RPSBLAST alignment of GI: 254781103 and protein with PDBid: 3equ

>3equ_A PBP-2, penicillin-binding protein 2; class B transpeptidase, cell division, cell inner membrane, cell membrane, cell shape; HET: SEP; 2.40A {Neisseria gonorrhoeae} PDB: 3eqv_A* Length = 542
 Score =  210 bits (533), Expect = 9e-55
 Identities = 139/503 (27%), Positives = 244/503 (48%), Gaps = 31/503 (6%)

Query: 115 SRPDIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKLQIV-LPNLDSEMIRRKLSSET 173
           +R  + DRNG +LA   PT SL+  P  +       +  ++  L ++  +++R KL  + 
Sbjct: 35  TRGTVSDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSELVDVPVDVLRNKLEQKG 94

Query: 174 K-FQWLRRKLSPQQQKRILSFGLPGVGFRLEKSRFYPAASHASHVVGYVDIDNRGITGIE 232
           K F W++R+L P+  + + + GL    F  E  R YP  +  +HV+G+ DID +G  G+E
Sbjct: 95  KSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLE 154

Query: 233 KFLDMQGLTRVFT------------------TNKGEKNLQPIRLALDLRIQNIVHQELVE 274
             L+                            NK  +N + I L+LD RIQ + ++EL +
Sbjct: 155 LSLEDSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNK 214

Query: 275 NKKKYNAESVGTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFK 334
             + + A++   V+L+  TGE++++ + P YDP+   +   E   NR    + E GS  K
Sbjct: 215 AVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIK 274

Query: 335 VFTIAMGIDSGLFTVKDLFDTRNPIKVGKHVIHDYHPQNRILTIPEIFRYSSNIGAAQIA 394
            F IA  +D+G   + +  +T+                   L +  I + SSN+G ++++
Sbjct: 275 PFVIAKALDAGKTDLNERLNTQPYKI--GPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLS 332

Query: 395 DAMGIQGHKEFLYRLGLLSKLETELPEIQAPSYP--SQWKRIHSLTISFGHGLSTTPLQT 452
              G +   +F + LG+  ++ +  P   A       +W+ I   T+SFG+GL  + LQ 
Sbjct: 333 ARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQL 392

Query: 453 AVAAAALINEGRLIPPTFMIRSREESEKVSRIVLKKNTVKTMRSLLREGVT-GGSGRRAF 511
           A A  AL ++G L+P +F    ++      + + K++T + +R+L+      GG+G    
Sbjct: 393 ARAYTALTHDGVLLPLSFE---KQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGA 449

Query: 512 VPGFEVGGKTGTAQKVIKKRYSDTLNFNSFLAVFPTTDPQYIVLSFMDSPKIKERNQLTA 571
           V GF+VG KTGTA+K +  RY+D  +  +F+   P  +P+ IV   +D P     +    
Sbjct: 450 VDGFDVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPT---AHGYYG 506

Query: 572 GINVAPMVGNIIRRSASMLGVKP 594
           G+   P    I+  S ++LG+ P
Sbjct: 507 GVVAGPPFKKIMGGSLNILGISP 529