RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 Score = 28.8 bits (64), Expect = 0.13 Identities = 20/123 (16%), Positives = 33/123 (26%), Gaps = 26/123 (21%) Query: 8 IILGVVLASITITYSIKHETEGKKEKLR-----ILENKITSEQNYIDLLKAQWALL---- 58 + + S Y I T G L + + E L A L+ Sbjct: 20 LKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSGEDATPALEGADVVLISAGV 79 Query: 59 -----------------IQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLP 101 I + ++ + K TNP+N LKK + Sbjct: 80 RRKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAGVYD 139 Query: 102 ENR 104 +N+ Sbjct: 140 KNK 142 >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 Score = 28.8 bits (64), Expect = 0.15 Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 6/60 (10%) Query: 45 QNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENR 104 ++ +DL+ I +K +V + L A NP++++TY K + P+ R Sbjct: 88 ESRLDLVNKNLN--ILSSIVKPVVDSGFDGIFLVAANPVDILTY----ATWKFSGFPKER 141 >d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 251 Score = 28.5 bits (64), Expect = 0.20 Identities = 10/42 (23%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query: 34 LRILENKITSEQNYIDLLKAQW--ALLIQPDRIKDLVSLYQK 73 + +E+ + +YID +K W + +I D +K+ ++ Y+ Sbjct: 25 PKFVEDYLKVCGDYIDFVKFGWGTSAVIDRDVVKEKINYYKD 66 >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 Score = 28.1 bits (62), Expect = 0.22 Identities = 6/46 (13%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Query: 59 IQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENR 104 + + +++ + + TNP++++TY K + + + Sbjct: 95 VMKEIARNVSKYAPDSIVIVVTNPVDVLTY----FFLKESGMDPRK 136 >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 Score = 27.3 bits (60), Expect = 0.39 Identities = 7/26 (26%), Positives = 11/26 (42%) Query: 79 ATNPINLITYDDLARLKKHTLLPENR 104 +NP+N KKH + N+ Sbjct: 116 ISNPVNSTIPITAEVFKKHGVYNPNK 141 >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 Score = 26.6 bits (58), Expect = 0.62 Identities = 11/86 (12%), Positives = 31/86 (36%), Gaps = 25/86 (29%) Query: 40 KITSEQNYIDLLKAQWALL---------------------IQPDRIKDLVSLYQKELQLQ 78 K+T +Y D + ++ I + +++ + + + Sbjct: 57 KVTGSNDYADTANSDIVIITAGLPRKPGMTREDLLMKNAGIVKEVTDNIMKHSKNPIIIV 116 Query: 79 ATNPINLITYDDLARLKKHTLLPENR 104 +NP++++T+ + LP+ R Sbjct: 117 VSNPLDIMTH----VAWVRSGLPKER 138 >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 Score = 26.6 bits (58), Expect = 0.62 Identities = 15/63 (23%), Positives = 24/63 (38%), Gaps = 6/63 (9%) Query: 42 TSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLP 101 +DL I D K +V + L TNP++++TY + K + P Sbjct: 82 KPGMTRLDLAHKNAG--IIKDIAKKIVENAPESKILVVTNPMDVMTY----IMWKESGKP 135 Query: 102 ENR 104 N Sbjct: 136 RNE 138 >d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} Length = 249 Score = 26.6 bits (59), Expect = 0.75 Identities = 8/40 (20%), Positives = 20/40 (50%) Query: 34 LRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQK 73 L+ ++ I +YID +K W + +++ +S ++ Sbjct: 28 LQFFKDAIAGASDYIDFVKFGWGTSLLTKDLEEKISTLKE 67 >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 Score = 26.6 bits (58), Expect = 0.75 Identities = 9/66 (13%), Positives = 24/66 (36%), Gaps = 6/66 (9%) Query: 39 NKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHT 98 + + LK +++ +L + + +NP+++IT + T Sbjct: 83 QQDNPTGDRFAELKFTSSMVQ--SVGTNLKESGFHGVLVVISNPVDVITA----LFQHVT 