%), Positives = 263/556 (47%), Gaps = 33/556 (5%)

Query: 63  RRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRP 117
           R +   + + R+    +   +  + L  R              +  A  +       SR 
Sbjct: 8   RPRNAFNLRQRLRWVALALGLCSVSLVGRAAYVQIINSDFYQRQGEARYLRELPIKTSRG 67

Query: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKL--SSETKF 175
            I DRNGE LA   P  S++V P  ++   E I +L   +  +  + +  +L   S+ +F
Sbjct: 68  MITDRNGEPLAVSTPVASIWVNPQDLLRSPERIPELAQAV-GMSVDELSSRLSQKSDKEF 126

Query: 176 QWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFL 235
            +LRR+++P + +++++  +PGV  + E  RFYP     +HV+G+ +ID+RG  G+E   
Sbjct: 127 MYLRRRINPDEAEKVVALKIPGVAAQREFRRFYPQGEAMAHVLGFTNIDDRGQEGLELAF 186

Query: 236 DMQ-----GLTRVFTTNKGE----------KNLQPIRLALDLRIQNIVHQELVENKKKYN 280
           D       G  RV    KGE          +  + + L++D RIQ +  +EL        
Sbjct: 187 DEWLRGKAGAKRVIRNRKGETVESDLLRAAEPGKDLTLSIDRRIQYLAFKELRNALVANK 246

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAM 340
           A     VI++V+TGE+++MV++P Y+P+       +   NR    + E GS  K  TIA 
Sbjct: 247 AAGGSMVIMDVTTGEILAMVNLPTYNPNSLTGALPDARRNRAVTDLVEPGSTMKPLTIAT 306

Query: 341 GIDSGLFTVKDLFD-TRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGI 399
            + +G  T   + D     + +G+  I D    N +L +  +   SSN+GAA++A  M  
Sbjct: 307 ALQAGAVTKDTIIDTNPGYMTLGRFTIRDVPRNNGVLNVTGVITRSSNVGAAKVAAKMPD 366

Query: 400 QGHKEFLYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAA 457
           Q   + + R G  S   +  P         P++W      T+S+G+GL+ TPLQ A A +
Sbjct: 367 QVFYDGVRRFGYGSVPHSGFPGESGGVVLRPARWSGTTKTTMSYGYGLNVTPLQIATAYS 426

Query: 458 ALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           AL N GRLI PTF+   R E     + ++ +N  K + +++   VT G  ++A V G+ V
Sbjct: 427 ALANGGRLIAPTFVKGQRNE----GQQIIDENVAKQVVAMMETVVTQGGAKQAAVLGYRV 482

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
            GKTGTA+K     Y        F  V P T+P++  +  ++ P+     +   G+  AP
Sbjct: 483 AGKTGTARKAGPGGYERGHYNALFAGVVPATNPRFATVIVINDPQA---GKFYGGLVSAP 539

Query: 578 MVGNIIRRSASMLGVK 593
           +  N++  +  ++ V 
Sbjct: 540 VYHNVMEGTLRLMDVP 555


>gi|323706126|ref|ZP_08117695.1| stage V sporulation protein D [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323534570|gb|EGB24352.1| stage V sporulation protein D [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 678

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 129/558 (23%), Positives = 237/558 (42%), Gaps = 48/558 (8%)

Query: 77  TIVVCLVIYIILAIRIIQYGNIHPEPIA-----PSMNIDEYGMSRPDIIDRNGEILATDI 131
            +   ++I  +L +R+     +  +                   R  I+DRNG+ LA   
Sbjct: 1   MLFFSILIISVLIVRLFWIQIVKSDEFQKLAIPQWTLDVAVTPKRGLILDRNGKALAESA 60

Query: 132 PTFSLYVEPHKVIS--PDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKR 189
            +  + + P +V     DEI  KL  +L     +++++  +   +   + R++      +
Sbjct: 61  SSNKVSIIPKEVKDSQKDEIASKLSEILKIDKEDILKKINNKNVQEVLIARRIDDDTANK 120

Query: 190 ILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGLTRVF 244
           I    LP +    +  R+YP  + ASH++G+  +DN+G+ GIE   D       G     
Sbjct: 121 IRKLNLPCIVISGDTKRYYPEKNLASHILGFTGVDNQGLDGIESVYDSYLRGIPGRISSP 180

Query: 245 TTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYNA-ESVGTVILNV 291
               G K            +   + L +D  IQ+   + L +        +    ++++ 
Sbjct: 181 VDALGRKMGNGEEEYIPPIDGYNVVLTIDSNIQHFAEKALDDAYAHTKPTKGAVAIVMDP 240

Query: 292 STGEVISMVSIPDYDPHEAFKG----KKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLF 347
            TG++++M S PDYDP+  F G      + W ++     +E GS+FK  T +  ++ G+ 
Sbjct: 241 KTGDILAMASRPDYDPNNPFAGSKSDWFKNWRDKAISDAYEPGSVFKTVTASAALEEGVV 300

Query: 348 TVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLY 407
            + + F     I V    I+ +       T  +  + S N+  A +A  +G+    ++++
Sbjct: 301 GLNEQFYDPGYIMVAGQRINCWATHYSE-TFVQGVQNSCNVVFATVAQRLGVDKLYKYIH 359

Query: 408 RLGLLSKLETELPEIQAPSYPSQWK--RIHSLTISFGHGLSTTPLQTAVAAAALINEGRL 465
             G        LP         +     +   T SFG G++ TPLQ   A +A++N G+L
Sbjct: 360 EFGFGETTGITLPGEAPGLVMKEKDVGPVELATNSFGQGIAVTPLQMIRAVSAIVNGGKL 419

Query: 466 IPPTFMIRSREESEK--------VSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEV 517
           + P  +    +   K        V R V+ + T  TMR +L   V+ G+G+  ++ G++V
Sbjct: 420 MEPHIVKEIVDSDGKPIKEFKPTVIRQVISEKTSATMRQILESVVSEGTGKAGYIEGYDV 479

Query: 518 GGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAP 577
           GGKTGT +K     Y+      S++   P  DP+ I L  +D P  +            P
Sbjct: 480 GGKTGTTEK-----YTPGKYVASYVGFAPAEDPKVIALVVIDEPNAET---HFGSALAGP 531

