HHsearch alignment of GI: 254781108 and MMDB domain: 1q0p_A_

>1q0p_A (A:) Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens}
Probab=99.70  E-value=2.8e-16  Score=115.64  Aligned_cols=195  Identities=21%  Similarity=0.224  Sum_probs=135.3

Q ss_pred             CCCCCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHH
Q ss_conf             45565431357505566666676663101233102301268876540310134322011255533341000245665541
Q gi|254781108|r  143 SENLAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVN  222 (398)
Q Consensus       143 ~~~~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~  222 (398)
                      ....++|+++|+|.||||...                                             +++..+.++..+++
T Consensus        11 ~~~~~~div~viD~SgSM~~~---------------------------------------------~~~~~k~a~~~~~~   45 (223)
T 1q0p_A           11 DPSGSMNIYLVLDGSDSIGAS---------------------------------------------NFTGAKKSLVNLIE   45 (223)
T ss_dssp             ----CEEEEEEEECSTTTCHH---------------------------------------------HHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHH
T ss_conf             899987799999488889828---------------------------------------------99999999999999


Q ss_pred             HHHHCCCCCCCCCEEEEEEECCCCCCCCC--CCCCCCCHHHHHHHHHCCC-----CCCCCCHHHHHHHHHHHHCCCCCCC
Q ss_conf             02202768776521346541267765431--1235689999999973577-----8887445889999999611346666
Q gi|254781108|r  223 SIQKAIQEKKNLSVRIGTIAYNIGIVGNQ--CTPLSNNLNEVKSRLNKLN-----PYENTNTYPAMHHAYRELYNEKESS  295 (398)
Q Consensus       223 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~lt~~~~~~~~~I~~l~-----~~G~T~~~~gl~~a~~~l~~~~~~~  295 (398)
                      .+.....     ..+.+.+.|........  ....+.........+..+.     +.|+|+++.++.++.+.+.......
T Consensus        46 ~~~~~~~-----~~rv~iv~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gt~~~~al~~a~~~~~~~~~~~  120 (223)
T 1q0p_A           46 KVASYGV-----KPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVP  120 (223)
T ss_dssp             HHHTTTC-----CCEEEEEEESSSEEEEECTTSGGGGCHHHHHHHHHTCCTTSCSCTTCCCHHHHHHHHHHHHCCTTSSC
T ss_pred             HHHCCCC-----CCEEEEEEECCCEEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             7544798-----85899999779459999825653011788888764212023578898679999999999987401246


Q ss_pred             CCCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHH-------HHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCC---
Q ss_conf             65667666651699815887787777766314899-------99999978988999995479755899999851998---
Q gi|254781108|r  296 HNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQ-------ICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG---  365 (398)
Q Consensus       296 ~~~~~~~~~~k~iillTDG~~~~~~~~~~~~~~~~-------~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~---  365 (398)
                      ..  ..+..+|+||++|||..+.............       ....+++.|+.+|+||+|. ..+..+|+.+|+.++   
T Consensus       121 ~~--~~~~~~~~iil~tdG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~ig~g~-~~~~~~L~~iA~~~~g~~  197 (223)
T 1q0p_A          121 PE--GWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGP-LVNQVNINALASKKDNEQ  197 (223)
T ss_dssp             CT--TGGGCEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCSCBTTBCCGGGEEEEEEECSS-CCCHHHHHHHSCCCTTCC
T ss_pred             CC--CCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCC-CCCHHHHHHHHCCCCCCE
T ss_conf             66--667775289997278766789807899999886667899999986698069874687-579999999980889972


Q ss_pred             CEEEECCHHHHHHHHHHHHHHHHHC
Q ss_conf             1899469899999999999987512
Q gi|254781108|r  366 QFFAVNDSRELLESFDKITDKIQEQ  390 (398)
Q Consensus       366 ~yy~a~~~~~L~~aF~~I~~~i~~~  390 (398)
                      +||.+.+.++|.++|++|.+.|.+.
T Consensus       198 ~~~~~~~~~~l~~~~~~i~~~i~~v  222 (223)
T 1q0p_A          198 HVFKVKDMENLEDVFYQMIDESQSL  222 (223)
T ss_dssp             CEEETTC-----------------C
T ss_pred             EEEEECCHHHHHHHHHHHHHHHCCC
T ss_conf             7999399999999999998750578