HHsearch alignment of GI: 254781108 and MMDB domain: 3k6s_B_102-342

>3k6s_B (B:102-342) Integrin beta-2; hetero dimer, cell receptor, adhesion molecule, calcium, cell adhesion, disulfide bond, glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B*
Probab=99.13  E-value=6e-11  Score=83.69  Aligned_cols=113  Identities=16%  Similarity=0.090  Sum_probs=70.0

Q ss_pred             CCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCC------
Q ss_conf             11235689999999973577888744588999999961134666665667666651699815887787777766------
Q gi|254781108|r  251 QCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQN------  324 (398)
Q Consensus       251 ~~~~lt~~~~~~~~~I~~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~~~~k~iillTDG~~~~~~~~~~------  324 (398)
                      ...+++.+...+..+|+.+.+.||++..+++..|..........    ...++..|+|||+|||..........      
T Consensus        83 ~~~~~t~~~~~~~~~i~~~~a~GGgD~~E~~~~al~~a~~~~~~----~~~~~~~k~iilitDa~~h~~~~~~~~~~~~~  158 (241)
T 3k6s_B           83 HVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEE----IGWRNVTRLLVFATDDGFHFAGDGKLGAILTP  158 (241)
T ss_dssp             EEEEEESCSHHHHHHHHTSCCCCCSSSSCCHHHHHHHHTTCHHH----HCCCSSCCEEEEECSSCCCCTTGGGGGTCCCC
T ss_pred             EECCCCCCHHHHHHHHHHEECCCCCCCCCCCHHHHHHHHEECCC----CCCCCCEEEEEEECCCCCCCCCCCCEEEEECC
T ss_conf             32467667899999986346215877876214243321000232----34325438999986687320566520236427


Q ss_pred             -------------------CHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHC-CCCCEEEE
Q ss_conf             -------------------31489999999978988999995479755899999851-99818994
Q gi|254781108|r  325 -------------------TLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTD-SSGQFFAV  370 (398)
Q Consensus       325 -------------------~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs-~~~~yy~a  370 (398)
                                         ........+.++.+++..+.+.-+   ....+++..+. .++.++..
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~l~~~~~~~~~~~  221 (241)
T 3k6s_B          159 NDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTS---RMVKTYEKLTEIIPKSAVGE  221 (241)
T ss_dssp             CCSCCCCSSSBCSSGGGSCCCCGGGHHHHHHHTTCBCCEEECG---GGHHHHHHHHHHSSSCCEEE
T ss_pred             CCCCEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECC---CHHHHHHHHHHHCCCCEEEE
T ss_conf             8885375588445677577888899999998629469999644---22669999987568634776