Query: 578 MVGNIIRRSASMLGVKPV 595
           +V +I+  + + L VKP 
Sbjct: 532 VVRSILYDTLTYLNVKPK 549


>gi|32345766|gb|AAM97177.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/559 (27%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A   
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARTY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + V+K +T K +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPKGKRVIKASTAKKVRELMVSVTEAGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|37651046|emb|CAD70590.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 148/559 (26%), Positives = 258/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+ D RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSFDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|37651036|emb|CAD70585.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 257/559 (45%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  I
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTI 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  ++++ KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTKSLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLKNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  S  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFAFEKELKRHYPMGSLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++    
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPAPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFS 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +  + LG+  ++ +  P   A        W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 SEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|319899163|ref|YP_004159256.1| Cell division protein/penicillin-binding protein [Bartonella
           clarridgeiae 73]
 gi|319403127|emb|CBI76685.1| Cell division protein/penicillin-binding protein [Bartonella
           clarridgeiae 73]
          Length = 559

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 253/529 (47%), Positives = 355/529 (67%), Gaps = 3/529 (0%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIP 132
           R+  +++  L +Y ++   +I YG    +       I     SRPDI+DRNG +LA DI 
Sbjct: 10  RLIFSLLCFLFLYGLIGGCLISYGLKGGQIEEAKGPIIVQLASRPDIVDRNGRLLAKDIT 69

Query: 133 TFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQQQKRILS 192
           T+SL+ EP ++I  DE IE +  VLP L+ + + ++L   + F W++R L+P Q+ +I+ 
Sbjct: 70  TYSLFAEPRRIIDVDETIELISTVLPKLNWQEVYKRLKRNSGFSWIQRGLTPTQKAQIME 129

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQGLTRVFTTNKG-EK 251
            G+PG+GFR E  RFYP  S ASH++G V++DN+G+ G+EK++D  GL+ +  T    E+
Sbjct: 130 LGIPGIGFRTEIRRFYPGGSIASHILGMVNVDNQGLAGMEKYIDDNGLSILRATGLATEE 189

Query: 252 NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAF 311
           +L+P++L++D+R+Q IVH EL+E  K+Y A + G VILN+ T EV++MVS+PD+ P    
Sbjct: 190 SLRPVQLSIDVRVQAIVHDELMEAMKRYKAIAAGAVILNIHTSEVLAMVSVPDFSPANPV 249

Query: 312 KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFD-TRNPIKVGKHVIHDYH 370
              K   FNRI+ G FEMGSI K FT AM +DSGLF +  + D ++       H I D+H
Sbjct: 250 DALKNNHFNRITAGTFEMGSIIKSFTTAMALDSGLFHLNSIIDASQPIQATRNHFIRDFH 309

Query: 371 PQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ 430
            +NR LT+ E+F YSSNIG+A+ A A+G+  H+ FL RLGLL ++ TELPE+  P YP  
Sbjct: 310 ARNRPLTLWEVFIYSSNIGSAKEALAIGVDKHRNFLKRLGLLDRMLTELPEVAQPIYPHY 369

Query: 431 WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNT 490
           WK I+S+TISFGHG++TTPLQTAVAAAAL+N G LI PTF+ RS+EE+ K ++ VL   T
Sbjct: 370 WKDINSMTISFGHGIATTPLQTAVAAAALMNGGLLIDPTFLKRSKEEALKHAKQVLHPQT 429

Query: 491 VKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDP 550
            + MR L +     GSGR A V G+ +GGKTGT++KV   +YS   NFNSFLA FP  +P
Sbjct: 430 SQDMRYLYKLNSDIGSGRNAKVVGYRIGGKTGTSEKVENGKYSKEKNFNSFLAAFPIDNP 489

Query: 551 QYIVLSFMDSPKI-KERNQLTAGINVAPMVGNIIRRSASMLGVKPVFLK 598
            YIVL+ +D PK   E++  TA +N AP++ NIIRRSA  LGV+P F K
Sbjct: 490 SYIVLTIIDEPKPENEKHSATAAMNAAPVLANIIRRSAIFLGVEPDFKK 538


>gi|194099357|ref|YP_002002457.1| penicillin-binding protein 2 [Neisseria gonorrhoeae NCCP11945]
 gi|38564793|gb|AAR23827.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
 gi|193934647|gb|ACF30471.1| penicillin-binding protein 2 [Neisseria gonorrhoeae NCCP11945]
 gi|283379454|dbj|BAI66136.1| penicillin-binding protein 2 [Neisseria gonorrhoeae]
          Length = 583

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 151/559 (27%), Positives = 261/559 (46%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P  +         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKF-- 234
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E    
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 235 ---LDMQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+        V  D H     L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKIGPSPVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFG 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 437 TALTHDGVLLPLSF---EKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     +    G+  
Sbjct: 494 DVGAKTGTARKLVNGRYVDNKHVGTFIGFAPAKNPRVIVAVTIDEPTA---HSYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 551 GPPFKKIMGGSLNILGVSP 569


>gi|255656633|ref|ZP_05402042.1| stage V sporulation protein D (sporulation specific
           penicillin-binding protein) [Clostridium difficile
           QCD-23m63]
 gi|296449911|ref|ZP_06891675.1| cell division protein FtsI/penicillin-binding protein [Clostridium
           difficile NAP08]
 gi|296878292|ref|ZP_06902301.1| cell division protein FtsI/penicillin-binding protein [Clostridium
           difficile NAP07]
 gi|296261181|gb|EFH08012.1| cell division protein FtsI/penicillin-binding protein [Clostridium
           difficile NAP08]
 gi|296430740|gb|EFH16578.1| cell division protein FtsI/penicillin-binding protein [Clostridium
           difficile NAP07]
          Length = 659

 Score =  373 bits (957), Expect = e-101,   Method: Composition-based stats.
 Identities = 143/586 (24%), Positives = 249/586 (42%), Gaps = 59/586 (10%)

Query: 64  RKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGN-----IHPEPIAPSMNIDEYGMSRPD 118
           RKV   SK R+ + +++   ++  L IR           +  + +            R  
Sbjct: 2   RKVKRISKKRLVLVLILACALFFCLVIRTGYLQLMKGNWLSTKALEQQTRDIPIEPKRGT 61

Query: 119 IIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSET-KFQW 177
           I DRN + LA  +  ++++ +P +V    E  EK+  +L   D + I   +S +      
Sbjct: 62  IYDRNMKELAVSVTKYTVWCKPVEVEDKKEAAEKVAEILDE-DYKDIYALISKKNMALVK 120

Query: 178 LRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM 237
           ++R +   +  +I    L G+    +  R+YP  + A +V+G+   D  GI+GIE   D 
Sbjct: 121 VKRWIDDDKASKIRDAKLSGIWVAEDNQRYYPYGNFAPYVLGHTSSDATGISGIEMQYDK 180

