RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >gnl|CDD|166660 PLN03019, PLN03019, carbonic anhydrase. Length = 330 Score = 31.3 bits (70), Expect = 0.069 Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 2/62 (3%) Query: 37 LENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKEL--QLQATNPINLITYDDLARL 94 LE + ++Y D ++A LLI+ D +KD+ + K++ +LQA + + ++D + R+ Sbjct: 68 LELRRMGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKSFDPVERI 127 Query: 95 KK 96 K+ Sbjct: 128 KE 129 >gnl|CDD|183125 PRK11413, PRK11413, putative hydratase; Provisional. Length = 751 Score = 28.4 bits (64), Expect = 0.55 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Query: 18 TITYSI--KHETEGKKEKLRILENKITS 43 TI +SI H T G +KL+I + + S Sbjct: 36 TIAWSILSSHNTSGNMDKLKIKFDSLAS 63 >gnl|CDD|178611 PLN03051, PLN03051, acyl-activating enzyme; Provisional. Length = 499 Score = 27.1 bits (60), Expect = 1.3 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 6/59 (10%) Query: 63 RIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKEI 121 R + L +Q+ +Q NP+ ++ R+K LP N SN R V R Q +KE+ Sbjct: 441 RPEALQKKFQEAIQ-TNLNPLFKVS-----RVKIVPELPRNASNKLLRRVLRDQLKKEL 493 >gnl|CDD|178011 PLN02385, PLN02385, hydrolase; alpha/beta fold family protein. Length = 349 Score = 27.0 bits (60), Expect = 1.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 65 KDLVSLYQKELQLQATNPINLITYDDLARLK 95 KDL L ++L+ + N+I Y D RL+ Sbjct: 229 KDLAELAFRDLKKRKMAEYNVIAYKDKPRLR 259 >gnl|CDD|167268 PRK01741, PRK01741, cell division protein ZipA; Provisional. Length = 332 Score = 25.5 bits (56), Expect = 4.0 Identities = 9/40 (22%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Query: 7 FIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQN 46 IILG++ + + I ++EK + N T + Sbjct: 7 LIILGILALVALVAHGI---WSNRREKSQYFSNANTFTRT 43 >gnl|CDD|116052 pfam07431, DUF1512, Protein of unknown function (DUF1512). This family consists of several archaeal proteins of around 370 residues in length. The function of this family is unknown. Length = 356 Score = 25.4 bits (56), Expect = 4.1 Identities = 20/89 (22%), Positives = 42/89 (47%), Gaps = 11/89 (12%) Query: 7 FIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKD 66 F +L ++L I + Y + + EG +L N +++ ++LLK + KD Sbjct: 13 FFLLIILLQRIQV-YRLFRDIEGALSELEKFLND--AKKKVVELLK--------KEGAKD 61 Query: 67 LVSLYQKELQLQATNPINLITYDDLARLK 95 SL ++ + +P++L ++RL+ Sbjct: 62 AESLVERYAEFFVIDPVDLDPTGIISRLR 90 >gnl|CDD|129483 TIGR00388, glyQ, glycyl-tRNA synthetase, tetrameric type, alpha subunit. This tetrameric form of glycyl-tRNA synthetase (2 alpha, 2 beta) is found in the majority of completed eubacterial genomes, with the two genes fused in a few species. A substantially different homodimeric form (not recognized by this model) replaces this form in the Archaea, animals, yeasts, and some eubacteria. Length = 293 Score = 24.8 bits (54), Expect = 6.4 Identities = 9/29 (31%), Positives = 13/29 (44%) Query: 61 PDRIKDLVSLYQKELQLQATNPINLITYD 89 D + L Y+KE Q N + L Y+ Sbjct: 210 VDFLFQLFKQYEKEAQQLLENGLPLPAYE 238 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.318 0.135 0.367 Gapped Lambda K H 0.267 0.0753 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,008,147 Number of extensions: 116534 Number of successful extensions: 263 Number of sequences better than 10.0: 1 Number of HSP's gapped: 263 Number of HSP's successfully gapped: 30 Length of query: 125 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 43 Effective length of database: 4,222,617 Effective search space: 181572531 Effective search space used: 181572531 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.4 bits)