136 Query: 99 LLPENR 104 P ++ Sbjct: 137 GFPAHK 142 >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 Score = 25.7 bits (56), Expect = 1.3 Identities = 4/26 (15%), Positives = 10/26 (38%), Gaps = 4/26 (15%) Query: 79 ATNPINLITYDDLARLKKHTLLPENR 104 +NP++L+ L + + Sbjct: 118 TSNPVDLLNR----HLYEAGDRSREQ 139 >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 Score = 25.4 bits (55), Expect = 1.5 Identities = 17/88 (19%), Positives = 35/88 (39%), Gaps = 6/88 (6%) Query: 17 ITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQ 76 + I + + + + +DL+ A I ++ +++ + L Sbjct: 62 VDIWHGDYDDCRDADLVVICAGANQKPGETRLDLVDKNIA--IFRSIVESVMASGFQGLF 119 Query: 77 LQATNPINLITYDDLARLKKHTLLPENR 104 L ATNP++++TY K + LP R Sbjct: 120 LVATNPVDILTY----ATWKFSGLPHER 143 >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 Score = 25.0 bits (54), Expect = 2.2 Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 6/67 (8%) Query: 38 ENKITSEQNYIDLLKAQWALLIQPDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKH 97 ++ S Q +DLL+ A I + ++ + TNP++++TY + K Sbjct: 96 GARMVSGQTRLDLLQRNVA--IMKAIVPGVIQNSPDCKIIVVTNPVDILTY----VVWKI 149 Query: 98 TLLPENR 104 + P R Sbjct: 150 SGFPVGR 156 >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 Score = 23.9 bits (51), Expect = 4.0 Identities = 6/41 (14%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Query: 64 IKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENR 104 +++ K + TNP++ + + + + +P N Sbjct: 114 GQNIKKYCPKTFIIVVTNPLDCMVKV----MCEASGVPTNM 150 >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 Score = 23.8 bits (51), Expect = 4.9 Identities = 8/38 (21%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Query: 63 RIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLL 100 RI++ V+ Y++ + + +D+ +HT L Sbjct: 9 RIEEAVAKYREFYEFKPVR--ESAGIEDVKSAIEHTNL 44 >d2j0pa1 e.62.1.1 (A:4-341) Hemin transport protein HemS {Yersinia enterocolitica [TaxId: 630]} Length = 338 Score = 23.2 bits (50), Expect = 7.6 Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 69 SLYQKELQLQATNP 82 S+Y++ LQ +A NP Sbjct: 1 SIYEQYLQAKADNP 14 >d2hq2a1 e.62.1.1 (A:1-337) Heme oxygenase ChuS {Escherichia coli O157:H7 [TaxId: 83334]} Length = 337 Score = 23.2 bits (50), Expect = 7.6 Identities = 5/15 (33%), Positives = 10/15 (66%) Query: 68 VSLYQKELQLQATNP 82 ++ Y + L+L+ NP Sbjct: 1 MNHYTRWLELKEQNP 15 >d1joga_ a.24.16.2 (A:) Hypothetical protein HI0074 {Haemophilus influenzae [TaxId: 727]} Length = 135 Score = 23.0 bits (49), Expect = 8.9 Identities = 6/35 (17%), Positives = 16/35 (45%) Query: 34 LRILENKITSEQNYIDLLKAQWALLIQPDRIKDLV 68 L +L+ S + + + + +QP ++D + Sbjct: 2 LNVLDAAFYSLEQTVVQISDRNWFDMQPSIVQDTL 36 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.135 0.367 Gapped Lambda K H 0.267 0.0552 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 440,836 Number of extensions: 18696 Number of successful extensions: 73 Number of sequences better than 10.0: 1 Number of HSP's gapped: 73 Number of HSP's successfully gapped: 27 Length of query: 125 Length of database: 2,407,596 Length adjustment: 75 Effective length of query: 50 Effective length of database: 1,377,846 Effective search space: 68892300 Effective search space used: 68892300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (22.7 bits)