Query: 238 QGLTR-----VFTTNKGEK------------NLQPIRLALDLRIQNIVHQELVENKKKYN 280
           +   +     V T   G +                + L++D  IQ+   + + +  +  N
Sbjct: 181 KLKGKPGKLIVSTDASGREIPQGMEKYYEPVQGNGLVLSIDEVIQHYTEKAVQKAYELNN 240

Query: 281 AESVGTVILNVSTGEVISMVSIPDYDPH--------------------EAFKGKKEGWFN 320
           A+ V  + +N  TG+++++ S PDYDP+                    +  KG  + W N
Sbjct: 241 AKKVTAIAMNPKTGDILALASKPDYDPNDSRTPIYPYYQEELEKYNDKDKIKGYYQMWRN 300

Query: 321 RISYGIFEMGSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQ--NRILTI 378
                 +E GS FK+ T +  ++ G+    + F     + VG   I  +     +     
Sbjct: 301 PAVSDTYEPGSTFKLITSSSALEEGVIKDGEKFTCTGSVTVGGRKIKCWRHYRPHGTQEF 360

Query: 379 PEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWK--RIHS 436
            +  + S N    ++   +G+    +++   GL+ K   +LP        ++     +  
Sbjct: 361 KQAVQNSCNPVFVELGSRLGVGKMYDYIESFGLMDKTGIDLPGEAKGILYNEKNVGPVEL 420

Query: 437 LTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIRSREE--------SEKVSRIVLKK 488
            TISFG  +S TP+Q   A +++ N G L+ P  +    +           K  R V+ K
Sbjct: 421 ATISFGQSISVTPIQLITAISSIANGGDLMQPRVVKSYTDNKGNITETVKPKKVRSVISK 480

Query: 489 NTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTT 548
            T K M  +    VT G G+ A++PG+ +GGKTGTAQKVI  +Y+      SF+ + P  
Sbjct: 481 ETSKKMLEIAESVVTEGGGKIAYIPGYRLGGKTGTAQKVIDGKYAPGKYICSFVGIAPCD 540

Query: 549 DPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASMLGVKP 594
           DPQ +VL+ +D P               P+V  I+  S   LGVKP
Sbjct: 541 DPQIVVLAIVDEPTGVS---AFGSTTAGPIVKEIMNDSLKYLGVKP 583


>gi|32345844|gb|AAM97216.1| PenA [Neisseria meningitidis]
          Length = 581

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/559 (26%), Positives = 260/559 (46%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++   G
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFG 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +F + LG+  ++ +  P   A    +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 AEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K++T + +R+L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P    I+  S ++LGV P
Sbjct: 550 GPPFKKIMGGSLNILGVSP 568


>gi|294677902|ref|YP_003578517.1| peptidoglycan synthetase FtsI [Rhodobacter capsulatus SB 1003]
 gi|294476722|gb|ADE86110.1| peptidoglycan synthetase FtsI [Rhodobacter capsulatus SB 1003]
          Length = 599

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 170/554 (30%), Positives = 277/554 (50%), Gaps = 29/554 (5%)

Query: 60  QKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDI 119
           +  R    A    RIG+ I +  V +  + +R+       PE    +         R DI
Sbjct: 36  EAGREAARARVAWRIGLVIGIFCVCFGAVGVRMGTLAASTPEEPQRADTAPAILAQRADI 95

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLR 179
            DR G +LAT++ T +LY +P  ++ P    +KL  + P+LD++ +    +   KF W++
Sbjct: 96  TDREGRVLATNLVTHALYAQPPMMVDPVGTAKKLAKIFPDLDAKRLAADFTGTRKFVWIK 155

Query: 180 RKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGI--------TGI 231
           +K+SP+Q +++   G PG+ F   + R YP    A+HV+G     N G+         G+
Sbjct: 156 KKISPEQLQQVHDIGEPGLLFGPREMRLYPNGRLAAHVLGGARFGNEGVDSAEIIGTAGV 215

Query: 232 EKFLDMQGLTRVFTTNKGEKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNV 291
           EK  D               N  P++L++DL +Q  V + L    K  NA+    V+++ 
Sbjct: 216 EKAFDGWL-------RDPANNGAPLKLSIDLTVQQAVEEILAGGMKLMNAKGATAVVMDA 268

Query: 292 STGEVISMVSIPDYDPHEAF------KGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSG 345
            +GE++++ S+PD+DP++               FNR   G++E+GS FK+F +A  ++ G
Sbjct: 269 HSGEIVALASLPDFDPNDRPTPLVKGDASDSPLFNRAVQGVYELGSTFKIFAVAQALELG 328

Query: 346 LFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEF 405
           L     + DT++P+  G+  I D+H     L+I +I   SSN+G A+IA  +G Q  K F
Sbjct: 329 LVNPTTMLDTKSPMVWGRFRIRDFHNYGPALSITDIVVESSNVGTARIALLIGGQRQKAF 388

Query: 406 LYRLGLLSKLETELPEIQAP--SYPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEG 463
           L  LG ++    EL E  +     P +W  I S+T+ +GHGL+ +PL  A A A + N G
Sbjct: 389 LESLGFMAPTPVELSEAPSGRPIVPGKWSEITSMTVGYGHGLAASPLHLAAAYATIANGG 448

Query: 464 RLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGRRAFVPGFEVGGKTGT 523
             + PT +  +  E       V+     +   +++R  VT G+   A V G+EV GKTGT
Sbjct: 449 YRVKPTLVHAATHERGP---QVMSTEAARKSLAMMRAVVTRGTASFADVKGYEVAGKTGT 505

Query: 524 AQKV-IKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKI--KERNQLTAGINVAPMVG 580
           A KV     Y D     +F + FP +DP+Y+++  +D P        + TAG    P+  
Sbjct: 506 ADKVKPGGGYYDNKVIATFASAFPASDPKYVLVLTLDEPSSFAANETRRTAGWTAVPVAA 565

Query: 581 NIIRRSASMLGVKP 594
            +IRR A +LG++P
Sbjct: 566 EVIRRIAPILGLRP 579


>gi|37651034|emb|CAD70584.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 582

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 256/559 (45%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++    
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPAQVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFS 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +  + LG+  ++ +  P   A        W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 SEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|32345874|gb|AAM97231.1| PenA [Neisseria meningitidis]
          Length = 582

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 256/559 (45%), Gaps = 38/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                  G   V    +G              KN + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPKNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+G   + +  +T+                   L +  I + SSN+G ++++    
Sbjct: 318 AKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFS 375

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +  + LG+  ++ +  P   A        W+ I   T+SFG+GL  + LQ A A 
Sbjct: 376 SEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQLSLLQLARAY 435

