BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] (125 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781104|ref|YP_003065517.1| hypothetical protein CLIBASIA_05030 [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 250 bits (639), Expect = 5e-69, Method: Compositional matrix adjust. Identities = 125/125 (100%), Positives = 125/125 (100%) Query: 1 MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ 60 MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ Sbjct: 1 MFKTLDFIILGVVLASITITYSIKHETEGKKEKLRILENKITSEQNYIDLLKAQWALLIQ 60 Query: 61 PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKE 120 PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKE Sbjct: 61 PDRIKDLVSLYQKELQLQATNPINLITYDDLARLKKHTLLPENRSNLPKRTVERRQHRKE 120 Query: 121 IVQQQ 125 IVQQQ Sbjct: 121 IVQQQ 125 >gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 954 Score = 27.7 bits (60), Expect = 0.071, Method: Compositional matrix adjust. Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 53 AQWALLIQPDRIKDLVSLYQKELQLQATN 81 A W L PD + DL LY KE ++ N Sbjct: 497 AGWTLF-SPDEVSDLHDLYGKEFEIAYEN 524 >gi|254780612|ref|YP_003065025.1| putative transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 503 Score = 21.9 bits (45), Expect = 3.5, Method: Compositional matrix adjust. Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 106 NLPKRTVERRQH 117 NLP+ T ERR H Sbjct: 14 NLPENTPERRSH 25 >gi|254780881|ref|YP_003065294.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 21.6 bits (44), Expect = 4.4, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 7 FIILGVVLASITITYSIKHETEG 29 FI+ V SIT+ ++I H+ + Sbjct: 35 FIVHNTVYLSITVPHTIAHQLQS 57 >gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 21.6 bits (44), Expect = 4.4, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 14/23 (60%) Query: 7 FIILGVVLASITITYSIKHETEG 29 FI+ V SIT+ ++I H+ + Sbjct: 35 FIVHNTVYLSITVPHTIAHQLQS 57 >gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 21.6 bits (44), Expect = 4.8, Method: Compositional matrix adjust. Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 94 LKKHTLLPENR 104 + KHT+LPE R Sbjct: 193 INKHTILPEER 203 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 20.8 bits (42), Expect = 8.6, Method: Composition-based stats. Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 8/42 (19%) Query: 34 LRILEN------KITSEQNYIDLLKAQWALLIQPD-RIKDLV 68 ++I EN + SE+ Y++L Q A+L PD R KD++ Sbjct: 1 MKIFENIPQVIGEALSERGYVNLTSVQEAIL-NPDLREKDVL 41 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.135 0.367 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,861 Number of Sequences: 1233 Number of extensions: 2887 Number of successful extensions: 13 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 10 length of query: 125 length of database: 328,796 effective HSP length: 64 effective length of query: 61 effective length of database: 249,884 effective search space: 15242924 effective search space used: 15242924 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 33 (17.3 bits)