HHsearch alignment for GI: 254781108 and conserved domain: COG2425

>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only].
Probab=97.89  E-value=0.0004  Score=43.11  Aligned_cols=125  Identities=14%  Similarity=0.170  Sum_probs=73.7

Q ss_pred             EEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCC
Q ss_conf             34654126776543112356899999999735778887445889999999611346666656676666516998158877
Q gi|254781108|r  237 RIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN  316 (398)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~k~iillTDG~~  316 (398)
T Consensus       310 ~~~~~lF~s~~~~~el~~k~~~~~e~i~fL~~~f-~GGTD~~~~l~~al~~~k~~~~~~----------adiv~ITDg~~  378 (437)
T COG2425         310 DCYVILFDSEVIEYELYEKKIDIEELIEFLSYVF-GGGTDITKALRSALEDLKSRELFK----------ADIVVITDGED  378 (437)
T ss_pred             CEEEEEECCCCEEEEECCCCCCHHHHHHHHHHHC-CCCCCHHHHHHHHHHHHHCCCCCC----------CCEEEEECCHH
T ss_conf             5389995252025550577457999999996506-898885899999999864366567----------77899804376


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCC-EEEECCHHHHHHHHHHH
Q ss_conf             87777766314899999999789889999954797558999998519981-89946989999999999
Q gi|254781108|r  317 SGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQ-FFAVNDSRELLESFDKI  383 (398)
Q Consensus       317 ~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~~-yy~a~~~~~L~~aF~~I  383 (398)
T Consensus       379 ~~~-----~~~~~~v~e~~k~~~~rl~aV~I~~--~~~~~l~~Is---d~~i~~~~~~-~~~kv~~~~  435 (437)
T COG2425         379 ERL-----DDFLRKVKELKKRRNARLHAVLIGG--YGKPGLMRIS---DHIIYRVEPR-DRVKVVKRW  435 (437)
T ss_pred             HHH-----HHHHHHHHHHHHHHHCEEEEEEECC--CCCCCCCEEC---EEEEEEECCH-HHHHHHHCC
T ss_conf             654-----6789999999887543489999647--8986600011---1467872747-776777344