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
            AL ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 436 TALTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 492

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 493 DVGAKTGTARKLVNGRYVDYKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVT 549

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 550 GPVFKQVMGGSLNILGVSP 568


>gi|167912658|ref|ZP_02499749.1| penicillin-binding protein [Burkholderia pseudomallei 112]
          Length = 613

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/548 (25%), Positives = 249/548 (45%), Gaps = 31/548 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +  + ++ LA+R              +  +      E   +R  I+DRNG +L
Sbjct: 27  RSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVL 86

Query: 128 ATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V      + ++ L  +L  + ++ ++ KLS +  F +++R++   
Sbjct: 87  ATSLPVRAIWAIPADVPDDLGADKLDALGKLL-GMTTKELKAKLSEDKTFVYVKRQVPLD 145

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGL 240
             +++    +PGV  R E  RFYP     +H++G+ ++++ G  G+E           G 
Sbjct: 146 VAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGFTNVEDEGQEGVELADQKLLVGTPGS 205

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G             N   + L++D +IQ I +  L    +K++A++   +++
Sbjct: 206 RHVIKDRVGHIVEDVDAQVPPHNGADVGLSIDSKIQYITYTNLKAAVEKFHAKAGAAMVI 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+S+V+ P Y+P++      E   NR+   +FE GSI K FT+++ +D    T 
Sbjct: 266 DVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLTDVFEPGSIMKPFTVSLALDLHRVTP 325

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             L +T N   V              LT+  + + SSNIGA +IA  M  +        +
Sbjct: 326 NTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQKSSNIGATKIAMTMKPEEMWNMYTGI 385

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+RI   T+S+G+GLS +  Q A A  A+ ++G L+P
Sbjct: 386 GLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYGYGLSVSLFQLARAYTAIAHDGELMP 445

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            T    + +        V    T + +R++L   V+  G+   A VPG+ VGGK+GTA K
Sbjct: 446 VTIFKTN-DAQPPTGPRVFSPTTAREVRTMLESVVSPQGTSPNAAVPGYRVGGKSGTAYK 504

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            + + Y       SF+ + P  +P+ +V   +D P          G    P+   I+  +
Sbjct: 505 QVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPTT---GGHFGGQVSGPVFSAIVGDT 561

Query: 587 ASMLGVKP 594
              L V P
Sbjct: 562 LRALNVPP 569


>gi|104783459|ref|YP_609957.1| penicillin-binding protein [Pseudomonas entomophila L48]
 gi|95112446|emb|CAK17173.1| penicillin-binding protein [Pseudomonas entomophila L48]
          Length = 577

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/552 (25%), Positives = 267/552 (48%), Gaps = 33/552 (5%)

Query: 71  KNRIGM---TIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           + R+ +    ++V  + + I+ ++++    +  +  A S+        R  I DRNGE L
Sbjct: 12  RFRVVVGLLALMVGAICWRIIDLQVVDRDFLKGQGDARSLRHIPIPAHRGLITDRNGEPL 71

Query: 128 ATDIPTFSLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSETK-FQWLRRKLSPQQ 186
           A   P  +L+  P ++    +   +L   L     ++I R     +K F +L R L+P+Q
Sbjct: 72  AVSTPVTTLWANPKEMQVAKDRWPQLAAALGQNPQQLIERLTQQASKEFIYLVRGLTPEQ 131

Query: 187 QKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLT 241
            +++L   +PGV    E  RFYPA    +H+VG+ D+D+ G  G+E   D       G  
Sbjct: 132 GQQVLDLKVPGVYGLEEFRRFYPAGDVTAHMVGFTDLDDHGREGVELAYDEWLAGVPGKR 191

Query: 242 RVFTTNKGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILN 290
           +V    +G            K  + + L++DLR+Q +  +EL     + +A++   VI++
Sbjct: 192 QVIKDRRGRLIKDIQVTKNAKAGKTLALSIDLRLQYLATRELRNAIAEQDAKAGSLVIMD 251

Query: 291 VSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVK 350
           V TGEV++MV+ P Y+P+           NR    +FE GS  K  +++  + SG +   
Sbjct: 252 VKTGEVLAMVNQPTYNPNNRRSMFPAAMRNRAIIDVFEPGSTVKPISMSAALQSGRWKPT 311

Query: 351 D-LFDTRNPIKVGKHVIHDYHPQNRIL-TIPEIFRYSSNIGAAQIADAMGIQGHKEFLYR 408
           D +      +++G++ I D       +  +  I   SSN+G ++IA  +G +     + +
Sbjct: 312 DKVEVYPGSLQIGRYTIKDVSKSEGPILDLTGILINSSNVGMSKIAFDIGGEAIYRVMSQ 371

Query: 409 LGLLSKLETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLI 466
           +GL        P  +  +     +W++  + T+S+G+G+S T LQ   A AAL N+G+++
Sbjct: 372 VGLGQYTGLGFPGERVGNLPNHREWRKAETATLSYGYGVSVTALQLVHAYAALANDGKMV 431

Query: 467 PPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVTGGSGR-RAFVPGFEVGGKTGTAQ 525
           P + +     +    +   + K T +T++++L++ +    G  RA VP + V GK+GTA+
Sbjct: 432 PLSILKV---DKAPEAVQAIPKETAETVQAMLQQVIEAPRGVFRAQVPFYHVAGKSGTAR 488

Query: 526 K--VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNII 583
           K  V  K Y++    + F    P +DP+Y ++  +D P    +     G+  AP+   ++
Sbjct: 489 KATVGSKGYTENAYRSLFAGFGPMSDPRYAIVVVIDEP---GKGGYFGGLVSAPVFSKVM 545

Query: 584 RRSASMLGVKPV 595
             +  ++ V P 
Sbjct: 546 SGTLRLMNVPPD 557


>gi|254178937|ref|ZP_04885591.1| penicillin-binding protein [Burkholderia mallei ATCC 10399]
 gi|160694851|gb|EDP84859.1| penicillin-binding protein [Burkholderia mallei ATCC 10399]
          Length = 614

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/548 (25%), Positives = 250/548 (45%), Gaps = 31/548 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +  + ++ LA+R              +  +      E   +R  I+DRNG +L
Sbjct: 27  RSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVL 86

Query: 128 ATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V      + ++ L  +L  + ++ ++ KLS +  F +++R++   
Sbjct: 87  ATSLPVRAIWAIPADVPDDLGADKLDALGKLL-GMTTKELKAKLSEDKTFVYVKRQVPLD 145

