BLAST/BLAST alignment of GI: 254781103 and GI: 254780752
>gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817
 Score = 38.9 bits (89), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 79/198 (39%), Gaps = 43/198 (21%)

Query: 285 GTVILNVSTGEVISMVSIPDYDPHEAFKGKKEGWFNRISYGIFEMGSIFKVFTIAMGIDS 344
           G + ++  TG +++ +    Y   E         FNR +  + + GS FK    A  +DS
Sbjct: 442 GLIAMDPRTGRILATIGGFSYSQSE---------FNRSTQAMRQPGSCFKPIVYAAALDS 492

Query: 345 GLFTVKDLFDTRNPIKV---GKHVIHDYHPQN--RILTIPEIFRY----SSNIGAAQIAD 395
           G      + D   PI+V   GK     + P+N  +  +     R+    S N+   ++A 
Sbjct: 493 GYTPASVIMDA--PIEVVSRGKI----WKPENYSKNFSGASTLRFGLEKSRNLMTVRLAH 546

Query: 396 AMGIQGHKEFLYRLGLLSKLETELPEIQAPSYPSQWKRIHSLTISFGHGLSTTPLQTAVA 455
            MG+    ++    G+  K+   LP                  +S G G  TT L+   A
Sbjct: 547 NMGMTVVADYAENFGIYDKMLPVLP------------------MSLGAG-ETTVLRMVSA 587

Query: 456 AAALINEGRLIPPTFMIR 473
            A   N G+ I P+F+ R
Sbjct: 588 YAVFANGGKQIRPSFIDR 605