RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 1llc_A* (A:1-150,A:231-293) Length = 213 Score = 26.1 bits (57), Expect = 1.7 Identities = 14/60 (23%), Positives = 26/60 (43%), Gaps = 6/60 (10%) Query: 45 QNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENR 104 + +DL+ I + +V + L A NP++++TY K + P+NR Sbjct: 92 ETRLDLVNKNLK--ILKSIVDPIVDSGFNGIFLVAANPVDILTY----ATWKLSGFPKNR 145 >1u83_A Phosphosulfolactate synthase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, lyase; 2.20A {Bacillus subtilis} (A:) Length = 276 Score = 25.4 bits (56), Expect = 2.4 Identities = 8/40 (20%), Positives = 20/40 (50%) Query: 34 LRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQK 73 L+ ++ I +YID +K W + +++ +S ++ Sbjct: 52 LQFFKDAIAGASDYIDFVKFGWGTSLLTKDLEEKISTLKE 91 >2vga_A Protein A41, A41; immunomodulator, chemokine binding protein, glycoprotein, viral protein, early protein; 1.9A {Vaccinia virus} (A:) Length = 207 Score = 24.3 bits (52), Expect = 5.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 80 TNPINLITYDDLARLKKHTLL 100 T PIN +T+DDL +L + ++ Sbjct: 94 TEPINSMTHDDLVKLTEECIV 114 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.318 0.135 0.367 Gapped Lambda K H 0.267 0.0441 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 876,432 Number of extensions: 34826 Number of successful extensions: 118 Number of sequences better than 10.0: 1 Number of HSP's gapped: 118 Number of HSP's successfully gapped: 21 Length of query: 125 Length of database: 4,956,049 Length adjustment: 75 Effective length of query: 50 Effective length of database: 2,420,674 Effective search space: 121033700 Effective search space used: 121033700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.8 bits)