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGL 240
             +++    +PGV  R E  RFYP     +H++G+ ++++ G  G+E           G 
Sbjct: 146 VAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGFTNVEDEGQEGVELADQKLLVGTPGS 205

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G             N   + L++D +IQ+I +  L    +K++A++   +++
Sbjct: 206 RHVIKDRVGHIVEDVDAQVPPHNGADVGLSIDSKIQDITYTNLKAAVEKFHAKAGAAMVI 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+S+V+ P Y+P++      E   NR+   +FE GSI K FT+++ +D    T 
Sbjct: 266 DVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLTDVFEPGSIMKPFTVSLALDLHRVTP 325

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             L +T N   V              LT+  + + SSNIGA +IA  M  +        +
Sbjct: 326 NTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQKSSNIGATKIAMTMKPEEMWNMYTGI 385

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+RI   T+S+G+GLS +  Q A A  A+ ++G L+P
Sbjct: 386 GLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYGYGLSVSLFQLARAYTAIAHDGELMP 445

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            T    + +        V    T + +R++L   V+  G+   A VPG+ VGGK+GTA K
Sbjct: 446 VTIFKTN-DAQPPTGPRVFSPTTAREVRTMLESVVSPQGTSPNAAVPGYRVGGKSGTAYK 504

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            + + Y       SF+ + P  +P+ +V   +D P          G    P+   I+  +
Sbjct: 505 QVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPTT---GGHFGGQVSGPVFSAIVGDT 561

Query: 587 ASMLGVKP 594
              L V P
Sbjct: 562 LRALNVPP 569


>gi|53726026|ref|YP_104100.1| penicillin-binding protein [Burkholderia mallei ATCC 23344]
 gi|67643635|ref|ZP_00442380.1| penicillin-binding protein [Burkholderia mallei GB8 horse 4]
 gi|76811653|ref|YP_334921.1| penicillin-binding protein [Burkholderia pseudomallei 1710b]
 gi|121599625|ref|YP_991827.1| penicillin-binding protein [Burkholderia mallei SAVP1]
 gi|124385619|ref|YP_001027320.1| penicillin-binding protein [Burkholderia mallei NCTC 10229]
 gi|126450569|ref|YP_001082743.1| penicillin-binding protein [Burkholderia mallei NCTC 10247]
 gi|126453513|ref|YP_001067792.1| penicillin-binding protein [Burkholderia pseudomallei 1106a]
 gi|134280170|ref|ZP_01766881.1| penicillin-binding protein [Burkholderia pseudomallei 305]
 gi|166998643|ref|ZP_02264501.1| penicillin-binding protein [Burkholderia mallei PRL-20]
 gi|167721349|ref|ZP_02404585.1| penicillin-binding protein [Burkholderia pseudomallei DM98]
 gi|167740318|ref|ZP_02413092.1| penicillin-binding protein [Burkholderia pseudomallei 14]
 gi|167825936|ref|ZP_02457407.1| penicillin-binding protein [Burkholderia pseudomallei 9]
 gi|167847422|ref|ZP_02472930.1| penicillin-binding protein [Burkholderia pseudomallei B7210]
 gi|167904397|ref|ZP_02491602.1| penicillin-binding protein [Burkholderia pseudomallei NCTC 13177]
 gi|167920625|ref|ZP_02507716.1| penicillin-binding protein [Burkholderia pseudomallei BCC215]
 gi|226199617|ref|ZP_03795173.1| penicillin-binding protein [Burkholderia pseudomallei Pakistan 9]
 gi|237813925|ref|YP_002898376.1| penicillin-binding protein [Burkholderia pseudomallei MSHR346]
 gi|242316104|ref|ZP_04815120.1| penicillin-binding protein [Burkholderia pseudomallei 1106b]
 gi|254180540|ref|ZP_04887138.1| penicillin-binding protein [Burkholderia pseudomallei 1655]
 gi|254199142|ref|ZP_04905557.1| penicillin-binding protein [Burkholderia pseudomallei S13]
 gi|254202821|ref|ZP_04909184.1| penicillin-binding protein [Burkholderia mallei FMH]
 gi|254208163|ref|ZP_04914513.1| penicillin-binding protein [Burkholderia mallei JHU]
 gi|254261979|ref|ZP_04953033.1| penicillin-binding protein [Burkholderia pseudomallei 1710a]
 gi|254357633|ref|ZP_04973907.1| penicillin-binding protein [Burkholderia mallei 2002721280]
 gi|52429449|gb|AAU50042.1| penicillin-binding protein [Burkholderia mallei ATCC 23344]
 gi|76581106|gb|ABA50581.1| penicillin-binding protein [Burkholderia pseudomallei 1710b]
 gi|121228435|gb|ABM50953.1| penicillin-binding protein [Burkholderia mallei SAVP1]
 gi|124293639|gb|ABN02908.1| penicillin-binding protein [Burkholderia mallei NCTC 10229]
 gi|126227155|gb|ABN90695.1| penicillin-binding protein [Burkholderia pseudomallei 1106a]
 gi|126243439|gb|ABO06532.1| penicillin-binding protein [Burkholderia mallei NCTC 10247]
 gi|134248177|gb|EBA48260.1| penicillin-binding protein [Burkholderia pseudomallei 305]
 gi|147747068|gb|EDK54145.1| penicillin-binding protein [Burkholderia mallei FMH]
 gi|147752057|gb|EDK59124.1| penicillin-binding protein [Burkholderia mallei JHU]
 gi|148026697|gb|EDK84782.1| penicillin-binding protein [Burkholderia mallei 2002721280]
 gi|169656972|gb|EDS88369.1| penicillin-binding protein [Burkholderia pseudomallei S13]
 gi|184211079|gb|EDU08122.1| penicillin-binding protein [Burkholderia pseudomallei 1655]
 gi|225928363|gb|EEH24394.1| penicillin-binding protein [Burkholderia pseudomallei Pakistan 9]
 gi|237505154|gb|ACQ97472.1| penicillin-binding protein [Burkholderia pseudomallei MSHR346]
 gi|238525014|gb|EEP88444.1| penicillin-binding protein [Burkholderia mallei GB8 horse 4]
 gi|242139343|gb|EES25745.1| penicillin-binding protein [Burkholderia pseudomallei 1106b]
 gi|243065322|gb|EES47508.1| penicillin-binding protein [Burkholderia mallei PRL-20]
 gi|254220668|gb|EET10052.1| penicillin-binding protein [Burkholderia pseudomallei 1710a]
          Length = 614

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 141/548 (25%), Positives = 249/548 (45%), Gaps = 31/548 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +  + ++ LA+R              +  +      E   +R  I+DRNG +L
Sbjct: 27  RSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQGESRYQRTLELPATRGKILDRNGLVL 86

