HHsearch alignment of GI: 254781108 and MMDB domain: 1rrk_A_1-214

>1rrk_A (A:1-214) Complement factor B; BB, hydrolase; 2.00A {Homo sapiens}
Probab=99.75  E-value=1.9e-17  Score=122.73  Aligned_cols=193  Identities=19%  Similarity=0.171  Sum_probs=135.8

Q ss_pred             CCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             43135750556666667666310123310230126887654031013432201125553334100024566554102202
Q gi|254781108|r  148 ISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQKA  227 (398)
Q Consensus       148 ~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~  227 (398)
                      +|+++|+|.||||...                                             +++..+.++..+++.+...
T Consensus         2 lDvv~viD~SgSM~~~---------------------------------------------~~~~~k~~~~~~i~~l~~~   36 (214)
T 1rrk_A            2 MNIYLVLDGSDSIGAS---------------------------------------------NFTGAKKVLVNLIEKVASY   36 (214)
T ss_dssp             EEEEEEEECSTTTCHH---------------------------------------------HHHHHHHHHHHHHHHHHHT
T ss_pred             EEEEEEEECCCCCCHH---------------------------------------------HHHHHHHHHHHHHHHCCCC
T ss_conf             3499999377889868---------------------------------------------9999999999999847678


Q ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCC--CCCCCHHHHHHHH-----HCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             76877652134654126776543112--3568999999997-----3577888744588999999961134666665667
Q gi|254781108|r  228 IQEKKNLSVRIGTIAYNIGIVGNQCT--PLSNNLNEVKSRL-----NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIG  300 (398)
Q Consensus       228 ~~~~~~~~~~~~~~~~~~~~~~~~~~--~lt~~~~~~~~~I-----~~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~  300 (398)
                      ..     ..+.+++.|+.........  ........+...+     +...+.|+|+++.+|.++.+.+.........  .
T Consensus        37 ~~-----~~rv~iv~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~~~~al~~a~~~~~~~~~~~~~--~  109 (214)
T 1rrk_A           37 GV-----KPRYGLVTYATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPE--G  109 (214)
T ss_dssp             TC-----CCEEEEEEESSSEEEEECTTSGGGGCHHHHHHHHHHCCGGGSCCTTCCCHHHHHHHHHHHHCCC--------C
T ss_pred             CC-----CEEEEEEEECCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCC--C
T ss_conf             99-----6199999988816899817987756899999999717557876888768999999999997641124765--5


Q ss_pred             CCCCCEEEEECCCCCCCCCCCCCCCHHH-------HHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCC---CEEEE
Q ss_conf             6666516998158877877777663148-------9999999978988999995479755899999851998---18994
Q gi|254781108|r  301 STRLKKFVIFITDGENSGASAYQNTLNT-------LQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSG---QFFAV  370 (398)
Q Consensus       301 ~~~~~k~iillTDG~~~~~~~~~~~~~~-------~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~---~yy~a  370 (398)
                      .++.+|+|||+|||..+.+.........       ...+..+|+.||.||+||+|. ..+..+|+..|..++   +||.+
T Consensus       110 ~~~~~~~iiliTDG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~~igig~-~~~~~~l~~ia~~~~g~~~~~~~  188 (214)
T 1rrk_A          110 WNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGP-LVNQVNINALASKKDNEQHVCKV  188 (214)
T ss_dssp             GGGCEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCSSCC-CCCGGGEEEEEEECSS-SCCHHHHHHHSCCCTTCCCEEET
T ss_pred             CCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEEEEECCCC-CCCHHHHHHHHHCCCCCCCEEEC
T ss_conf             56887699999797566789848999999987888888887876794999834777-57999999775257876561665


Q ss_pred             CCHHHHHHHHHHHHHHHHHCEEE
Q ss_conf             69899999999999987512457
Q gi|254781108|r  371 NDSRELLESFDKITDKIQEQSVR  393 (398)
Q Consensus       371 ~~~~~L~~aF~~I~~~i~~~r~~  393 (398)
                      .+.++|.++|++|.++|.+..++
T Consensus       189 ~~~~~l~~~~~~i~~~l~~~~~~  211 (214)
T 1rrk_A          189 KDMECLEDVFYQMIDESQSLSLC  211 (214)
T ss_dssp             TCHHHHHHHHHHHSCGGGGTTCT
T ss_pred             CCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             99999999998764324543234