Query: 128 ATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V      + ++ L  +L  + ++ ++ KLS +  F +++R++   
Sbjct: 87  ATSLPVRAIWAIPADVPDDLGADKLDALGKLL-GMTTKELKAKLSEDKTFVYVKRQVPLD 145

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGL 240
             +++    +PGV  R E  RFYP     +H++G+ ++++ G  G+E           G 
Sbjct: 146 VAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGFTNVEDEGQEGVELADQKLLVGTPGS 205

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
             V     G             N   + L++D +IQ I +  L    +K++A++   +++
Sbjct: 206 RHVIKDRVGHIVEDVDAQVPPHNGADVGLSIDSKIQYITYTNLKAAVEKFHAKAGAAMVI 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+S+V+ P Y+P++      E   NR+   +FE GSI K FT+++ +D    T 
Sbjct: 266 DVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLTDVFEPGSIMKPFTVSLALDLHRVTP 325

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             L +T N   V              LT+  + + SSNIGA +IA  M  +        +
Sbjct: 326 NTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQKSSNIGATKIAMTMKPEEMWNMYTGI 385

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+RI   T+S+G+GLS +  Q A A  A+ ++G L+P
Sbjct: 386 GLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYGYGLSVSLFQLARAYTAIAHDGELMP 445

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            T    + +        V    T + +R++L   V+  G+   A VPG+ VGGK+GTA K
Sbjct: 446 VTIFKTN-DAQPPTGPRVFSPTTAREVRTMLESVVSPQGTSPNAAVPGYRVGGKSGTAYK 504

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            + + Y       SF+ + P  +P+ +V   +D P          G    P+   I+  +
Sbjct: 505 QVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPTT---GGHFGGQVSGPVFSAIVGDT 561

Query: 587 ASMLGVKP 594
              L V P
Sbjct: 562 LRALNVPP 569


>gi|163854997|ref|YP_001629295.1| peptidoglycan glycosyltransferase [Bordetella petrii DSM 12804]
 gi|163258725|emb|CAP41024.1| peptidoglycan glycosyltransferase [Bordetella petrii]
          Length = 576

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 138/549 (25%), Positives = 244/549 (44%), Gaps = 34/549 (6%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + +++    + +LA R +         +  +             +R  I+DRNG +L
Sbjct: 20  RARLVLLMLFGGFAVLAGRALYLQGLSTEFLQQQGERRYERTLTLSATRGKILDRNGVVL 79

Query: 128 ATDIPTFSLYVEPHKVISPD-EIIEKLQIVLPNLDSEMIRRKL-SSETKFQWLRRKLSPQ 185
           A+ +P  +++  P  V       +  L  +L       +R +L   +  F +L+R++  +
Sbjct: 80  ASSVPARAIWAIPEDVKPATGAQLADLAKLL-ETSVADLRGRLADEDRNFVYLKRQVPME 138

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD-----MQGL 240
              +I    +PG+  + E  R+YP     +H+VG+  I+++G  G+E   +       G 
Sbjct: 139 VADQIKKLDVPGIHQQPETRRYYPDGEVTAHLVGFTSIEDKGQEGVELAFNDLLSGTPGS 198

Query: 241 TRVFTTNKGEK-----------NLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G             N + + L++D R+Q +V +EL E  +K+ A +   +++
Sbjct: 199 RRVIKDRLGRVIEDVQAVTLPVNGRDLNLSIDARLQYLVFRELNEAMQKHQAGAASAIVM 258

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGE++++ S+P +DP+           NR     FE GSI K FT A+ +D G    
Sbjct: 259 DVHTGEILALASLPTFDPNRRETFHAPNLRNRAITDTFEPGSIMKPFTAALALDLGRINA 318

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
              F+T N     +        +N  L +  + R SSNIG   I++ +  +   E    L
Sbjct: 319 STQFETGNGALRYQGSTIHDVSRNGTLNVAGVLRRSSNIGMTLISEKLESREMWERFTEL 378

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           G     +   P            W+ I   T+++G+GLS + LQ A A      +G ++ 
Sbjct: 379 GFGRAPQLGFPGAAPGRLRPWDRWRLIEKATMAYGYGLSVSLLQVARAYTVFARDGDMVS 438

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGV-TGGSGRRAFVPGFEVGGKTGTAQK 526
           PT + R  +     S  V      + +RS+L       G  + A V G+ V GK+GTA+K
Sbjct: 439 PTLVKRDSD---PTSVKVYSPKVAQLIRSMLEAAAGPDG-AKAAQVQGYRVAGKSGTARK 494

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
           ++  +YS     +SF+   P ++P+ +V   +D PK+        G   AP+   I+  S
Sbjct: 495 IVDGKYSTQRYRSSFVGFAPVSNPRIVVAVSIDEPKV---GGYYGGAIAAPVFSTIVGGS 551

Query: 587 ASMLGVKPV 595
             M+GV+P 
Sbjct: 552 LRMMGVQPD 560


>gi|509126|emb|CAA42183.1| penicillin-binding protein 2 [Neisseria meningitidis]
          Length = 584

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 147/559 (26%), Positives = 262/559 (46%), Gaps = 37/559 (6%)

Query: 65  KVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDI 119
           K    S  RI   ++   V++  L  R +         +  +     +       +R  +
Sbjct: 19  KKPMTSNGRISFVLMAIAVLFAGLIARGLYLQTVTYNFLKEQGDNRIVRTQTLPATRGTV 78

Query: 120 IDRNGEILATDIPTFSLYVEPHKVISPDEII--EKLQIVLPNLDSEMIRRKLSSE-TKFQ 176
            DRNG +LA   PT SL+  P ++         E+L   L ++  +++R KL  +   F 
Sbjct: 79  SDRNGAVLALSAPTESLFAVPKEMKEMPSAAQLERLSE-LVDVPVDVLRNKLEQKGKSFI 137

Query: 177 WLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLD 236
           W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E  L+
Sbjct: 138 WIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLE 197

Query: 237 -----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVHQELVENKKK 278
                 +G   V    +G              +N + I L+LD RIQ + ++EL +  + 
Sbjct: 198 DSLHAGEGAEVVLRDREGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEY 257

Query: 279 YNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTI 338
           + A++   V+L+  TGE++++V+ P Y+P++  +   E   NR    + E GS  K F I
Sbjct: 258 HQAKAGTVVVLDARTGEILALVNTPAYEPNKPGQADSEQRRNRAVTDMIEPGSAIKPFVI 317

Query: 339 AMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMG 398
           A  +D+    + +  +T+        V  D H     L +  I + SSN+G ++++    
Sbjct: 318 AKALDAEKTNLNERLNTQPYKIGPAQVRDDTHVYP-SLDVRGIMQKSSNVGTSKLSARFS 376

Query: 399 IQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAA 456
            +   +  + LG+  ++ +  P   A +  +   W+ I   T+SFG+GL  + LQ A A 
Sbjct: 377 SKEMYDLYHELGIGVRMHSGFPGESAGALRNWQKWRPIEQATMSFGYGLQLSLLQLARAY 436

Query: 457 AALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGF 515
             L ++G L+P   +   ++      + + K +T + +R L+      GG+G    V GF
Sbjct: 437 TVLTHDGVLLP---VSFEKQAVAPQGKRIFKASTARQVRELMVSVTEPGGTGTAGAVDGF 493

Query: 516 EVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINV 575
           +VG KTGTA+K++  RY D  +  +F+   P  +P+ IV   +D P     N    G+  
Sbjct: 494 DVGAKTGTARKLVNGRYVDNKHVATFIGFAPAKNPRVIVAVTIDEPTA---NGYYGGVVA 550

Query: 576 APMVGNIIRRSASMLGVKP 594
            P+   ++  S ++LGV P
Sbjct: 551 GPVFKQVMGGSLNILGVSP 569


>gi|313667808|ref|YP_004048092.1| penicillin-binding protein 2 [Neisseria lactamica ST-640]
 gi|313005270|emb|CBN86703.1| penicillin-binding protein 2 [Neisseria lactamica 020-06]
          Length = 581

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 150/568 (26%), Positives = 264/568 (46%), Gaps = 38/568 (6%)

Query: 56  QDLFQKRRRKVIAHSKNRIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNID 110
           + + +  + K    S  RIG  ++   V++  L +R +         +  +     +   
Sbjct: 10  RMISKGEQVKKPLTSDGRIGFVLLAMAVLFAGLIVRGLYLQTVTYNFLKNQGDNQIVRTQ 69

Query: 111 EYGMSRPDIIDRNGEILATDIPTFSLYVEPHKVISPD--EIIEKLQIVLPNLDSEMIRRK 168
               +R  I DRNG +LA   PT SLY  P  +        +E+L   L ++  +++R K
Sbjct: 70  SLPAARGTISDRNGAVLALSAPTESLYAVPKDMEEMPTGAQLEQLSG-LVDVPVDVLRNK 128

Query: 169 LSSE-TKFQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRG 227
           L  +   F W++R+L P+  ++I + GL    F  E  R YP  S  +HV+G+ DID +G
Sbjct: 129 LEQKGKSFIWIKRQLDPKVAEKIDALGLKHFAFEKELKRHYPMGSLFAHVIGFTDIDGKG 188

Query: 228 ITGIEKFLD-----MQGLTRVFTTNKG-------------EKNLQPIRLALDLRIQNIVH 269
             G+E  L+       G   V    +G              +N + I L+LD RIQ + +
Sbjct: 189 QEGLELSLEDSLHGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAY 248

Query: 270 QELVENKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEM 329
           +EL +  + + A++   V+L+  TGE++++ + P Y+P++  +   E   NR    + E 
Sbjct: 249 EELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYEPNKPGQADSEQRRNRAVTDMIEP 308

Query: 330 GSIFKVFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIG 389
           GS  K F IA  +D+G   + +  +T+                   L +  I + SSN+G
Sbjct: 309 GSAIKPFVIAKALDAGKTDLNERLNTQPYKI--GPAPVRDTHVYPSLDVRGIMQKSSNVG 366

Query: 390 AAQIADAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLST 447
            ++++     +   +  + LG+  ++ +  P   A        W+ I   T+SFG+GL  
Sbjct: 367 TSKLSARFSSEEMYDLYHSLGIGVRMHSGFPGESAGVLRDWRKWRPIEQATMSFGYGLQL 426

Query: 448 TPLQTAVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGS 506
           + LQ A A  AL ++G L+P   +   ++      + + K++T + +R+L+      GG+
Sbjct: 427 SLLQLARAYTALTHDGVLLP---VSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGT 483

Query: 507 GRRAFVPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKER 566
           G    V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     
Sbjct: 484 GTAGAVDGFDVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTANS- 542

Query: 567 NQLTAGINVAPMVGNIIRRSASMLGVKP 594
                G+   P    I+  S ++LGV P
Sbjct: 543 --YYGGVVAGPPFKKIMGGSLNILGVSP 568


>gi|312795055|ref|YP_004027977.1| Division specific D,D-transpeptidase / cell division protein ftsI
           [Burkholderia rhizoxinica HKI 454]
 gi|312166830|emb|CBW73833.1| Division specific D,D-transpeptidase / Cell division protein ftsI
           [Burkholderia rhizoxinica HKI 454]
          Length = 596

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 142/549 (25%), Positives = 245/549 (44%), Gaps = 31/549 (5%)

Query: 73  RIGMTIVVCLVIYIILAIRIIQYG-----NIHPEPIAPSMNIDEYGMSRPDIIDRNGEIL 127
           R  + + +  V ++ LA R              +  +      E   +R  I+DRNG +L
Sbjct: 27  RSKLIVFLLFVAFVALAARAFWIQGPGNAFYQKQGESRYQRTIELPATRGKILDRNGLVL 86

Query: 128 ATDIPTFSLYVEPHKVISP--DEIIEKLQIVLPNLDSEMIRRKLSSETKFQWLRRKLSPQ 185
           AT +P  +++  P  V +      + +L  +L  +  + +R KLS +  F +++R++   
Sbjct: 87  ATSLPVRAIWAIPESVPNDLGAGKLAELSKLLS-MGEKALRAKLSQDKTFVYVKRQVPLD 145

Query: 186 QQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDM-----QGL 240
             +++ +  +PG+  R E  RFYP     +H++G+ ++++ G  GIE           G 
Sbjct: 146 VAQKVAALDIPGIYARPEYKRFYPEGEITAHMIGFTNVEDEGQEGIELADQKALAGVPGS 205

Query: 241 TRVFTTNKG-----------EKNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVIL 289
            RV     G            ++ Q I L+LD +IQ I +  L     ++ A++   +++
Sbjct: 206 RRVIKDRIGHIVEDVDEWVKPRDGQDIALSLDSKIQYIAYANLKAAVDRFKAKAGAAIVI 265

Query: 290 NVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTV 349
           +V TGEV+++V+ P Y+P+       E   NR+   +FE GSI K FT+++ +D      
Sbjct: 266 DVKTGEVLALVNYPTYNPNNRSHLTGEQLRNRVLTDVFEPGSIMKPFTVSLALDLHRVLP 325

Query: 350 KDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRL 409
             L DT                   +LT+  + + SSNIGA +IA  +  +        +
Sbjct: 326 TTLVDTGGGRFTLDGATITDDAGFGVLTVGGVIQKSSNIGATKIAMQLRPEEMWNMYTSI 385

Query: 410 GLLSKLETELPEIQAPSYPSQ--WKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIP 467
           GL    +   P   A        W+RI   T+S+G+GLS +  Q   A  A+ ++GR+IP
Sbjct: 386 GLGQAPKVGFPGAAAGRLRPWKSWRRIEQATMSYGYGLSASLFQLGRAYTAIAHDGRIIP 445

Query: 468 PTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQK 526
            T +  +    E     V    T + +R++L      GG+   A VPG+ VGGK+GTA K
Sbjct: 446 LTLIRGN-NGDEPQGTQVFSATTARQVRAMLESVTQPGGTSPDAAVPGYRVGGKSGTAYK 504

Query: 527 VIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRS 586
            + + Y       SF+ + P  +P+ +V   +D P          G    P+   I   +
Sbjct: 505 HVGRGYDRGKYRASFVGMAPMPNPRIVVAVSVDEPTA---GSHFGGQVSGPVFSAIAGDT 561

Query: 587 ASMLGVKPV 595
              L V P 
Sbjct: 562 LRSLNVPPD 570


>gi|15599614|ref|NP_253108.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PAO1]
 gi|107099997|ref|ZP_01363915.1| hypothetical protein PaerPA_01001018 [Pseudomonas aeruginosa PACS2]
 gi|116054422|ref|YP_792764.1| penicillin-binding protein 3 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|254244771|ref|ZP_04938093.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 2192]
 gi|296391127|ref|ZP_06880602.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PAb1]
 gi|313106948|ref|ZP_07793151.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 39016]
 gi|9950650|gb|AAG07806.1|AE004856_17 penicillin-binding protein 3 [Pseudomonas aeruginosa PAO1]
 gi|840842|emb|CAA58872.1| penicillin-binding protein 3 [Pseudomonas aeruginosa PAO1]
 gi|115589643|gb|ABJ15658.1| penicillin-binding protein 3 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126198149|gb|EAZ62212.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 2192]
 gi|310879653|gb|EFQ38247.1| penicillin-binding protein 3 [Pseudomonas aeruginosa 39016]
          Length = 579

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/545 (26%), Positives = 261/545 (47%), Gaps = 31/545 (5%)

Query: 75  GMTIVVCLVIYIILAIRIIQYGNIHPEPIAPSMNIDEYGMSRPDIIDRNGEILATDIPTF 134
            +  +V  +++ I+ + +I +  +  +  A S+        R  I DRNGE LA   P  
Sbjct: 21  LLLAMVGAIVWRIVDLHVIDHDFLKGQGDARSVRHIAIPAHRGLITDRNGEPLAVSTPVT 80

Query: 135 SLYVEPHKVISPDEIIEKLQIVLPNLDSEMIRRKLSSE--TKFQWLRRKLSPQQQKRILS 192
           +L+  P ++++  E   +L   L   D+++   ++      +F +L R L+P+Q + +++
Sbjct: 81  TLWANPKELMTAKERWPQLAAALGQ-DTKLFADRIEQNAEREFIYLVRGLTPEQGEGVIA 139

Query: 193 FGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIEKFLDMQ-----GLTRVFTTN 247
             +PGV    E  RFYPA    +H VG+ D+D+RG  GIE   D       G  +V    
Sbjct: 140 LKVPGVYSIEEFRRFYPAGEVVAHAVGFTDVDDRGREGIELAFDEWLAGVPGKRQVLKDR 199

Query: 248 KGE-----------KNLQPIRLALDLRIQNIVHQELVENKKKYNAESVGTVILNVSTGEV 296
           +G            K  + + L++DLR+Q + H+EL     +  A++   VI++V TGE+
Sbjct: 200 RGRVIKDVQVTKNAKPGKTLALSIDLRLQYLAHRELRNALLENGAKAGSLVIMDVKTGEI 259

Query: 297 ISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDSGLFTVKD-LFDT 355
           ++M + P Y+P+     +     NR    +FE GS  K F+++  + SG +   D +   
Sbjct: 260 LAMTNQPTYNPNNRRNLQPAAMRNRAMIDVFEPGSTVKPFSMSAALASGRWKPSDIVDVY 319

Query: 356 RNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIADAMGIQGHKEFLYRLGLLSKL 415
              +++G++ I D    +R L +  I   SSN+G ++IA  +G +     + ++GL    
Sbjct: 320 PGTLQIGRYTIRDVSRNSRQLDLTGILIKSSNVGISKIAFDIGAESIYSVMQQVGLGQDT 379

Query: 416 ETELPEIQAPS--YPSQWKRIHSLTISFGHGLSTTPLQTAVAAAALINEGRLIPPTFMIR 473
               P  +  +     +W +  + T+++G+GLS T +Q A A AAL N+G+ +P +    
Sbjct: 380 GLGFPGERVGNLPNHRKWPKAETATLAYGYGLSVTAIQLAHAYAALANDGKSVPLSMTRV 439

Query: 474 SREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAFVPGFEVGGKTGTAQKVIKK-- 530
            R         V+      T++ +L++ V   G   RA VPG+   GK+GTA+KV     
Sbjct: 440 DRVPDGV---QVISPEVASTVQGMLQQVVEAQGGVFRAQVPGYHAAGKSGTARKVSVGTK 496

Query: 531 RYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTAGINVAPMVGNIIRRSASML 590
            Y +    + F    P TDP+  ++  +D P    +     G+  AP+   ++  +  ++
Sbjct: 497 GYRENAYRSLFAGFAPATDPRIAMVVVIDEP---SKAGYFGGLVSAPVFSKVMAGALRLM 553

Query: 591 GVKPV 595
            V P 
Sbjct: 554 NVPPD 558


>gi|218893509|ref|YP_002442378.1| penicillin-binding protein 3 [Pseudomonas aeruginosa LESB58]
 gi|218773737|emb|CAW29551.1| penicillin-binding protein 3 [Pseudomonas aeruginosa LESB58]
          Length = 579

 Score =  372 bits (956), Expect = e-101,   Method: Composition-based stats.
 Identities = 144/545 (26%), Positives = 261/545 (47%), Gaps = 31/54